Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR050C5.251ON47547524270.0
Ecym_82505.251ON45645622090.0
Kpol_1032.875.251ON46446421050.0
SAKL0G11484g5.251ON45645820840.0
TDEL0E037505.251ON47147220790.0
KAFR0H036305.251ON44845320650.0
NCAS0F023005.251ON47447420620.0
TPHA0B025505.251ON46346420580.0
KLTH0G07524g5.251ON44545320550.0
CAGL0E06490g5.251ON47247220580.0
TBLA0C030405.251ON46847020570.0
ZYRO0A10560g5.251ON46846820390.0
Skud_11.825.251ON46846920210.0
YKL145W (RPT1)5.251ON46746820180.0
Smik_11.915.251ON46846920170.0
Suva_11.805.251ON47147219820.0
KLLA0E13773g5.251ON47547719730.0
KNAG0H023005.251ON47747719640.0
Kwal_23.28495.251ON40941319160.0
NDAI0C037805.251ON38539116890.0
Suva_7.2274.57ON4053118061e-103
Skud_7.2364.57ON4053118031e-102
Smik_7.2354.57ON4053118031e-102
YGL048C (RPT6)4.57ON4053118031e-102
KLLA0A04752g4.57ON4043247941e-101
CAGL0D06292g4.57ON4003137891e-100
Kwal_26.74744.57ON4053017881e-100
KLTH0D03806g4.57ON4053017871e-100
ZYRO0G22330g4.57ON4053117871e-100
Kpol_1041.424.57ON4033127861e-100
NCAS0A058804.57ON4073127861e-100
AGL043C4.57ON4053017851e-100
KNAG0D032004.57ON4003157822e-99
TBLA0B098804.57ON4013127822e-99
KAFR0F031004.57ON4053127822e-99
NDAI0D028504.57ON4053127813e-99
TPHA0F004404.57ON4033127805e-99
SAKL0H23672g4.57ON4083017805e-99
TDEL0E056604.57ON4063007796e-99
KLLA0C09592g8.708ON4343077233e-90
AAL113W8.708ON4323097209e-90
Skud_15.4258.708ON4373227182e-89
YOR259C (RPT4)8.708ON4373227165e-89
KNAG0G027208.708ON4443227157e-89
Smik_15.4428.708ON4373227148e-89
KLTH0D11990g8.708ON4333077148e-89
Ecym_23658.708ON4273097139e-89
SAKL0H05764g8.708ON4213077121e-88
Suva_8.3088.708ON4373227103e-88
NCAS0B011508.708ON4263227093e-88
NDAI0E010208.708ON4433227104e-88
TDEL0A065308.708ON4353227095e-88
Kwal_26.89128.708ON4343077086e-88
Kpol_1064.228.708ON4323207079e-88
CAGL0K08910g8.708ON4363227061e-87
KAFR0A040108.708ON4243227051e-87
TPHA0D014708.708ON4553267072e-87
Ecym_55275.428ON4323677033e-87
TBLA0D012408.708ON4433207043e-87
NCAS0A101803.216ON4373317025e-87
KLLA0E21209g5.428ON4323087016e-87
NCAS0F033305.428ON4343086982e-86
SAKL0G02376g5.428ON4343086982e-86
TPHA0H017705.251ON4343086972e-86
KLTH0F16214g5.428ON4343086948e-86
NDAI0A072903.216ON3763316889e-86
KAFR0F024403.216ON4362606931e-85
YDL007W (RPT2)3.216ON4372606931e-85
KNAG0C049605.428ON4233086921e-85
Kwal_55.214535.428ON4343086931e-85
AER254W5.428ON4603676941e-85
Suva_4.2463.216ON4372606922e-85
CAGL0A02750g5.428ON4293086912e-85
Smik_4.2293.216ON4372606922e-85
TDEL0D040603.216ON4372736912e-85
KNAG0K015303.216ON4352606912e-85
YOR117W (RPT5)5.428ON4343086903e-85
Smik_15.2955.428ON4343086903e-85
ZYRO0A04224g3.216ON4372606903e-85
Suva_8.1705.428ON4343086893e-85
Kpol_1010.743.216ON4373316894e-85
Kwal_27.110323.216ON3763246844e-85
ZYRO0F11946g8.708ON4443226895e-85
KAFR0E038905.428ON4343086885e-85
Kpol_1062.335.428ON4343086885e-85
TDEL0E019705.428ON4343086877e-85
Skud_15.2805.428ON4343086877e-85
SAKL0C11440g3.216ON4363246878e-85
CAGL0I04884g3.216ON4332606879e-85
Skud_4.2473.216ON4372606861e-84
TPHA0A042703.216ON4372606861e-84
NDAI0B056205.428ON4823086892e-84
Ecym_52863.216ON4373136842e-84
TBLA0A037405.428ON4343086842e-84
TBLA0F006903.216ON4342606833e-84
AEL011W3.216ON4373136825e-84
ZYRO0F09900g5.428ON4343086801e-83
KLLA0F14707g3.216ON4342606782e-83
KLTH0G16698g3.216ON4553116792e-83
Kpol_543.175.486ON4282786502e-79
ZYRO0D11528g5.486ON4532926504e-79
KLLA0C06534g5.486ON4282626461e-78
NDAI0A042905.486ON4262786451e-78
NCAS0A119805.486ON4262796442e-78
Ecym_45485.486ON4252626432e-78
Smik_4.6685.486ON4282796423e-78
TPHA0J028605.486ON4312636423e-78
CAGL0K09526g5.486ON4312636424e-78
YDR394W (RPT3)5.486ON4282796414e-78
AFR394W5.486ON4722596455e-78
Skud_4.6685.486ON4282796415e-78
TBLA0D018605.486ON4292786415e-78
KAFR0E035805.486ON4252786398e-78
SAKL0G03828g5.486ON4252626381e-77
Suva_2.5715.486ON4282796372e-77
KNAG0C045905.486ON4322966382e-77
TDEL0A035005.486ON4262786172e-74
KLTH0G02662g5.486ON4252626145e-74
Kpol_1020.97.288ON8122315291e-58
TBLA0J006407.288ON8522315301e-58
TDEL0H015607.288ON8382315292e-58
NCAS0E035807.288ON6012315164e-58
TBLA0C048407.288ON8472315265e-58
Kpol_2000.157.288ON8232315246e-58
SAKL0F09834g7.288ON8422315256e-58
KLLA0F05676g7.288ON8302315247e-58
KLTH0A05324g7.288ON8322315239e-58
KNAG0B029407.288ON8382315221e-57
NCAS0A137607.288ON8252315221e-57
NDAI0A030407.288ON8422315221e-57
Smik_4.1117.288ON8352315212e-57
NDAI0A022807.288ON8252315212e-57
Kwal_23.59967.288ON8312315202e-57
YDL126C (CDC48)7.288ON8352315193e-57
Ecym_80377.288ON8362315193e-57
KAFR0L011907.288ON8242315194e-57
Suva_4.1197.288ON8362315194e-57
Skud_4.1297.288ON8352315194e-57
AFR158W7.288ON8322315194e-57
CAGL0J09350g7.288ON8302315185e-57
ZYRO0C09262g7.288ON8302315176e-57
TPHA0A032607.288ON8262315151e-56
NCAS0E040505.34ON13292794943e-53
KAFR0D019005.34ON12612694944e-53
ZYRO0D07414g5.34ON14202694918e-53
Kwal_47.18848singletonOFF3021564599e-53
TDEL0G005905.34ON12942364855e-52
NDAI0B007805.34ON13482794846e-52
TBLA0C068505.34ON14262694821e-51
KNAG0K002805.34ON14082714821e-51
SAKL0H01276g5.34ON13372694821e-51
TPHA0L022105.34ON14002704821e-51
Ecym_47695.34ON13392694812e-51
Kpol_513.195.34ON13772704793e-51
KLLA0A09823g5.34ON13192714793e-51
KLTH0B09130g5.34ON13332794794e-51
CAGL0G00528g5.34ON13172714784e-51
ABR139W5.34ON12702364759e-51
TBLA0I011902.472ON8352654721e-50
KNAG0B061604.259ON7722674701e-50
Skud_13.2452.472ON8242574711e-50
Smik_16.385.34ON13892694723e-50
ZYRO0D15290g7.168ON7272644663e-50
Skud_7.6035.34ON13862694713e-50
Kwal_23.42535.34ON13292584713e-50
NCAS0J015504.259ON7722424665e-50
Ecym_12587.168ON7472644655e-50
KNAG0L010607.168ON7132614637e-50
TDEL0A024802.472ON8162574658e-50
KLTH0F13904g7.168ON7392634621e-49
Kpol_483.204.259ON7832614631e-49
Kpol_401.37.168ON7862644631e-49
Kwal_26.77492.472ON8142574641e-49
Suva_13.2662.472ON8232574631e-49
KLTH0D05412g2.472ON8132574631e-49
Ecym_74002.472ON8042574622e-49
Suva_7.5665.34ON13982814652e-49
YGR270W (YTA7)5.34ON13792694652e-49
KAFR0A058904.259ON7722824603e-49
KAFR0A007402.472ON7842574603e-49
AAR025C7.168ON7262644583e-49
Smik_13.2732.472ON8272574596e-49
YMR089C (YTA12)2.472ON8252574587e-49
TPHA0B007304.259ON7762824561e-48
Klac_YGOB_Anc_7.168b7.168ON7792614561e-48
NDAI0H022102.472ON8032574561e-48
NCAS0E020207.168ON7732644551e-48
CAGL0J01353g2.472ON8272554561e-48
NDAI0E035807.168ON7822624551e-48
CAGL0C02585g4.259ON7712724542e-48
KLLA0B03234g4.259ON8042454552e-48
SAKL0E03014g2.472ON8302574552e-48
NCAS0A078202.472ON7912574552e-48
SAKL0H02750g4.259ON7763094542e-48
Kpol_467.232.472ON8592574552e-48
YLR397C (AFG2)4.259ON7802494533e-48
KLLA0F13706g2.472ON8422574543e-48
SAKL0F03894g7.168ON7422634497e-48
TBLA0D044907.168ON7822634508e-48
KNAG0C033207.430ON7662544498e-48
NDAI0J023204.259ON7782424508e-48
Suva_5.1097.168ON7612594481e-47
TPHA0C015207.168ON7842644491e-47
ABL041W2.472ON8182564491e-47
KAFR0K020607.430ON7262544462e-47
Smik_12.4844.259ON7802674472e-47
NCAS0A146407.430ON7502544462e-47
CAGL0H09416g7.168ON7502644453e-47
TDEL0H027707.168ON7442644443e-47
KLLA0E06711g7.430ON7692544453e-47
TPHA0G031302.472ON7922664453e-47
ZYRO0F13024g7.430ON7402544444e-47
Skud_12.4824.259ON7772424436e-47
Smik_5.1387.168ON7602594427e-47
ZYRO0G03212g2.472ON8302554437e-47
Ecym_71237.430ON7272554418e-47
Skud_5.1217.168ON7622594428e-47
KLTH0D14586g4.259ON7742674429e-47
Suva_10.5144.259ON7802424429e-47
KNAG0E025502.472ON8452574439e-47
ZYRO0G08008g4.23ON8263224439e-47
NDAI0A013907.430ON7122554391e-46
SAKL0F13376g7.430ON7412544392e-46
Suva_16.3517.430ON7472544392e-46
YER017C (AFG3)7.168ON7612594392e-46
CAGL0K05093g7.430ON7452544382e-46
YLL034C (RIX7)4.23ON8372594402e-46
TBLA0F014707.430ON8022544392e-46
TDEL0C029307.430ON7402544382e-46
YPR024W (YME1)7.430ON7472544382e-46
Smik_16.2657.430ON7472544382e-46
KAFR0G028007.168ON7832624383e-46
Skud_12.334.23ON8372574384e-46
Smik_12.224.23ON8372484384e-46
Skud_16.3097.430ON7472544364e-46
SAKL0H25630g4.23ON8302484375e-46
AGL274W7.430ON7322544355e-46
Suva_10.384.23ON8372484375e-46
TDEL0E011104.259ON7782674365e-46
NCAS0A029404.23ON8572884367e-46
KLTH0C05742g7.430ON7442544339e-46
CAGL0D02838g4.23ON8343184359e-46
Ecym_62184.23ON8382574351e-45
Kwal_23.41944.259ON7742824331e-45
TPHA0E006607.430ON7822554322e-45
KLLA0E00837g4.23ON8142484322e-45
ZYRO0B12606g4.259ON7772834312e-45
Kpol_1044.154.23ON8392484304e-45
Kpol_1045.117.430ON6952564275e-45
TPHA0K022204.23ON8202484297e-45
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR050C
         (475 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON} S...   939   0.0  
Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar t...   855   0.0  
Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa] ...   815   0.0  
SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 ...   807   0.0  
TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.2...   805   0.0  
KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.2...   800   0.0  
NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {O...   798   0.0  
TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.2...   797   0.0  
KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 ...   796   0.0  
CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly...   797   0.0  
TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.2...   796   0.0  
ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly...   790   0.0  
Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W...   783   0.0  
YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One o...   781   0.0  
Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W...   781   0.0  
Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W...   768   0.0  
KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]...   764   0.0  
KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.2...   761   0.0  
Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W (...   742   0.0  
NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {O...   655   0.0  
Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON...   315   e-103
Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON...   313   e-102
Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON...   313   e-102
YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}  ...   313   e-102
KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {...   310   e-101
CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly...   308   e-100
Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {O...   308   e-100
KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {...   307   e-100
ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]...   307   e-100
Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON} (1108...   307   e-100
NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa] ...   307   e-100
AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON} S...   306   e-100
KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {O...   305   2e-99
TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4...   305   2e-99
KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {O...   305   2e-99
NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57     305   3e-99
TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {O...   305   5e-99
SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} high...   305   5e-99
TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa] ...   304   6e-99
KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly...   283   3e-90
AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic ho...   281   9e-90
Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {...   281   2e-89
YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON} ...   280   5e-89
KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {O...   280   7e-89
Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {...   279   8e-89
KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {...   279   8e-89
Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar t...   279   9e-89
SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly...   278   1e-88
Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON...   278   3e-88
NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708    277   3e-88
NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708    278   4e-88
TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa] ...   277   5e-88
Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa] ...   277   6e-88
Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {O...   276   9e-88
CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highl...   276   1e-87
KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {O...   276   1e-87
TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {O...   276   2e-87
Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar...   275   3e-87
TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.7...   275   3e-87
NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa] ...   275   5e-87
KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]...   274   6e-87
NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428    273   2e-86
SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly...   273   2e-86
TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.2...   273   2e-86
KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]...   271   8e-86
NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON} Anc_3...   269   9e-86
KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.2...   271   1e-85
YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of...   271   1e-85
KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {O...   271   1e-85
Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {...   271   1e-85
AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic ...   271   1e-85
Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W ...   271   2e-85
CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly...   270   2e-85
Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W ...   271   2e-85
TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.2...   270   2e-85
KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {...   270   2e-85
YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One o...   270   3e-85
Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117...   270   3e-85
ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly...   270   3e-85
Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W ...   270   3e-85
Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa] ...   270   4e-85
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...   268   4e-85
ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {...   270   5e-85
KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.4...   269   5e-85
Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {O...   269   5e-85
TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {O...   269   7e-85
Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117...   269   7e-85
SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736) ...   269   8e-85
CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly...   269   9e-85
Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W ...   268   1e-84
TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.2...   268   1e-84
NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON} Anc_5...   270   2e-84
Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar t...   268   2e-84
TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.4...   268   2e-84
TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.2...   267   3e-84
AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic ho...   267   5e-84
ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly...   266   1e-83
KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} high...   265   2e-83
KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085) ...   266   2e-83
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...   254   2e-79
ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly...   254   4e-79
KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly...   253   1e-78
NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {O...   253   1e-78
NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON} Anc_5...   252   2e-78
Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {O...   252   2e-78
Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394...   251   3e-78
TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5....   251   3e-78
CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highl...   251   4e-78
YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One ...   251   4e-78
AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic ...   253   5e-78
Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394...   251   5e-78
TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {O...   251   5e-78
KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {O...   250   8e-78
SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly...   250   1e-77
Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394...   249   2e-77
KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {O...   250   2e-77
TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.4...   242   2e-74
KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly...   241   5e-74
Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON...   208   1e-58
TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7....   208   1e-58
TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {O...   208   2e-58
NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288    203   4e-58
TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON} Anc_7...   207   5e-58
Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {O...   206   6e-58
SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly...   206   6e-58
KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {...   206   7e-58
KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly...   206   9e-58
KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {O...   205   1e-57
NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON}            205   1e-57
NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {O...   205   1e-57
Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON...   205   2e-57
NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {O...   205   2e-57
Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL12...   204   2e-57
YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}  ...   204   3e-57
Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to ...   204   3e-57
KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7....   204   4e-57
Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON...   204   4e-57
Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON...   204   4e-57
AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic ho...   204   4e-57
CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa] ...   204   5e-57
ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly...   203   6e-57
TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {O...   202   1e-56
NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34    194   3e-53
KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {...   194   4e-53
ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa] ...   193   8e-53
Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {O...   181   9e-53
TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {...   191   5e-52
NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {...   191   6e-52
TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON} Anc_...   190   1e-51
KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {O...   190   1e-51
SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa] ...   190   1e-51
TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5...   190   1e-51
Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {...   189   2e-51
Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON} (53678.....   189   3e-51
KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} simil...   189   3e-51
KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} simil...   189   4e-51
CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {O...   188   4e-51
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...   187   9e-51
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...   186   1e-50
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...   185   1e-50
Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {...   186   1e-50
Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON...   186   3e-50
ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]...   184   3e-50
Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR27...   186   3e-50
Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {...   186   3e-50
NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {...   184   5e-50
Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar t...   183   5e-50
KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {...   182   7e-50
TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.4...   183   8e-50
KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]...   182   1e-49
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...   182   1e-49
Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON} co...   182   1e-49
Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C...   183   1e-49
Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {...   182   1e-49
KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} simila...   182   1e-49
Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}...   182   2e-49
Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W...   183   2e-49
YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}  YTA7Pro...   183   2e-49
KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON} Anc_4...   181   3e-49
KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.4...   181   3e-49
AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON} S...   181   3e-49
Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {...   181   6e-49
YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON} ...   181   7e-49
TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.2...   180   1e-48
Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2...   180   1e-48
NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {O...   180   1e-48
NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168    179   1e-48
CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} simil...   180   1e-48
NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168    179   1e-48
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...   179   2e-48
KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} simila...   179   2e-48
SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {...   179   2e-48
NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa] ...   179   2e-48
SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly...   179   2e-48
Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON} (50661..5...   179   2e-48
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...   179   3e-48
KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]...   179   3e-48
SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} simila...   177   7e-48
TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa] ...   177   8e-48
KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {O...   177   8e-48
NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {...   177   8e-48
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...   177   1e-47
TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.1...   177   1e-47
ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic ho...   177   1e-47
KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7....   176   2e-47
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...   176   2e-47
NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON} Anc_7...   176   2e-47
CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly...   176   3e-47
TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.1...   175   3e-47
KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {...   176   3e-47
TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.4...   176   3e-47
ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} simi...   175   4e-47
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...   175   6e-47
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...   174   7e-47
ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} simila...   175   7e-47
Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}...   174   8e-47
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...   174   8e-47
KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]...   174   9e-47
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...   174   9e-47
KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.4...   175   9e-47
ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {...   175   9e-47
NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {O...   173   1e-46
SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} high...   173   2e-46
Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024...   173   2e-46
YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}  ...   173   2e-46
CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highl...   173   2e-46
YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}  R...   174   2e-46
TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.4...   173   2e-46
TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.4...   173   2e-46
YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}  YME1Catal...   173   2e-46
Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024...   173   2e-46
KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {O...   173   3e-46
Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}...   173   4e-46
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...   173   4e-46
Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024...   172   4e-46
SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} high...   172   5e-46
AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic ho...   172   5e-46
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...   172   5e-46
TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.2...   172   5e-46
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23     172   7e-46
KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {...   171   9e-46
CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {...   172   9e-46
Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}...   172   1e-45
Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C...   171   1e-45
TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {O...   171   2e-45
KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON...   171   2e-45
ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]...   170   2e-45
Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {O...   170   4e-45
Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {O...   169   5e-45
TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4....   169   7e-45
TBLA0E01450 Chr5 complement(327199..329784) [2586 bp, 861 aa] {O...   169   1e-44
KNAG0E01040 Chr5 complement(195972..198329) [2358 bp, 785 aa] {O...   168   2e-44
NDAI0E03960 Chr5 complement(877738..880071) [2334 bp, 777 aa] {O...   168   2e-44
TBLA0A06380 Chr1 (1566622..1569048) [2427 bp, 808 aa] {ON} Anc_4...   168   2e-44
KAFR0L00260 Chr12 (44832..47216) [2385 bp, 794 aa] {ON} Anc_4.23...   167   2e-44
KLTH0E06006g Chr5 complement(542954..545413) [2460 bp, 819 aa] {...   167   3e-44
TDEL0G01680 Chr7 (329761..332181) [2421 bp, 806 aa] {ON} Anc_4.2...   167   4e-44
Kwal_55.20644 s55 complement(502435..504876) [2442 bp, 813 aa] {...   166   1e-43
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...   166   1e-43
AFR188W Chr6 (778329..780812) [2484 bp, 827 aa] {ON} Syntenic ho...   165   2e-43
CAGL0D02574g Chr4 (263063..266116) [3054 bp, 1017 aa] {ON} simil...   162   2e-42
TBLA0I00550 Chr9 (96744..99863) [3120 bp, 1039 aa] {ON} Anc_3.9 ...   162   4e-42
Klac_YGOB_Anc_7.168 Chr2 (1011211..1012734) [1524 bp, 507 aa] {O...   158   4e-42
NCAS0E01270 Chr5 complement(243168..246005) [2838 bp, 945 aa] {O...   161   6e-42
NDAI0G01370 Chr7 (306715..309921) [3207 bp, 1068 aa] {ON} Anc_3.9     160   2e-41
KLLA0E02003g Chr5 complement(187814..190816) [3003 bp, 1000 aa] ...   159   2e-41
Kwal_55.22137 s55 (1127242..1130358) [3117 bp, 1038 aa] {ON} YNL...   158   8e-41
Smik_14.3 Chr14 complement(3964..7053) [3090 bp, 1029 aa] {ON} Y...   157   1e-40
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...   157   2e-40
KLTH0F19646g Chr6 (1592186..1595320) [3135 bp, 1044 aa] {ON} sim...   156   4e-40
Skud_14.12 Chr14 complement(12962..16126) [3165 bp, 1054 aa] {ON...   155   7e-40
TDEL0A00280 Chr1 complement(46558..49620) [3063 bp, 1020 aa] {ON...   155   9e-40
AER065C Chr5 complement(753980..756304) [2325 bp, 774 aa] {ON} S...   154   1e-39
Suva_14.12 Chr14 complement(14684..17773) [3090 bp, 1029 aa] {ON...   154   2e-39
KNAG0K02600 Chr11 (517667..520744) [3078 bp, 1025 aa] {ON} Anc_3...   153   3e-39
YNL329C Chr14 complement(19541..22633) [3093 bp, 1030 aa] {ON}  ...   153   3e-39
Kpol_1014.31 s1014 (54948..58082) [3135 bp, 1044 aa] {ON} (54948...   153   3e-39
ZYRO0G04510g Chr7 complement(363004..366159) [3156 bp, 1051 aa] ...   152   7e-39
TPHA0P01580 Chr16 (324418..327516) [3099 bp, 1032 aa] {ON} Anc_3...   152   9e-39
AGR394W Chr7 (1452410..1455475) [3066 bp, 1021 aa] {ON} Syntenic...   151   2e-38
Ecym_3259 Chr3 (495875..498199) [2325 bp, 774 aa] {ON} similar t...   149   5e-38
SAKL0C13684g Chr3 (1204367..1207471) [3105 bp, 1034 aa] {ON} sim...   148   2e-37
ZYRO0C03476g Chr3 (274719..277805) [3087 bp, 1028 aa] {ON} simil...   148   2e-37
KLLA0B06094g Chr2 complement(541408..542490) [1083 bp, 360 aa] {...   140   1e-36
KLLA0B06523g Chr2 complement(579869..582862) [2994 bp, 997 aa] {...   143   9e-36
KNAG0F03850 Chr6 complement(729019..730323) [1305 bp, 434 aa] {O...   137   3e-35
Ecym_3161 Chr3 complement(308085..311240) [3156 bp, 1051 aa] {ON...   140   5e-35
Kpol_385.7 s385 (17541..18629) [1089 bp, 362 aa] {ON} (17541..18...   134   2e-34
SAKL0F15884g Chr6 complement(1285496..1286782) [1287 bp, 428 aa]...   135   2e-34
SAKL0D12606g Chr4 (1044200..1047274) [3075 bp, 1024 aa] {ON} sim...   138   3e-34
TBLA0E00840 Chr5 (182594..183883) [1290 bp, 429 aa] {ON} Anc_7.5...   134   3e-34
Kwal_23.5338 s23 complement(1116675..1117961) [1287 bp, 428 aa] ...   134   6e-34
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...   137   7e-34
TPHA0I03200 Chr9 complement(706938..708236) [1299 bp, 432 aa] {O...   133   8e-34
CAGL0K03971g Chr11 (367761..368840) [1080 bp, 359 aa] {ON} highl...   132   8e-34
Skud_16.478 Chr16 complement(829027..830340) [1314 bp, 437 aa] {...   133   8e-34
Smik_16.438 Chr16 complement(749208..750521) [1314 bp, 437 aa] {...   133   8e-34
YPR173C Chr16 complement(886524..887837) [1314 bp, 437 aa] {ON} ...   133   8e-34
NCAS0A01990 Chr1 (381080..382165) [1086 bp, 361 aa] {ON}              131   1e-33
NDAI0D03930 Chr4 (928651..929715) [1065 bp, 354 aa] {ON}              130   2e-33
Suva_16.506 Chr16 complement(869082..870395) [1314 bp, 437 aa] {...   132   3e-33
NDAI0J00290 Chr10 complement(47691..49028) [1338 bp, 445 aa] {ON...   132   4e-33
Kpol_1013.42 s1013 (96318..97610) [1293 bp, 430 aa] {ON} (96318....   132   4e-33
KAFR0B00410 Chr2 (88947..90221) [1275 bp, 424 aa] {ON} Anc_7.530...   131   4e-33
KLTH0A00968g Chr1 (96149..97432) [1284 bp, 427 aa] {ON} highly s...   131   4e-33
NCAS0A15130 Chr1 complement(2978192..2979496) [1305 bp, 434 aa] ...   131   4e-33
TDEL0F00540 Chr6 complement(90867..93965) [3099 bp, 1032 aa] {ON...   135   5e-33
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....   134   7e-33
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....   134   9e-33
Ecym_8344 Chr8 (694173..695261) [1089 bp, 362 aa] {ON} similar t...   129   1e-32
TPHA0F00980 Chr6 (222909..223991) [1083 bp, 360 aa] {ON} Anc_4.1...   129   1e-32
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...   133   1e-32
TBLA0B02000 Chr2 complement(463205..466300) [3096 bp, 1031 aa] {...   133   2e-32
CAGL0I06402g Chr9 (620231..621529) [1299 bp, 432 aa] {ON} highly...   130   2e-32
SAKL0B03894g Chr2 (345902..346978) [1077 bp, 358 aa] {ON} highly...   128   2e-32
KAFR0E00340 Chr5 complement(77112..80087) [2976 bp, 991 aa] {ON}...   132   2e-32
Suva_7.309 Chr7 (527237..528325) [1089 bp, 362 aa] {ON} YGR028W ...   128   3e-32
Ecym_2804 Chr2 complement(1561704..1563005) [1302 bp, 433 aa] {O...   129   3e-32
TBLA0I02090 Chr9 complement(474394..477000) [2607 bp, 868 aa] {O...   132   3e-32
KLLA0B10846g Chr2 complement(949338..950630) [1293 bp, 430 aa] {...   129   4e-32
Suva_11.25 Chr11 complement(54969..58109) [3141 bp, 1046 aa] {ON...   132   5e-32
TDEL0H00410 Chr8 (63535..64839) [1305 bp, 434 aa] {ON} Anc_7.530...   128   5e-32
YKL197C Chr11 complement(70734..73865) [3132 bp, 1043 aa] {ON}  ...   131   5e-32
CAGL0E04642g Chr5 complement(447934..450141) [2208 bp, 735 aa] {...   131   6e-32
YGR028W Chr7 (542203..543291) [1089 bp, 362 aa] {ON}  MSP1Mitoch...   126   8e-32
KLLA0C14520g Chr3 complement(1269505..1271799) [2295 bp, 764 aa]...   130   8e-32
SAKL0B06402g Chr2 complement(548471..550795) [2325 bp, 774 aa] {...   130   1e-31
Skud_11.21 Chr11 complement(54078..57206) [3129 bp, 1042 aa] {ON...   130   2e-31
AEL265W Chr5 (140797..142092) [1296 bp, 431 aa] {ON} Syntenic ho...   127   2e-31
Smik_11.25 Chr11 complement(55016..58147) [3132 bp, 1043 aa] {ON...   130   2e-31
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...   129   3e-31
Skud_7.320 Chr7 (540689..541897) [1209 bp, 402 aa] {ON} YGR028W ...   126   3e-31
AFR371W Chr6 (1105757..1108837) [3081 bp, 1026 aa] {ON} Syntenic...   129   3e-31
Kpol_1056.21 s1056 complement(47832..51026) [3195 bp, 1064 aa] {...   129   4e-31
Smik_6.97 Chr6 (172621..173709) [1089 bp, 362 aa] {ON} YGR028W (...   124   5e-31
ZYRO0D01210g Chr4 (93236..94519) [1284 bp, 427 aa] {ON} highly s...   125   5e-31
YPL074W Chr16 (415763..418027) [2265 bp, 754 aa] {ON}  YTA6Putat...   128   7e-31
TBLA0G03290 Chr7 complement(873305..875593) [2289 bp, 762 aa] {O...   127   8e-31
Skud_16.208 Chr16 (387144..389408) [2265 bp, 754 aa] {ON} YPL074...   127   1e-30
Kpol_1052.6 s1052 (16325..18616) [2292 bp, 763 aa] {ON} (16325.....   127   1e-30
KNAG0G00290 Chr7 complement(45891..48884) [2994 bp, 997 aa] {ON}...   127   1e-30
KLTH0G17930g Chr7 complement(1553688..1554764) [1077 bp, 358 aa]...   123   2e-30
Smik_2.213 Chr2 complement(380313..382589) [2277 bp, 758 aa] {ON...   126   2e-30
KNAG0D03870 Chr4 (704252..705331) [1080 bp, 359 aa] {ON} Anc_4.1...   122   2e-30
TPHA0A03890 Chr1 (856900..859182) [2283 bp, 760 aa] {ON} Anc_3.3...   126   2e-30
YBR080C Chr2 complement(398614..400890) [2277 bp, 758 aa] {ON}  ...   126   2e-30
Smik_16.162 Chr16 (298702..301230) [2529 bp, 842 aa] {ON} YPL074...   126   2e-30
Suva_16.238 Chr16 (426245..428506) [2262 bp, 753 aa] {ON} YPL074...   126   3e-30
TDEL0D02860 Chr4 complement(543697..544785) [1089 bp, 362 aa] {O...   122   3e-30
Suva_4.320 Chr4 complement(565994..568270) [2277 bp, 758 aa] {ON...   125   4e-30
ZYRO0A12342g Chr1 (979094..980185) [1092 bp, 363 aa] {ON} highly...   122   4e-30
ZYRO0G12738g Chr7 complement(1012482..1014773) [2292 bp, 763 aa]...   125   4e-30
NDAI0A07600 Chr1 complement(1741778..1744060) [2283 bp, 760 aa] ...   125   5e-30
TDEL0D03210 Chr4 (598442..600721) [2280 bp, 759 aa] {ON} Anc_3.3...   125   7e-30
AER169C Chr5 complement(951174..953462) [2289 bp, 762 aa] {ON} S...   125   7e-30
CAGL0M01782g Chr13 (208704..210980) [2277 bp, 758 aa] {ON} highl...   125   8e-30
Skud_2.204 Chr2 complement(366362..368638) [2277 bp, 758 aa] {ON...   124   1e-29
TPHA0O01090 Chr15 complement(208519..211680) [3162 bp, 1053 aa] ...   124   1e-29
ABR036W Chr2 (464427..465509) [1083 bp, 360 aa] {ON} Syntenic ho...   119   3e-29
KAFR0C00290 Chr3 (54829..57111) [2283 bp, 760 aa] {ON} Anc_3.304...   122   4e-29
KLTH0E14190g Chr5 complement(1255261..1257552) [2292 bp, 763 aa]...   122   4e-29
NCAS0I01400 Chr9 (256606..258882) [2277 bp, 758 aa] {ON} Anc_3.304    122   5e-29
Ecym_7426 Chr7 complement(873420..875714) [2295 bp, 764 aa] {ON}...   122   5e-29
Kwal_27.12376 s27 complement(1199810..1202056) [2247 bp, 749 aa]...   122   6e-29
Kwal_YGOB_27.12376 s27 complement(1199780..1202056) [2277 bp, 75...   122   6e-29
ZYRO0D03938g Chr4 (320521..322578) [2058 bp, 685 aa] {ON} simila...   120   2e-28
KNAG0J02320 Chr10 complement(431036..433312) [2277 bp, 758 aa] {...   120   2e-28
TDEL0B03040 Chr2 (541376..543619) [2244 bp, 747 aa] {ON} Anc_8.5...   119   4e-28
Kwal_14.1321 s14 (278328..279404) [1077 bp, 358 aa] {ON} YGR028W...   115   6e-28
KAFR0F03780 Chr6 (743830..744903) [1074 bp, 357 aa] {ON} Anc_4.1...   115   9e-28
NDAI0E02810 Chr5 (595594..597864) [2271 bp, 756 aa] {ON} Anc_8.542    118   2e-27
NCAS0C02100 Chr3 (396101..398377) [2277 bp, 758 aa] {ON} Anc_8.542    117   2e-27
Kpol_1048.61 s1048 (176743..179121) [2379 bp, 792 aa] {ON} (1767...   116   5e-27
Kpol_1018.113 s1018 (297316..298503,298553..298561,298604..29955...   116   6e-27
CAGL0H05357g Chr8 complement(514513..516825) [2313 bp, 770 aa] {...   116   7e-27
SAKL0H10032g Chr8 (858355..860484) [2130 bp, 709 aa] {ON} simila...   115   8e-27
TBLA0B04610 Chr2 (1068676..1072083) [3408 bp, 1135 aa] {ON} Anc_...   115   2e-26
TPHA0I01900 Chr9 (427715..429883) [2169 bp, 722 aa] {ON} Anc_8.5...   113   6e-26
AEL244W Chr5 (178664..180736) [2073 bp, 690 aa] {ON} Syntenic ho...   113   6e-26
KAFR0E00920 Chr5 (196279..198699) [2421 bp, 806 aa] {ON} Anc_8.5...   111   3e-25
Ecym_7036 Chr7 complement(74300..76435) [2136 bp, 711 aa] {ON} s...   110   3e-25
Kwal_27.10646 s27 complement(433603..434793) [1191 bp, 397 aa] {...   106   2e-24
KLLA0E23409g Chr5 complement(2082115..2084106) [1992 bp, 663 aa]...   108   2e-24
KAFR0L00730 Chr12 complement(137874..140522) [2649 bp, 882 aa] {...   108   2e-24
KLTH0E12562g Chr5 complement(1114263..1116410) [2148 bp, 715 aa]...   108   3e-24
KNAG0A01960 Chr1 (155185..157449) [2265 bp, 754 aa] {ON} Anc_8.5...   107   4e-24
Kwal_YGOB_27.10642 s27 complement(432707..433537,433540..434793)...   107   6e-24
Kwal_27.12039 s27 complement(1059119..1061275) [2157 bp, 718 aa]...   107   7e-24
CAGL0J02728g Chr10 complement(269575..272382) [2808 bp, 935 aa] ...   105   3e-23
SAKL0F08008g Chr6 complement(612481..614844) [2364 bp, 787 aa] {...   105   3e-23
Kwal_47.18123 s47 complement(697417..699792) [2376 bp, 791 aa] {...   104   5e-23
KLLA0E04379g Chr5 complement(396027..398216) [2190 bp, 729 aa] {...   103   7e-23
Smik_5.172 Chr5 complement(248542..251214) [2673 bp, 890 aa] {ON...   103   7e-23
Kwal_55.21051 s55 complement(666773..667849) [1077 bp, 358 aa] {...   101   9e-23
KLTH0A03696g Chr1 complement(318721..321066) [2346 bp, 781 aa] {...   103   9e-23
ADL109W Chr4 (491872..494088) [2217 bp, 738 aa] {ON} Syntenic ho...   102   2e-22
ZYRO0D16346g Chr4 complement(1361550..1364075) [2526 bp, 841 aa]...   102   2e-22
Kpol_1070.24 s1070 (55367..58012) [2646 bp, 881 aa] {ON} (55367....   102   2e-22
KNAG0L01320 Chr12 complement(236592..239342) [2751 bp, 916 aa] {...   102   3e-22
YER047C Chr5 complement(243810..246503) [2694 bp, 897 aa] {ON}  ...   101   4e-22
NCAS0E01710 Chr5 (334984..337224) [2241 bp, 746 aa] {ON}              100   7e-22
TDEL0H02310 Chr8 (386966..389599) [2634 bp, 877 aa] {ON} Anc_7.2...   100   1e-21
TPHA0C01280 Chr3 (291235..293799) [2565 bp, 854 aa] {ON} Anc_7.2...   100   1e-21
Skud_5.157 Chr5 complement(241636..244311) [2676 bp, 891 aa] {ON...   100   2e-21
NDAI0G01900 Chr7 (427004..429964) [2961 bp, 986 aa] {ON} Anc_7.2...   100   2e-21
TBLA0D04260 Chr4 (1051964..1054561) [2598 bp, 865 aa] {ON} Anc_7...    99   3e-21
Suva_5.149 Chr5 complement(220370..223057) [2688 bp, 895 aa] {ON...    97   2e-20
Kwal_47.18846 s47 complement(997109..997450) [342 bp, 113 aa] {O...    64   6e-12
ACR200C Chr3 complement(700324..701658) [1335 bp, 444 aa] {ON} S...    61   3e-09
Kwal_55.21054 s55 complement(667988..668956) [969 bp, 323 aa] {O...    58   1e-08
NCAS0H02120 Chr8 complement(412484..413905) [1422 bp, 473 aa] {O...    57   6e-08
KLLA0E02487g Chr5 complement(227048..228388) [1341 bp, 446 aa] {...    56   8e-08
TDEL0D02530 Chr4 (488653..490011) [1359 bp, 452 aa] {ON} Anc_5.4...    56   1e-07
TBLA0A02720 Chr1 (660311..661660) [1350 bp, 449 aa] {ON} Anc_5.4...    56   1e-07
KLTH0F15730g Chr6 (1282421..1283773) [1353 bp, 450 aa] {ON} high...    54   3e-07
ZYRO0G01716g Chr7 complement(131297..132646) [1350 bp, 449 aa] {...    54   4e-07
KNAG0B04170 Chr2 (793281..794642) [1362 bp, 453 aa] {ON} Anc_5.4...    54   4e-07
Ecym_4643 Chr4 (1254526..1255857) [1332 bp, 443 aa] {ON} similar...    54   5e-07
KAFR0D05090 Chr4 complement(1001713..1003098) [1386 bp, 461 aa] ...    53   8e-07
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    53   1e-06
SAKL0G02816g Chr7 complement(231094..232560) [1467 bp, 488 aa] {...    53   1e-06
TPHA0E01660 Chr5 (337199..338557) [1359 bp, 452 aa] {ON} Anc_5.4...    52   2e-06
Kwal_55.21381 s55 (809652..811004) [1353 bp, 450 aa] {ON} YDR375...    52   3e-06
Kpol_1062.18 s1062 (44220..45560) [1341 bp, 446 aa] {ON} (44220....    52   3e-06
YDR375C Chr4 complement(1225166..1226536) [1371 bp, 456 aa] {ON}...    51   4e-06
Smik_4.643 Chr4 complement(1145612..1147033) [1422 bp, 473 aa] {...    51   4e-06
Skud_4.645 Chr4 complement(1148035..1149405) [1371 bp, 456 aa] {...    51   4e-06
Suva_2.548 Chr2 complement(975787..977157) [1371 bp, 456 aa] {ON...    50   5e-06
CAGL0A02992g Chr1 complement(308689..310062) [1374 bp, 457 aa] {...    50   5e-06
NDAI0C01530 Chr3 (325097..326557) [1461 bp, 486 aa] {ON} Anc_5.4...    50   7e-06
KLTH0E12936g Chr5 complement(1145066..1146700) [1635 bp, 544 aa]...    49   2e-05
Kwal_27.12113 s27 complement(1090541..1092061) [1521 bp, 506 aa]...    49   3e-05
Sklu_YGOB_09658g Chr8 (828107..829591,829654..829791) [1623 bp, ...    47   8e-05
SAKL0H09658g Chr8 (828107..829639) [1533 bp, 510 aa] {OFF} simil...    47   8e-05
KLLA0E23783g Chr5 complement(2115721..2115885,2115988..2117484) ...    46   1e-04
KLTH0B08052g Chr2 complement(652928..654538) [1611 bp, 536 aa] {...    46   2e-04
KAFR0E00840 Chr5 (176559..178121,178220..178348) [1692 bp, 563 a...    45   2e-04
KNAG0A01880 Chr1 (135396..137078) [1683 bp, 560 aa] {ON} Anc_8.5...    44   5e-04
Ecym_7051 Chr7 complement(103898..104056,104172..105644) [1632 b...    44   6e-04
AEL258W Chr5 (152451..153911,153967..154086) [1581 bp, 526 aa] {...    44   0.001
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    42   0.002
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    42   0.002
Suva_4.437 Chr4 (770299..771957) [1659 bp, 552 aa] {ON} YBR186W ...    42   0.004
NDAI0E02730 Chr5 (573056..574554,574636..574771) [1635 bp, 544 a...    42   0.004
Smik_2.326 Chr2 (586919..588469,588545..588688) [1695 bp, 564 aa...    41   0.005
Skud_2.312 Chr2 (567925..569382,569566..569712) [1605 bp, 534 aa...    41   0.007
TDEL0B02870 Chr2 (512594..514168,514238..514384) [1722 bp, 573 a...    41   0.007
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    40   0.007
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    40   0.008
KNAG0F00930 Chr6 (170493..172262) [1770 bp, 589 aa] {ON} Anc_2.2...    40   0.009
Kwal_23.4480 s23 (737809..739470) [1662 bp, 553 aa] {ON} YNL218W...    40   0.012
TBLA0H03710 Chr8 complement(902121..903824) [1704 bp, 567 aa] {O...    40   0.013
ABL183W Chr2 (63196..64839) [1644 bp, 547 aa] {ON} Syntenic homo...    40   0.015
YBR186W Chr2 (600553..602103,602217..602360) [1695 bp, 564 aa] {...    38   0.048
SAKL0E13926g Chr5 complement(1147571..1149223) [1653 bp, 550 aa]...    37   0.14 
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    37   0.14 
TPHA0I01820 Chr9 (404763..406295,406384..406530) [1680 bp, 559 a...    37   0.15 
CAGL0K04983g Chr11 complement(483181..484860) [1680 bp, 559 aa] ...    36   0.19 
TPHA0P01680 Chr16 complement(350606..352414) [1809 bp, 602 aa] {...    36   0.22 
Smik_2.369 Chr2 complement(659801..661306) [1506 bp, 501 aa] {ON...    36   0.25 
CAGL0K06919g Chr11 complement(675277..676926) [1650 bp, 549 aa] ...    36   0.26 
Ecym_6466 Chr6 complement(901576..903330) [1755 bp, 584 aa] {ON}...    36   0.28 
Skud_2.358 Chr2 complement(642328..643905) [1578 bp, 525 aa] {ON...    35   0.28 
ACR102W Chr3 (535740..538262) [2523 bp, 840 aa] {ON} Syntenic ho...    36   0.29 
NCAS0G01450 Chr7 (262021..263730) [1710 bp, 569 aa] {ON} Anc_2.2...    35   0.31 
YBR227C Chr2 complement(673572..675134) [1563 bp, 520 aa] {ON}  ...    35   0.31 
Kwal_56.24172 s56 complement(887183..890167) [2985 bp, 994 aa] {...    35   0.32 
KLLA0D19360g Chr4 complement(1629360..1631039) [1680 bp, 559 aa]...    35   0.32 
YMR078C Chr13 complement(422503..424728) [2226 bp, 741 aa] {ON} ...    35   0.33 
Kpol_1014.42 s1014 complement(81164..82876) [1713 bp, 570 aa] {O...    35   0.47 
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    35   0.47 
TBLA0G00290 Chr7 (53122..55110) [1989 bp, 662 aa] {ON} Anc_2.26 ...    35   0.54 
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    35   0.56 
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    35   0.63 
KLLA0B01892g Chr2 (162844..165855) [3012 bp, 1003 aa] {ON} weakl...    35   0.64 
Suva_4.482 Chr4 complement(843869..845419) [1551 bp, 516 aa] {ON...    34   0.67 
KAFR0A07880 Chr1 complement(1577607..1579292) [1686 bp, 561 aa] ...    34   0.71 
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    34   0.75 
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    34   0.87 
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    34   0.98 
TDEL0A00690 Chr1 (116066..117724) [1659 bp, 552 aa] {ON} Anc_2.2...    34   1.0  
KLLA0F09691g Chr6 complement(892208..893725) [1518 bp, 505 aa] {...    33   1.2  
ZYRO0B11880g Chr2 (950091..951908) [1818 bp, 605 aa] {ON} simila...    33   1.2  
NDAI0F03710 Chr6 complement(882364..884193) [1830 bp, 609 aa] {O...    33   1.3  
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    33   1.3  
TDEL0E05510 Chr5 complement(1010410..1013400) [2991 bp, 996 aa] ...    33   1.4  
Kpol_1048.53 s1048 (151366..153024) [1659 bp, 552 aa] {ON} (1513...    33   1.5  
SAKL0E02486g Chr5 complement(196218..198395) [2178 bp, 725 aa] {...    33   1.6  
ZYRO0F06446g Chr6 (533651..536176) [2526 bp, 841 aa] {ON} simila...    33   1.6  
ZYRO0F15136g Chr6 complement(1238898..1240598) [1701 bp, 566 aa]...    33   1.7  
TPHA0F03230 Chr6 (704126..706663) [2538 bp, 845 aa] {ON} Anc_8.6...    33   1.7  
KAFR0A01930 Chr1 complement(401199..403541) [2343 bp, 780 aa] {O...    33   1.8  
ZYRO0E07458g Chr5 complement(572497..575538) [3042 bp, 1013 aa] ...    33   1.8  
Ecym_8322 Chr8 (654654..657074) [2421 bp, 806 aa] {ON} similar t...    33   2.0  
AFL121W Chr6 (209373..211949) [2577 bp, 858 aa] {ON} Non-synteni...    33   2.0  
ZYRO0E01826g Chr5 (134806..136320) [1515 bp, 504 aa] {ON} simila...    33   2.0  
Ecym_2174 Chr2 (338477..341560) [3084 bp, 1027 aa] {ON} similar ...    33   2.2  
Kwal_47.18662 s47 complement(919990..921402) [1413 bp, 470 aa] {...    33   2.2  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    33   2.4  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    32   2.6  
AFR013C Chr6 complement(458057..461230) [3174 bp, 1057 aa] {ON} ...    33   2.7  
NCAS0F00820 Chr6 complement(166312..168531) [2220 bp, 739 aa] {O...    32   3.0  
SAKL0A03806g Chr1 (353414..356539) [3126 bp, 1041 aa] {ON} weakl...    32   3.1  
Skud_13.235 Chr13 complement(396755..398980) [2226 bp, 741 aa] {...    32   3.2  
Suva_14.124 Chr14 (232456..234216) [1761 bp, 586 aa] {ON} YNL218...    32   3.2  
Kpol_363.12 s363 complement(18968..20512) [1545 bp, 514 aa] {ON}...    32   3.3  
KLTH0H03542g Chr8 (320024..322993) [2970 bp, 989 aa] {ON} weakly...    32   3.5  
YNL218W Chr14 (238238..240001) [1764 bp, 587 aa] {ON}  MGS1Prote...    32   3.8  
SAKL0A06908g Chr1 (612325..613836) [1512 bp, 503 aa] {ON} simila...    32   4.3  
ZYRO0G03806g Chr7 (304402..306522) [2121 bp, 706 aa] {ON} simila...    32   4.3  
Skud_14.118 Chr14 (226974..228740) [1767 bp, 588 aa] {ON} YNL218...    32   4.4  
Smik_14.114 Chr14 (217529..219280) [1752 bp, 583 aa] {ON} YNL218...    32   4.8  
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...    32   4.8  
KAFR0F01270 Chr6 (243255..246236) [2982 bp, 993 aa] {ON}               32   5.0  
Kwal_55.19939 s55 complement(185588..187921) [2334 bp, 777 aa] {...    32   5.5  
NDAI0E01440 Chr5 complement(285903..288581) [2679 bp, 892 aa] {O...    32   6.0  
Suva_16.71 Chr16 (112264..113682) [1419 bp, 472 aa] {ON} YPL235W...    31   6.0  
ZYRO0E07282g Chr5 (555489..559088) [3600 bp, 1199 aa] {ON} simil...    32   6.1  
YPL235W Chr16 (103232..104647) [1416 bp, 471 aa] {ON}  RVB2ATP-d...    31   6.1  
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    32   6.1  
Smik_6.440 Chr6 complement(719661..721076) [1416 bp, 471 aa] {ON...    31   6.2  
NDAI0C06450 Chr3 (1491880..1494528) [2649 bp, 882 aa] {ON}             31   6.9  
Skud_16.43 Chr16 (76826..78241) [1416 bp, 471 aa] {ON} YPL235W (...    31   7.0  
Ecym_2154 Chr2 (289010..290413) [1404 bp, 467 aa] {ON} similar t...    31   7.2  
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    31   7.2  
TBLA0A02230 Chr1 complement(537595..539022) [1428 bp, 475 aa] {O...    31   7.4  
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    31   7.9  
SAKL0A03982g Chr1 complement(369575..373072) [3498 bp, 1165 aa] ...    31   8.3  
ZYRO0C04884g Chr3 (383579..385573) [1995 bp, 664 aa] {ON} simila...    31   8.6  
Kwal_23.3268 s23 (223136..224515) [1380 bp, 459 aa] {ON} YDR190C...    31   9.1  
Suva_13.257 Chr13 complement(404214..406430) [2217 bp, 738 aa] {...    31   9.8  

>ACR050C Chr3 complement(447221..448648) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL145W
           (RPT1)
          Length = 475

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/475 (96%), Positives = 460/475 (96%)

Query: 1   MFRFALSYTTLLHRQTITRDYAMPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVL 60
           MFRFALSYTTLLHRQTITRDYAMPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVL
Sbjct: 1   MFRFALSYTTLLHRQTITRDYAMPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVL 60

Query: 61  KTYGAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPL 120
           KTYGAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPL
Sbjct: 61  KTYGAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPL 120

Query: 121 QVARCTKIIRSNPSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGM 180
           QVARCTKIIRSNPSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGM
Sbjct: 121 QVARCTKIIRSNPSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGM 180

Query: 181 RVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSP 240
           RVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSP
Sbjct: 181 RVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSP 240

Query: 241 ERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 300
           ERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR
Sbjct: 241 ERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVR 300

Query: 301 ELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVM 360
           ELFEMARTKKACIIFFDEV               NEVQRTMLELITQLDGFDPRGNIKVM
Sbjct: 301 ELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVM 360

Query: 361 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCP 420
           FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCP
Sbjct: 361 FATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCP 420

Query: 421 NSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           NSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN
Sbjct: 421 NSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475

>Ecym_8250 Chr8 (512209..513579) [1371 bp, 456 aa] {ON} similar to
           Ashbya gossypii ACR050C
          Length = 456

 Score =  855 bits (2209), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/456 (92%), Positives = 428/456 (93%), Gaps = 3/456 (0%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           M PKEDWEKYK PVETE+EQKQAD+KIKPL+EGDIQVLKTYGAAPYAAKLKSTEKDLKDI
Sbjct: 1   MSPKEDWEKYKPPVETEDEQKQADDKIKPLTEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 60

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADA---SR 139
           EQRIKEKAGVKESDTGLAPSHLWDI+GDRQKLSERHPLQVARCTKII+S PS D+   S 
Sbjct: 61  EQRIKEKAGVKESDTGLAPSHLWDILGDRQKLSERHPLQVARCTKIIKSEPSRDSAGGSS 120

Query: 140 SGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRI 199
           S    G+DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRI
Sbjct: 121 SATTVGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRI 180

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFA LGIDPPKGILLYGP
Sbjct: 181 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAALGIDPPKGILLYGP 240

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV
Sbjct: 241 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 300

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                          NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI
Sbjct: 301 DAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 360

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI
Sbjct: 361 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 420

Query: 440 RSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           RSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN
Sbjct: 421 RSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 456

>Kpol_1032.87 s1032 complement(185143..186537) [1395 bp, 464 aa]
           {ON} complement(185143..186537) [1395 nt, 465 aa]
          Length = 464

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/464 (87%), Positives = 418/464 (90%), Gaps = 11/464 (2%)

Query: 23  MPPKEDWEKYKAPVETEE-EQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKD 81
           MPPKEDWEKYKAP+E +E E    DEKI PL+E DIQVLKTYGAAPYA+KLK TEKDLKD
Sbjct: 1   MPPKEDWEKYKAPLEGKENEDVSKDEKITPLTESDIQVLKTYGAAPYASKLKETEKDLKD 60

Query: 82  IEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASR-- 139
           IE RIKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+ + S +     
Sbjct: 61  IELRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSSTEGENDN 120

Query: 140 --------SGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFI 191
                   + AN  +DDE+AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY I
Sbjct: 121 GNGENGESASANDADDDEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 180

Query: 192 ELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPP 251
           ELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCKEQIEKLREVVELPLLSPERFATLGIDPP
Sbjct: 181 ELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKEQIEKLREVVELPLLSPERFATLGIDPP 240

Query: 252 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 311
           KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA
Sbjct: 241 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 300

Query: 312 CIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 371
           CIIFFDEV               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
Sbjct: 301 CIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 360

Query: 372 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 431
           ALLRPGRIDRKVEFSLPDLEGRANIFRIHTK+MSVERGIRWELISRLCPNSTGAELRSVC
Sbjct: 361 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKAMSVERGIRWELISRLCPNSTGAELRSVC 420

Query: 432 TEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           TEAGMFAIR+RRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN
Sbjct: 421 TEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 464

>SAKL0G11484g Chr7 (982362..982478,982604..983857) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 456

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/458 (87%), Positives = 417/458 (91%), Gaps = 7/458 (1%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKE+WEKY AP+E E  + + ++K+ PLSEGDIQVLKTYGAAPYA KLK  EKDLKDI
Sbjct: 1   MPPKENWEKYTAPIEEE--ETEEEKKVVPLSEGDIQVLKTYGAAPYANKLKEIEKDLKDI 58

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIR-----SNPSADA 137
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+     S+P    
Sbjct: 59  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKGDSSSSSPEDTQ 118

Query: 138 SRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPP 197
           S S  N+ EDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPP
Sbjct: 119 SNSSPNSEEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPP 178

Query: 198 RIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLY 257
           RIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFATLGIDPPKGILLY
Sbjct: 179 RIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFATLGIDPPKGILLY 238

Query: 258 GPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFD 317
           GPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFD
Sbjct: 239 GPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFD 298

Query: 318 EVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPG 377
           EV               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPG
Sbjct: 299 EVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPG 358

Query: 378 RIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMF 437
           RIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMF
Sbjct: 359 RIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMF 418

Query: 438 AIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           AIR+RRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 419 AIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 456

>TDEL0E03750 Chr5 (709088..710503) [1416 bp, 471 aa] {ON} Anc_5.251
           YKL145W
          Length = 471

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/472 (86%), Positives = 421/472 (89%), Gaps = 20/472 (4%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKEDWEKYKAP E E+++K  DEK  PL+EGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 1   MPPKEDWEKYKAPAE-EDKEKSNDEKNTPLTEGDIQVLKTYGAAPYAGKLKETEKDLKDI 59

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSN---------- 132
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKIIRSN          
Sbjct: 60  ENRIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIRSNGEGESRNEDG 119

Query: 133 -PSADASRSGANTGE--------DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 183
             +A  +R+G ++ E        DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 120 LDTATLARNGLDSNEPRETEEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179

Query: 184 VDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 243
           VDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF
Sbjct: 180 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 239

Query: 244 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 303
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299

Query: 304 EMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 363
           EMARTKKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 300 EMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 359

Query: 364 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 423
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST
Sbjct: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 419

Query: 424 GAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           GAELRSVCTEAGMFAIR+RRKVATEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVEKVINGYKKFSSTSRYMQYN 471

>KAFR0H03630 Chr8 (691036..692382) [1347 bp, 448 aa] {ON} Anc_5.251
           YKL145W
          Length = 448

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/453 (86%), Positives = 415/453 (91%), Gaps = 5/453 (1%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPK+DWEKYK P++ E  +++ +E+I PL+EGDIQVLKTYGAAPYA KLK TE+DLK I
Sbjct: 1   MPPKQDWEKYKTPIDEESSKEKKEEQIAPLTEGDIQVLKTYGAAPYADKLKVTEEDLKKI 60

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGA 142
           E RIKEKAGVKESDTGLAPSH+WD+MGDRQ+LSE HPLQVARCTKII+S     +S  GA
Sbjct: 61  EARIKEKAGVKESDTGLAPSHMWDVMGDRQRLSEEHPLQVARCTKIIKS-----SSEEGA 115

Query: 143 NTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPS 202
              ED++DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPPRIDP+
Sbjct: 116 EGNEDEDDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPT 175

Query: 203 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGT 262
           VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGT
Sbjct: 176 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGT 235

Query: 263 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXX 322
           GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE+   
Sbjct: 236 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAI 295

Query: 323 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 382
                       NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK
Sbjct: 296 GGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 355

Query: 383 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           VEFSLPDLEGRANIFRIH+K+MSVER IRWELISRLCPNSTGAELRSVCTEAGMFAIR+R
Sbjct: 356 VEFSLPDLEGRANIFRIHSKAMSVERNIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 415

Query: 443 RKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           RKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN
Sbjct: 416 RKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 448

>NCAS0F02300 Chr6 complement(456422..457846) [1425 bp, 474 aa] {ON}
           Anc_5.251
          Length = 474

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/474 (84%), Positives = 420/474 (88%), Gaps = 21/474 (4%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADE-KIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKD 81
           MPPKEDWEKYKAPV+ E+E+++A E KI PLSEGDIQVLKTYGAAPYAAKLK  EKDLK 
Sbjct: 1   MPPKEDWEKYKAPVDAEDEKEKAKEDKIVPLSEGDIQVLKTYGAAPYAAKLKEIEKDLKT 60

Query: 82  IEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASR-- 139
           IE +IKEK+GV+ESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+SN + +     
Sbjct: 61  IENKIKEKSGVRESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSNGNEEEQEGE 120

Query: 140 ------------------SGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 181
                             SG N  ++DEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR
Sbjct: 121 GESAASATSTTNNASTTGSGENGEDEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMR 180

Query: 182 VGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPE 241
           VGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPE
Sbjct: 181 VGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPE 240

Query: 242 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 301
           RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE
Sbjct: 241 RFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRE 300

Query: 302 LFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMF 361
           LFEMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMF
Sbjct: 301 LFEMARTKKACIIFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMF 360

Query: 362 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPN 421
           ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPN
Sbjct: 361 ATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPN 420

Query: 422 STGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           +TGAELRSVCTEAGMFAIR+RRKVA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 TTGAELRSVCTEAGMFAIRARRKVASEKDFLKAVEKVINGYKKFSSTSRYMQYN 474

>TPHA0B02550 Chr2 (583789..585180) [1392 bp, 463 aa] {ON} Anc_5.251
           YKL145W
          Length = 463

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/464 (85%), Positives = 415/464 (89%), Gaps = 12/464 (2%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           M PKEDWEKYKAPVE ++ +   D KI PLSEGDIQVLK+YGAAPY +K+K TEKDLK I
Sbjct: 1   MAPKEDWEKYKAPVEGKDSKPNED-KIIPLSEGDIQVLKSYGAAPYDSKIKETEKDLKVI 59

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIR--------SNPS 134
           E +IKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+        SN  
Sbjct: 60  EGKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKKSSENGDESNSE 119

Query: 135 ADASRSGANT---GEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFI 191
           +      ANT    +D+E+AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY I
Sbjct: 120 STEGNGTANTNTAADDNEEAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHI 179

Query: 192 ELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPP 251
           ELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFATLGIDPP
Sbjct: 180 ELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFATLGIDPP 239

Query: 252 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 311
           KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA
Sbjct: 240 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKA 299

Query: 312 CIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 371
           CIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP
Sbjct: 300 CIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDP 359

Query: 372 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 431
           ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC
Sbjct: 360 ALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVC 419

Query: 432 TEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           TEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 TEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 463

>KLTH0G07524g Chr7 (610689..610802,611037..612260) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 445

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/453 (86%), Positives = 412/453 (90%), Gaps = 8/453 (1%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKEDWEK+KAP E   E+KQ ++   PL+EGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 1   MPPKEDWEKFKAPAE---EEKQEEKPNVPLTEGDIQVLKTYGAAPYADKLKETEKDLKDI 57

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGA 142
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+   S ++     
Sbjct: 58  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKPEASDESP---- 113

Query: 143 NTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPS 202
              ED+ED+KY+INLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPPRIDPS
Sbjct: 114 -ADEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPS 172

Query: 203 VTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGT 262
           VTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPERFA LGIDPPKGILLYGPPGT
Sbjct: 173 VTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPERFAALGIDPPKGILLYGPPGT 232

Query: 263 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXX 322
           GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART+KACIIFFDE+   
Sbjct: 233 GKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTRKACIIFFDEIDAV 292

Query: 323 XXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 382
                       NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK
Sbjct: 293 GGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRK 352

Query: 383 VEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           VEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR+R
Sbjct: 353 VEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRAR 412

Query: 443 RKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           RKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 413 RKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 445

>CAGL0E06490g Chr5 (649826..651244) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145w YTA3
          Length = 472

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/472 (84%), Positives = 417/472 (88%), Gaps = 19/472 (4%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           M PKEDWEKYKAPVE++++ K  D+K  PL+EGDIQVLKTYGAAPYAAKLK TEKDLK+I
Sbjct: 1   MAPKEDWEKYKAPVESDDDNKLKDDKSIPLTEGDIQVLKTYGAAPYAAKLKETEKDLKEI 60

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGA 142
           EQRIKEK+G+KESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+S+ S + S   A
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSSASNEVSDESA 120

Query: 143 NTGEDDEDA-------------------KYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 183
             G +  ++                   KYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 121 VNGANTTNSATTGSGNDGDAEGDDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 180

Query: 184 VDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 243
           VDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF
Sbjct: 181 VDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 240

Query: 244 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 303
           ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 241 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 300

Query: 304 EMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 363
           EMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 301 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 360

Query: 364 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 423
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPNST
Sbjct: 361 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERNIRWELISRLCPNST 420

Query: 424 GAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           GAELRSVCTEAGMFAIR+RRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN
Sbjct: 421 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 472

>TBLA0C03040 Chr3 (734862..736268) [1407 bp, 468 aa] {ON} Anc_5.251
           YKL145W
          Length = 468

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/470 (83%), Positives = 414/470 (88%), Gaps = 19/470 (4%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           M PKEDW+KYKAP+E  +++   DEKI PLSEGDIQVLKTYGAAP A KLK TEKDLK+I
Sbjct: 1   MAPKEDWDKYKAPIE--DDKTTVDEKITPLSEGDIQVLKTYGAAPCAGKLKQTEKDLKEI 58

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSGA 142
            +RIKEK GVKESDTGLAPSHLWDIMGDRQ+LS  HPLQVARCTKII++N   + S S  
Sbjct: 59  RKRIKEKGGVKESDTGLAPSHLWDIMGDRQRLSSEHPLQVARCTKIIKANSDLENSNSMD 118

Query: 143 NTG-----------------EDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVD 185
           N                   ++DEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVD
Sbjct: 119 NNSTNNTPLDDTNHNNNIDEDNDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVD 178

Query: 186 RSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFAT 245
           RSKY IELPLPPRIDPSVTMMTVEEKPDVTY+DVGGCK+QIEKLREVVELPLLSPERFAT
Sbjct: 179 RSKYHIELPLPPRIDPSVTMMTVEEKPDVTYTDVGGCKDQIEKLREVVELPLLSPERFAT 238

Query: 246 LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEM 305
           LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEM
Sbjct: 239 LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEM 298

Query: 306 ARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNR 365
           ARTKKACIIFFDEV               NEVQRTMLELITQLDGFDPRGNIKVMFATNR
Sbjct: 299 ARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNR 358

Query: 366 PNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGA 425
           PNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGA
Sbjct: 359 PNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGA 418

Query: 426 ELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           ELRSVCTEAGMFAIR+RRKVA+EKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 419 ELRSVCTEAGMFAIRARRKVASEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>ZYRO0A10560g Chr1 (854410..855816) [1407 bp, 468 aa] {ON} highly
           similar to uniprot|P33299 Saccharomyces cerevisiae
           YKL145W RPT1 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 468

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/468 (83%), Positives = 412/468 (88%), Gaps = 15/468 (3%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPP+EDWEKYKAP+E   ++   D K  PLSEGDIQVLKTYGAAPYA KLK TEKDLKDI
Sbjct: 1   MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAAPYATKLKETEKDLKDI 60

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSG- 141
           EQRIKEK+G+KESDTGLAPSHLWDIMGDRQ+LSE HPLQVARCTKII+S   ++ +  G 
Sbjct: 61  EQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVARCTKIIKSTSDSNENGEGL 120

Query: 142 ---ANTGEDDED-----------AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 187
              A  G   E+           AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 121 DGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 180

Query: 188 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLG 247
           KY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGG K+QIEKLREVVELPLLSPERFA LG
Sbjct: 181 KYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQIEKLREVVELPLLSPERFAKLG 240

Query: 248 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 307
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 241 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 300

Query: 308 TKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 367
           +KKACI+FFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 301 SKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 360

Query: 368 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 427
           TLDPALLRPGRIDRKVEFSLPDLEGRAN+FRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 361 TLDPALLRPGRIDRKVEFSLPDLEGRANVFRIHSKSMSVERGIRWELISRLCPNSTGAEL 420

Query: 428 RSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           RSVCTEAGMFAIR+RRKVATEKDFL+AV+KVINGYKKFSSTSRYMQYN
Sbjct: 421 RSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSRYMQYN 468

>Skud_11.82 Chr11 (160364..161770) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/469 (84%), Positives = 414/469 (88%), Gaps = 17/469 (3%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKEDWEKYKAP++ ++++    +KI PL+EGDIQVLK+YGAAPYAAKLK TE DLKDI
Sbjct: 1   MPPKEDWEKYKAPLDDDDKKPDD-DKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDI 59

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRS-- 140
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+L E HPLQVARCTKII+ +   D S +  
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGSGENDDSTTDN 119

Query: 141 -----GANTGEDDEDA---------KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 186
                  N+  + E A         KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR
Sbjct: 120 NNDSVNGNSNSNQESADVDEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 179

Query: 187 SKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATL 246
           SKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERFATL
Sbjct: 180 SKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATL 239

Query: 247 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 306
           GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
Sbjct: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299

Query: 307 RTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 366
           RTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRP
Sbjct: 300 RTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359

Query: 367 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAE 426
           NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAE
Sbjct: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE 419

Query: 427 LRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           LRSVCTEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 LRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>YKL145W Chr11 (174213..175616) [1404 bp, 467 aa] {ON}  RPT1One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for optimal CDC20 transcription;
           interacts with Rpn12p and Ubr1p; mutant has aneuploidy
           tolerance
          Length = 467

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/468 (85%), Positives = 417/468 (89%), Gaps = 16/468 (3%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKEDWEKYKAP+E ++++    +KI PL+EGDIQVLK+YGAAPYAAKLK TE DLKDI
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPDD-DKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDI 59

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSG- 141
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+L E HPLQVARCTKII+ N  +D + +  
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDN 119

Query: 142 --------------ANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 187
                          +  EDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS
Sbjct: 120 NNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRS 179

Query: 188 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLG 247
           KY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERFATLG
Sbjct: 180 KYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLG 239

Query: 248 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 307
           IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR
Sbjct: 240 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 299

Query: 308 TKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 367
           TKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRPN
Sbjct: 300 TKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 359

Query: 368 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAEL 427
           TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAEL
Sbjct: 360 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAEL 419

Query: 428 RSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           RSVCTEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 RSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 467

>Smik_11.91 Chr11 (160113..161519) [1407 bp, 468 aa] {ON} YKL145W
           (REAL)
          Length = 468

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/469 (85%), Positives = 419/469 (89%), Gaps = 17/469 (3%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKEDWEKYKAP+E ++++    +KI PL+EGDIQVLK+YGAAPYAAKLK TE DLKDI
Sbjct: 1   MPPKEDWEKYKAPLEDDDKKPND-DKIVPLTEGDIQVLKSYGAAPYAAKLKQTESDLKDI 59

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSN-----PSADA 137
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+L E HPLQVARCTKII+ N     P+ D 
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDPTTDN 119

Query: 138 S-----------RSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 186
           +           +  A+  EDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR
Sbjct: 120 NSNSGNENSNSNQQSADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDR 179

Query: 187 SKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATL 246
           SKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERFATL
Sbjct: 180 SKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATL 239

Query: 247 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 306
           GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA
Sbjct: 240 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 299

Query: 307 RTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 366
           RTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFATNRP
Sbjct: 300 RTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 359

Query: 367 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAE 426
           NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAE
Sbjct: 360 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAE 419

Query: 427 LRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           LRSVCTEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 LRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 468

>Suva_11.80 Chr11 (160287..161702) [1416 bp, 471 aa] {ON} YKL145W
           (REAL)
          Length = 471

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/472 (83%), Positives = 418/472 (88%), Gaps = 20/472 (4%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKE+WEKYKAP+E ++++    +KI PL+EGDIQVLK+YGAAPYAAKLK TE DLKDI
Sbjct: 1   MPPKENWEKYKAPLEDDDKKSDE-DKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDI 59

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSN---------- 132
           E RIKEKAGVKESDTGLAPSHLWDIMGDRQ+L E HPLQVARCTKII+ N          
Sbjct: 60  EARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGENDDSTTNN 119

Query: 133 ---------PSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 183
                     ++++++  A+  EDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG
Sbjct: 120 NNDINSSNNNNSNSNQESADADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVG 179

Query: 184 VDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERF 243
           VDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLLSPERF
Sbjct: 180 VDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERF 239

Query: 244 ATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 303
           A LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF
Sbjct: 240 AALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELF 299

Query: 304 EMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFAT 363
           EMARTKKACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFAT
Sbjct: 300 EMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFAT 359

Query: 364 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST 423
           NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVER IRWELISRLCPNST
Sbjct: 360 NRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERDIRWELISRLCPNST 419

Query: 424 GAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           GAELRSVCTEAGMFAIR+RRKVATEKDFLKAVDKVI+GYKKFSSTSRYMQYN
Sbjct: 420 GAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 471

>KLLA0E13773g Chr5 complement(1215253..1216680) [1428 bp, 475 aa]
           {ON} highly similar to uniprot|P33299 Saccharomyces
           cerevisiae YKL145W RPT1 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           optimal CDC20 transcription interacts with Rpn12p and
           the E3 ubiquitin-protein ligase Ubr1p
          Length = 475

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/477 (83%), Positives = 415/477 (87%), Gaps = 26/477 (5%)

Query: 23  MPPKEDWEKYKAPVETEEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKDI 82
           MPPKEDWEKYKAP+E EE +++   K+ PLSEGDI+VLKTYGAAPYA KLKS E DLK+I
Sbjct: 1   MPPKEDWEKYKAPIEDEESKEEK--KVVPLSEGDIEVLKTYGAAPYAKKLKSIENDLKEI 58

Query: 83  EQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNP--------S 134
           E++IKEKAGVKESDTGLAPSHLWDI+GDRQ+LSE  PLQVARCTKII++           
Sbjct: 59  EKKIKEKAGVKESDTGLAPSHLWDIVGDRQRLSEEQPLQVARCTKIIKAEKPQRSGNALG 118

Query: 135 ADASRSG----------------ANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEE 178
            DA  +G                    EDD+DAKYVINLKQIAKFVVGLGERVSPTDIEE
Sbjct: 119 GDADGNGVAAAAAAAAAAAAAASGTEDEDDDDAKYVINLKQIAKFVVGLGERVSPTDIEE 178

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
           GMRVGVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL
Sbjct: 179 GMRVGVDRSKYQIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
           SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM
Sbjct: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VRELFEMARTKKACIIFFDEV               NEVQRTMLELITQLDGFDPRGNIK
Sbjct: 299 VRELFEMARTKKACIIFFDEVDAIGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIK 358

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL
Sbjct: 359 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418

Query: 419 CPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           CPNSTGAELRSVCTEAGMFAIR+RRKV TEKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 419 CPNSTGAELRSVCTEAGMFAIRARRKVTTEKDFLKAVEKVINGYKKFSSTSRYMQYN 475

>KNAG0H02300 Chr8 (417868..419301) [1434 bp, 477 aa] {ON} Anc_5.251
           YKL145W
          Length = 477

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/477 (80%), Positives = 403/477 (84%), Gaps = 24/477 (5%)

Query: 23  MPPKEDWEKYKAPVET-EEEQKQADEKIKPLSEGDIQVLKTYGAAPYAAKLKSTEKDLKD 81
           MPPKEDWEK K  VE  E++  +  E + PL+E DIQVLKTYG APYA KLK TE DLK+
Sbjct: 1   MPPKEDWEKQKPAVENAEDDAAKKGEDVAPLTEDDIQVLKTYGVAPYAVKLKETENDLKE 60

Query: 82  IEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVARCTKIIRSNPSADASRSG 141
           IE RIKEKAGV+ESDTGLAPSHLWDIMGDRQ+L E HPLQVARCTKII+S          
Sbjct: 61  IEARIKEKAGVRESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKSGEGDGNGSGN 120

Query: 142 ANTGEDDED-----------------------AKYVINLKQIAKFVVGLGERVSPTDIEE 178
            + G   +                        +KYVINLKQIAKFVVGLGERVSPTDIEE
Sbjct: 121 NSNGAAADGAGAAAAAGENAAQAAGADDDEDDSKYVINLKQIAKFVVGLGERVSPTDIEE 180

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
           GMRVGVDRSKY IELPLPPRIDP+VTMMTVEEKPDVTYSDVGGCK+QIEKLREVVELPLL
Sbjct: 181 GMRVGVDRSKYHIELPLPPRIDPTVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLL 240

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
           SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM
Sbjct: 241 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 300

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VRELFEMARTK+ACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIK
Sbjct: 301 VRELFEMARTKRACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIK 360

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRL
Sbjct: 361 VMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRL 420

Query: 419 CPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           CPN+TGAELRSVCTEAGMFAIR+RRKVA+EKDFLKAVDKVINGYKKFSSTSRYMQYN
Sbjct: 421 CPNATGAELRSVCTEAGMFAIRARRKVASEKDFLKAVDKVINGYKKFSSTSRYMQYN 477

>Kwal_23.2849 s23 (40940..42169) [1230 bp, 409 aa] {ON} YKL145W
           (RPT1) - putative ATPase, 26S protease subunit component
           [contig 246] FULL
          Length = 409

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/413 (88%), Positives = 381/413 (92%), Gaps = 7/413 (1%)

Query: 64  GAAPYAAKLKSTEKDLKDIEQRIKEKAGVKESDTGLAPSHLWDIMGDRQKLSERHPLQVA 123
           GAAPYA KLK+ +KDLKDIE +IKEKAGVKESDTGLAPSHLWDIMGDRQ+LSE HPLQVA
Sbjct: 3   GAAPYADKLKAIDKDLKDIEAKIKEKAGVKESDTGLAPSHLWDIMGDRQRLSEEHPLQVA 62

Query: 124 RCTKIIRSNPSADASRSGANTGEDDE-DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRV 182
           RCTKII+   S D      NTGE+DE D+KY+INLKQIAKFVVGLGERVSPTDIEEGMRV
Sbjct: 63  RCTKIIKPEASED------NTGEEDEEDSKYIINLKQIAKFVVGLGERVSPTDIEEGMRV 116

Query: 183 GVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPER 242
           GVDRSKY IELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQI+KLREVVELPLLSPER
Sbjct: 117 GVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIDKLREVVELPLLSPER 176

Query: 243 FATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 302
           FA LGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL
Sbjct: 177 FAALGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 236

Query: 303 FEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFA 362
           FEMART+KACIIFFDE+               NEVQRTMLELITQLDGFDPRGNIKVMFA
Sbjct: 237 FEMARTRKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFA 296

Query: 363 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS 422
           TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNS
Sbjct: 297 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNS 356

Query: 423 TGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           TGAELRSVCTEAGMFAIR+RRKVATEKDFL+AV+KVINGYKKFSSTS+YMQYN
Sbjct: 357 TGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEKVINGYKKFSSTSQYMQYN 409

>NDAI0C03780 Chr3 complement(860828..861985) [1158 bp, 385 aa] {ON}
           Anc_5.251
          Length = 385

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/391 (83%), Positives = 338/391 (86%), Gaps = 29/391 (7%)

Query: 108 MGDRQKLSERHPLQVARCTKIIRSNPSADASRSGANTGEDDED----------------- 150
           MGDRQ+LSE HPLQVARCTKII+ N ++      A  GED  D                 
Sbjct: 1   MGDRQRLSEEHPLQVARCTKIIKGNAAS------ATEGEDGGDEQINPTSTSNNSNAENA 54

Query: 151 ------AKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVT 204
                  KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKY IELPLPPRIDPSVT
Sbjct: 55  EEDEEDNKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVT 114

Query: 205 MMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGK 264
           MMTVEEKPD+TYSDVGGCK+QIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGK
Sbjct: 115 MMTVEEKPDITYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGK 174

Query: 265 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXX 324
           TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE+     
Sbjct: 175 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAIGG 234

Query: 325 XXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 384
                     NEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE
Sbjct: 235 ARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 294

Query: 385 FSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRK 444
           FSLPDLEGRANIFRIH+KSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR+RRK
Sbjct: 295 FSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRK 354

Query: 445 VATEKDFLKAVDKVINGYKKFSSTSRYMQYN 475
           VA+EKDFLKAV+KVINGYKKFSSTSRYMQYN
Sbjct: 355 VASEKDFLKAVEKVINGYKKFSSTSRYMQYN 385

>Suva_7.227 Chr7 complement(402610..403827) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  315 bits (806), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 210/311 (67%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGMFA+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQE 380

Query: 450 DFLKAVDKVIN 460
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>Skud_7.236 Chr7 complement(412698..413915) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  313 bits (803), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 210/311 (67%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 450 DFLKAVDKVIN 460
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>Smik_7.235 Chr7 complement(401584..402801) [1218 bp, 405 aa] {ON}
           YGL048C (REAL)
          Length = 405

 Score =  313 bits (803), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 210/311 (67%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 450 DFLKAVDKVIN 460
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>YGL048C Chr7 complement(410069..411286) [1218 bp, 405 aa] {ON}
           RPT6One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in the degradation of
           ubiquitinated substrates; bound by ubiquitin-protein
           ligases Ubr1p and Ufd4p; localized mainly to the nucleus
           throughout the cell cycle
          Length = 405

 Score =  313 bits (803), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 210/311 (67%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVE 140

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 200

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEG 260

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPS 320

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 450 DFLKAVDKVIN 460
           DF  AV KV+N
Sbjct: 381 DFELAVGKVMN 391

>KLLA0A04752g Chr1 complement(425610..426824) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates
          Length = 404

 Score =  310 bits (794), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 216/324 (66%), Gaps = 3/324 (0%)

Query: 140 SGANTGEDDE---DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLP 196
           SG+  GE  +   + K ++ ++   K++V + + ++  D++   RV +    Y +   L 
Sbjct: 67  SGSYVGEVLKVISEKKVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYQLHKVLE 126

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
            ++DP V++M VE+ PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++L
Sbjct: 127 NKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVIL 186

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           YGPPGTGKTL ARAVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF 
Sbjct: 187 YGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFM 246

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRP
Sbjct: 247 DEIDSIGSSRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRP 306

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGM 436
           GRIDRK+EF  P +  R  I RIH++ M++ RGI    ++      +GA+++ VCTEAGM
Sbjct: 307 GRIDRKIEFPPPTVAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGM 366

Query: 437 FAIRSRRKVATEKDFLKAVDKVIN 460
           +A+R RR   T++DF  AV KV+N
Sbjct: 367 YALRERRIHVTQEDFELAVAKVMN 390

>CAGL0D06292g Chr4 (593556..594758) [1203 bp, 400 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048c SUG1 26S proteasome regulatory subunit
          Length = 400

 Score =  308 bits (789), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 210/313 (67%), Gaps = 2/313 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 74  DKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLVNKADPLVSLMMVE 133

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 134 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 193

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV--XXXXXXXX 327
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 194 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 253

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                  +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  
Sbjct: 254 GGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPP 313

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVAT 447
           P +  RA I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T
Sbjct: 314 PTVAARAEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVT 373

Query: 448 EKDFLKAVDKVIN 460
           ++DF  AV KV+N
Sbjct: 374 QEDFELAVGKVMN 386

>Kwal_26.7474 s26 complement(379608..380825) [1218 bp, 405 aa] {ON}
           YGL048C (RPT6) - ATPase [contig 51] FULL
          Length = 405

 Score =  308 bits (788), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 205/301 (68%), Gaps = 1/301 (0%)

Query: 161 AKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 220
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 221 GCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 280
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 281 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN-EVQR 339
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 340 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 399
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 400 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           H++ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 460 N 460
           N
Sbjct: 391 N 391

>KLTH0D03806g Chr4 complement(371457..372674) [1218 bp, 405 aa] {ON}
           highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  307 bits (787), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/301 (50%), Positives = 205/301 (68%), Gaps = 1/301 (0%)

Query: 161 AKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 220
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 221 GCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 280
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 281 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN-EVQR 339
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 340 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 399
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  RA I RI
Sbjct: 271 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRI 330

Query: 400 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           H++ M++ RGI    I+      +GA+++ VCTEAGMFA+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVM 390

Query: 460 N 460
           N
Sbjct: 391 N 391

>ZYRO0G22330g Chr7 complement(1835777..1836994) [1218 bp, 405 aa]
           {ON} highly similar to uniprot|Q01939 Saccharomyces
           cerevisiae YGL048C RPT6 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 405

 Score =  307 bits (787), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 208/311 (66%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 81  DKKVLVKVQPEGKYIVDISKDINIKDLKPSQRVCLKSDSYTLHKILENKADPLVSLMMVE 140

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  +GG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 141 KVPDSTYDMLGGLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLAR 200

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 201 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARENAPSIIFMDEIDSIGSSRVEG 260

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P 
Sbjct: 261 SGGGDSEVQRTMLELLNQLDGFETSKNIKIVMATNRLDILDPALLRPGRIDRKIEFPPPT 320

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++
Sbjct: 321 VAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQE 380

Query: 450 DFLKAVDKVIN 460
           D   AV KV+N
Sbjct: 381 DLELAVGKVMN 391

>Kpol_1041.42 s1041 (110852..112063) [1212 bp, 403 aa] {ON}
           (110852..112063) [1212 nt, 404 aa]
          Length = 403

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D + ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 78  DKRVLVKVQPEGKYIVDVAKDINVKDLKPSQRVCLKSDTYMLHKVLENKADPLVSLMMVE 137

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 138 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 197

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 198 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 257

Query: 330 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 258 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 317

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +  R  I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 318 TVAARTEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 377

Query: 449 KDFLKAVDKVIN 460
           +DF  AV KV+N
Sbjct: 378 EDFELAVSKVMN 389

>NCAS0A05880 Chr1 complement(1154364..1155587) [1224 bp, 407 aa]
           {ON} Anc_4.57
          Length = 407

 Score =  307 bits (786), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 82  DKKVLVKVQPEGKYIVDIAKDINVKDLKTSQRVCLKSDSYMLHKILENKADPLVSLMMVE 141

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 142 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 201

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 202 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 261

Query: 330 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 262 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 321

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 322 TVAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 381

Query: 449 KDFLKAVDKVIN 460
           +DF  AV KV+N
Sbjct: 382 EDFELAVGKVMN 393

>AGL043C Chr7 complement(625438..626655) [1218 bp, 405 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL048C
           (RPT6)
          Length = 405

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 161 AKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 220
            K++V + + ++  D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 91  GKYIVDIAKDINVKDLKVSQRVCLKSDSYVLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 150

Query: 221 GCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 280
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 151 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 210

Query: 281 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN-EVQR 339
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+               + EVQR
Sbjct: 211 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 270

Query: 340 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 399
           TMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 271 TMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRI 330

Query: 400 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           H++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 331 HSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 390

Query: 460 N 460
           N
Sbjct: 391 N 391

>KNAG0D03200 Chr4 complement(573942..575144) [1203 bp, 400 aa] {ON}
           Anc_4.57 YGL048C
          Length = 400

 Score =  305 bits (782), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 208/315 (66%), Gaps = 4/315 (1%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 72  DTKVLVKVQPEGKYIVDVAKDINVKELKVSQRVCLKSDSYMLHKVLENKADPLVSLMMVE 131

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 132 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 191

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV----XXXXXX 325
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 192 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVES 251

Query: 326 XXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF 385
                    +EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF
Sbjct: 252 SSGGGGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEF 311

Query: 386 SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
             P L  R  I RIH++ M++ RGI    I       +GA+++ VCTEAGM+A+R RR  
Sbjct: 312 PAPTLAARTEILRIHSRKMNLTRGINLRKIVEKMNGCSGADVKGVCTEAGMYALRERRIH 371

Query: 446 ATEKDFLKAVDKVIN 460
            T++DF  AV KV+N
Sbjct: 372 VTQEDFELAVGKVMN 386

>TBLA0B09880 Chr2 (2356110..2357315) [1206 bp, 401 aa] {ON} Anc_4.57
           YGL048C
          Length = 401

 Score =  305 bits (782), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D + ++ ++   K++V + + ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 76  DKRVLVKIQPEGKYIVDVAKDINIKELKPSQRVCLKSDSYLLHKVLKNKSDPLVSLMMVE 135

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 136 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 195

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 196 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 255

Query: 330 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 256 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 315

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 316 TVAARTEILRIHSRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 375

Query: 449 KDFLKAVDKVIN 460
           +DF  AV KV+N
Sbjct: 376 EDFELAVAKVMN 387

>KAFR0F03100 Chr6 complement(617330..618547) [1218 bp, 405 aa] {ON}
           Anc_4.57 YGL048C
          Length = 405

 Score =  305 bits (782), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + ++  D++   RV +    Y +   L  + DP V++M VE
Sbjct: 80  DKKVLVKVQPEGKYIVDVAKDINVKDLKVSQRVCLKSDSYMLHKILENKADPLVSLMMVE 139

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVES 259

Query: 330 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 260 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 319

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +  R  I RIH++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 320 TVAARTEILRIHSRKMNLTRGINLRKIADKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 379

Query: 449 KDFLKAVDKVIN 460
           +DF  AV KV+N
Sbjct: 380 EDFELAVGKVMN 391

>NDAI0D02850 Chr4 (659572..660789) [1218 bp, 405 aa] {ON} Anc_4.57
          Length = 405

 Score =  305 bits (781), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D K ++ ++   K++V + + +   +++   RV +    Y +   L  + DP V++M VE
Sbjct: 80  DKKVLVKVQPEGKYIVDVAKDIDIKNLKPSQRVCLKSDSYMLHKVLENKSDPLVSLMMVE 139

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 140 KVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 199

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 200 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMARQHAPSIIFMDEIDSIGSSRVEG 259

Query: 330 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                + EVQRTMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 260 GSGGGDSEVQRTMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 319

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +  RA I RIH++ M++ RGI    ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 320 TVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 379

Query: 449 KDFLKAVDKVIN 460
           +DF  AV KV+N
Sbjct: 380 EDFELAVGKVMN 391

>TPHA0F00440 Chr6 complement(106389..107600) [1212 bp, 403 aa] {ON}
           Anc_4.57 YGL048C
          Length = 403

 Score =  305 bits (780), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 209/312 (66%), Gaps = 1/312 (0%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D + ++ ++   K++V +   ++  +++   RV +    Y +   L  + DP V++M VE
Sbjct: 78  DKRVLVKVQPEGKYIVDVAPDINVKELKPSQRVCLKSDSYLLHKVLDNKADPLVSLMMVE 137

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           + PD TY  VGG  +QI +++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL AR
Sbjct: 138 KVPDSTYDMVGGLTKQIREIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLAR 197

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA+ TD  FIRV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+          
Sbjct: 198 AVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEG 257

Query: 330 XXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                + EVQRTMLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P
Sbjct: 258 GSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPP 317

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +  RA I +IH++ M++ RGI  + ++      +GA+++ VCTEAGM+A+R RR   T+
Sbjct: 318 TVAARAEILKIHSRKMNLTRGINLKKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQ 377

Query: 449 KDFLKAVDKVIN 460
           +DF  AV KV+N
Sbjct: 378 EDFELAVAKVMN 389

>SAKL0H23672g Chr8 (2045883..2047109) [1227 bp, 408 aa] {ON} highly
           similar to uniprot|Q01939 Saccharomyces cerevisiae
           YGL048C RPT6 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates bound by
           ubiquitin- protein ligases Ubr1p and Ufd4p localized
           mainly to the nucleus throughout the cell cycle
          Length = 408

 Score =  305 bits (780), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 204/301 (67%), Gaps = 1/301 (0%)

Query: 161 AKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 220
            K++V + + +   D++   RV +    Y +   L  ++DP V++M VE+ PD TY  VG
Sbjct: 94  GKYIVDIAKDIDVKDLKTSQRVCLKSDSYTLHKVLENKVDPLVSLMMVEKVPDSTYDMVG 153

Query: 221 GCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 280
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 154 GLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 213

Query: 281 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN-EVQR 339
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+               + EVQR
Sbjct: 214 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQR 273

Query: 340 TMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRI 399
           TMLEL+ QLDGF+   +IK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RI
Sbjct: 274 TMLELLNQLDGFETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTIAARTEILRI 333

Query: 400 HTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           H++ M++ RGI  + I+      +GA+++ VCTEAGM+A+R RR   T++DF  AV KV+
Sbjct: 334 HSRKMNLTRGINLKKIAEQMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVM 393

Query: 460 N 460
           N
Sbjct: 394 N 394

>TDEL0E05660 Chr5 complement(1051545..1052765) [1221 bp, 406 aa]
           {ON} Anc_4.57 YGL048C
          Length = 406

 Score =  304 bits (779), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 149/300 (49%), Positives = 202/300 (67%)

Query: 161 AKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVG 220
            K++V + + ++  +++   RV +    Y +   L  + DP V++M VE+ PD TY  +G
Sbjct: 93  GKYIVDISKDINIKELKPSQRVCLKSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMLG 152

Query: 221 GCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFI 280
           G  +QI++++EV+ELP+  PE F +LGI  PKG++LYGPPGTGKTL ARAVA+ TD  FI
Sbjct: 153 GLTKQIKEIKEVIELPVKHPELFESLGITQPKGVILYGPPGTGKTLLARAVAHHTDCKFI 212

Query: 281 RVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRT 340
           RV G+ELVQKY+GEG+RMVRELF MAR     IIF DE+               +EVQRT
Sbjct: 213 RVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRT 272

Query: 341 MLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH 400
           MLEL+ QLDGF+   NIK++ ATNR + LDPALLRPGRIDRK+EF  P +  R  I RIH
Sbjct: 273 MLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTQILRIH 332

Query: 401 TKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVIN 460
           ++ M++ RGI    I+      +GA+++ VCTEAGM+A+R RR   T++D   AV KV+N
Sbjct: 333 SRKMNLTRGINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDLELAVGKVMN 392

>KLLA0C09592g Chr3 (833061..834365) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 434

 Score =  283 bits (723), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 196/307 (63%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTFEQ 172

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 232

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 352

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT ++       +E   ++     GA++R+  TEAG FAIR  R    ++D 
Sbjct: 353 GRLEIFKIHTSNVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDYINQEDL 412

Query: 452 LKAVDKV 458
           +KAV KV
Sbjct: 413 MKAVRKV 419

>AAL113W Chr1 (146143..147441) [1299 bp, 432 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR259C (RPT4)
          Length = 432

 Score =  281 bits (720), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 141/309 (45%), Positives = 194/309 (62%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           D KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 109 DEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTF 168

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+
Sbjct: 169 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAK 228

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV          
Sbjct: 229 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 288

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 289 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 348

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
             G   IF+IHT  +       +E   ++C    GA++R+  TEAG FAIR  R    ++
Sbjct: 349 EAGMLEIFKIHTAKVKKSGEFDFEAAVKMCDGFNGADIRNCVTEAGFFAIRDDRDYIIQE 408

Query: 450 DFLKAVDKV 458
           D +KAV KV
Sbjct: 409 DLMKAVRKV 417

>Skud_15.425 Chr15 complement(751324..752637) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  281 bits (718), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R   T  D 
Sbjct: 356 GRLEIFKIHTEKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIREDRDHITSDDL 415

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>YOR259C Chr15 complement(812395..813708) [1314 bp, 437 aa] {ON}
           RPT4One of six ATPases of the 19S regulatory particle of
           the 26S proteasome involved in degradation of
           ubiquitinated substrates; contributes preferentially to
           ERAD; required for spindle pole body duplication; mainly
           nuclear localization
          Length = 437

 Score =  280 bits (716), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KNAG0G02720 Chr7 complement(606758..608092) [1335 bp, 444 aa] {ON}
           Anc_8.708 YOR259C
          Length = 444

 Score =  280 bits (715), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  T +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 123 KYIVKASSGPRYIVGVRNSVDRTKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 182

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 183 GEITFDGIGGLTEQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 242

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 303 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNEA 362

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT ++       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEIFKIHTANVKKHGEFDFDAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV +  KK   T  Y +
Sbjct: 423 MKAVRKV-SETKKLEGTIEYQK 443

>Smik_15.442 Chr15 complement(762080..763393) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  279 bits (714), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V+ + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVNRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 355

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R      D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDL 415

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>KLTH0D11990g Chr4 complement(976271..977572) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 433

 Score =  279 bits (714), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 194/307 (63%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 112 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFEQ 171

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            D+T+  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 172 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 231

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 232 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 291

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 292 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 351

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 352 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 411

Query: 452 LKAVDKV 458
           +KAV KV
Sbjct: 412 MKAVRKV 418

>Ecym_2365 Chr2 (712020..713303) [1284 bp, 427 aa] {ON} similar to
           Ashbya gossypii AAL113W
          Length = 427

 Score =  279 bits (713), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 195/309 (63%)

Query: 150 DAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVE 209
           + KY++      +++VG+      + +++G+RV +D +   I   LP   DP V  MT  
Sbjct: 104 EEKYIVKASSGPRYIVGVRNSADRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTTF 163

Query: 210 EKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCAR 269
           E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI+ PKG+LLYGPPGTGKTL A+
Sbjct: 164 EQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGINSPKGVLLYGPPGTGKTLLAK 223

Query: 270 AVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX 329
           AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV          
Sbjct: 224 AVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSE 283

Query: 330 XXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPD 389
                 E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+
Sbjct: 284 GTSADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPN 343

Query: 390 LEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
             GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R    ++
Sbjct: 344 EAGRLEIFKIHTAKVKKTGEFDFEATVKMSDGFNGADIRNCVTEAGFFAIRDDRDYIIQE 403

Query: 450 DFLKAVDKV 458
           D +KAV KV
Sbjct: 404 DLMKAVRKV 412

>SAKL0H05764g Chr8 (514898..516163) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259C RPT4 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 421

 Score =  278 bits (712), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 193/307 (62%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E 
Sbjct: 100 KYIVKASSGPRYIVGVRNSVDRSKLKKGIRVTLDITTLTIMRILPRETDPLVYNMTTFEP 159

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 160 GEISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 219

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 220 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 279

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E SLP+  
Sbjct: 280 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEISLPNEA 339

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 340 GRLEIFKIHTAHVKKSGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIQDDL 399

Query: 452 LKAVDKV 458
           +KAV KV
Sbjct: 400 MKAVRKV 406

>Suva_8.308 Chr8 complement(551573..552886) [1314 bp, 437 aa] {ON}
           YOR259C (REAL)
          Length = 437

 Score =  278 bits (710), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 116 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 175

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++T+  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 176 GEITFDGIGGLTDQIRELREVIELPLKNPEIFQRIGIKPPKGVLLYGPPGTGKTLLAKAV 235

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 236 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 295

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 296 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKLEIPLPNEA 355

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 356 GRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPEDL 415

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   T  Y +
Sbjct: 416 MKAVRKVAE-VKKLEGTIEYQK 436

>NCAS0B01150 Chr2 (192406..193686) [1281 bp, 426 aa] {ON} Anc_8.708
          Length = 426

 Score =  277 bits (709), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 199/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 105 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 164

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 165 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 224

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 225 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 284

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRKVE  LP+  
Sbjct: 285 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEA 344

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +  +    +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 345 GRLEIFKIHTAKVKKQGDFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 404

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   +  Y +
Sbjct: 405 MKAVRKVAE-VKKLEGSLEYQK 425

>NDAI0E01020 Chr5 (206043..207374) [1332 bp, 443 aa] {ON} Anc_8.708
          Length = 443

 Score =  278 bits (710), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V    +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRKKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 181

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            +VT+  +GG  EQI  LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEVTFDGIGGLTEQIRALREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 301

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 421

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   +  Y +
Sbjct: 422 MKAVRKVAE-VKKLEGSLEYQK 442

>TDEL0A06530 Chr1 complement(1140292..1141599) [1308 bp, 435 aa]
           {ON} Anc_8.708 YOR259C
          Length = 435

 Score =  277 bits (709), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 144/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 114 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 173

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            D+++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 174 GDISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQPPKGVLLYGPPGTGKTLLAKAV 233

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 234 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 293

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  KV+ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 294 SADREIQRTLMELLTQMDGFDNLGQTKVIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 353

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 354 GRLEIFKIHTVHVKKSGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 413

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   +  Y +
Sbjct: 414 MKAVRKVAE-VKKLEGSLDYQK 434

>Kwal_26.8912 s26 complement(1003260..1004564) [1305 bp, 434 aa]
           {ON} YOR259C (RPT4) - ATPase; component of the 26S
           proteasome cap subunit [contig 68] FULL
          Length = 434

 Score =  277 bits (708), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 139/307 (45%), Positives = 193/307 (62%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 113 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 172

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            D+T+  +GG  EQI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL A+AV
Sbjct: 173 GDLTFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIQSPKGVLLYGPPGTGKTLLAKAV 232

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 233 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 292

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E +LP+  
Sbjct: 293 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEINLPNET 352

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IH+  +       +E   ++     GA++R+  TEAG FAIR  R    + D 
Sbjct: 353 GRFEIFKIHSAKVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIQDDL 412

Query: 452 LKAVDKV 458
           +KAV KV
Sbjct: 413 MKAVRKV 419

>Kpol_1064.22 s1064 complement(38724..40022) [1299 bp, 432 aa] {ON}
           complement(38724..40022) [1299 nt, 433 aa]
          Length = 432

 Score =  276 bits (707), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 197/320 (61%), Gaps = 1/320 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 111 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 170

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 171 GEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 230

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 231 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 290

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 291 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 350

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 351 GRLEIFKIHTAHVKKAGEFDFEAAVKMSDGFNGADIRNCITEAGFFAIRDDRDHIIPEDL 410

Query: 452 LKAVDKVINGYKKFSSTSRY 471
           +KAV KV    KK   +  Y
Sbjct: 411 MKAVRKVAE-VKKLEGSLEY 429

>CAGL0K08910g Chr11 (893007..894317) [1311 bp, 436 aa] {ON} highly
           similar to uniprot|P53549 Saccharomyces cerevisiae
           YOR259c CRL13
          Length = 436

 Score =  276 bits (706), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 198/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 115 KYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 174

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 175 GEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 234

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV            
Sbjct: 235 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGT 294

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 295 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 354

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT  +       ++   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 355 GRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHIIPEDL 414

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   T  Y +
Sbjct: 415 MKAVRKVAE-VKKLEGTLEYQK 435

>KAFR0A04010 Chr1 complement(809423..810697) [1275 bp, 424 aa] {ON}
           Anc_8.708 YOR259C
          Length = 424

 Score =  276 bits (705), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 201/322 (62%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 103 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQ 162

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            +++++ +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 163 GEISFNGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAV 222

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           +    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 223 SATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 282

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 283 SADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 342

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  IF+IHT ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 343 GRLEIFKIHTANVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 402

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV +  KK   T  Y +
Sbjct: 403 MKAVRKV-SEVKKLEGTLEYQK 423

>TPHA0D01470 Chr4 complement(302134..303501) [1368 bp, 455 aa] {ON}
           Anc_8.708 YOR259C
          Length = 455

 Score =  276 bits (707), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 143/326 (43%), Positives = 201/326 (61%), Gaps = 1/326 (0%)

Query: 146 EDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTM 205
           +D  D KY++      +++VG+   +  + +++G+RV +D +   I   LP   DP V  
Sbjct: 128 KDLSDEKYIVKASSGPRYIVGVRNSIDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYN 187

Query: 206 MTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKT 265
           MT  E+ ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKT
Sbjct: 188 MTSFEQGEISFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKT 247

Query: 266 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX 325
           L A+AVA    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DEV      
Sbjct: 248 LLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKDHEPCIIFMDEVDAIGGR 307

Query: 326 XXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF 385
                     E+QRT++EL+TQ+DGF+  G  K++ ATNRP+TLDPALLRPGR+DRK+E 
Sbjct: 308 RFSEGTSADREIQRTLMELLTQMDGFENLGQTKIIMATNRPDTLDPALLRPGRLDRKIEI 367

Query: 386 SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
            LP+  GR  IF+IHT+ +       +E   ++     GA++R+  TEAG FAIR  R  
Sbjct: 368 PLPNEAGRLEIFKIHTEKVKKIGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIREDRNH 427

Query: 446 ATEKDFLKAVDKVINGYKKFSSTSRY 471
              +D +KAV KV    KK   +  Y
Sbjct: 428 IIPEDLMKAVRKVAE-VKKLEGSLEY 452

>Ecym_5527 Chr5 (1069222..1070520) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii AER254W
          Length = 432

 Score =  275 bits (703), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 218/367 (59%), Gaps = 13/367 (3%)

Query: 113 KLSERHPLQVARCTKIIRSNPSADASRS---GANTGEDDEDAKYVINLKQIAKF-----V 164
           K +++ P  VA   +I+  +   D + S   G N   D+    Y   +K  ++      +
Sbjct: 70  KNNKQLPYLVANVVEIMDMDGLDDTNESVTQGGNLNLDNAAKGYAAVVKTSSRQTVFLPM 129

Query: 165 VGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 224
           VGL   V+P  ++    VGV++  Y +   LP   D  V  M V++KP  TYSDVGG  +
Sbjct: 130 VGL---VNPKKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDDKPTETYSDVGGLDK 186

Query: 225 QIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 284
           QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++  
Sbjct: 187 QIEELVEAIVLPMKQAEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAA 246

Query: 285 SELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLEL 344
            +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLEL
Sbjct: 247 PQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLEL 306

Query: 345 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSM 404
           + QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ M
Sbjct: 307 LNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRKM 366

Query: 405 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKK 464
           + +  I W+ ++R      GA+L++V  EAGM A+R+ + V   +DF++A+ +V    +K
Sbjct: 367 TTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVVKHEDFVEAISEV--QARK 424

Query: 465 FSSTSRY 471
             S S Y
Sbjct: 425 TKSVSFY 431

>TBLA0D01240 Chr4 (310540..311871) [1332 bp, 443 aa] {ON} Anc_8.708
           YOR259C
          Length = 443

 Score =  275 bits (704), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 199/320 (62%), Gaps = 1/320 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  E+
Sbjct: 122 KYIVKASSGPRYIVGVRNSVDRSRLKKGVRVTLDITTLTIMRILPRETDPLVYNMTAFEQ 181

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  EQI +LREV+ELPL +PE F  +GI PPKG+LLYGPPGTGKTL A+AV
Sbjct: 182 GEISFDGIGGLTEQIRELREVIELPLKNPEIFERVGIKPPKGVLLYGPPGTGKTLLAKAV 241

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 242 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 301

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL++Q+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 302 SADREIQRTLMELLSQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 361

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR +IF+IHT  +       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 362 GRLDIFKIHTSKVKKVGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDL 421

Query: 452 LKAVDKVINGYKKFSSTSRY 471
           +KAV KV +  KK   +  Y
Sbjct: 422 MKAVRKV-SEVKKLEGSLEY 440

>NCAS0A10180 Chr1 complement(2028343..2029656) [1314 bp, 437 aa]
           {ON} Anc_3.216
          Length = 437

 Score =  275 bits (702), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 207/331 (62%), Gaps = 5/331 (1%)

Query: 129 IRSNPSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 188
           IR NP      S     E  +D   ++    +  F V +   V    +E G  V +    
Sbjct: 99  IRGNP-----LSIGTLEEIIDDDHAIVTSPTMPDFYVSILSFVDKELLEPGCSVLLHHKT 153

Query: 189 YFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGI 248
             I   L    DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI
Sbjct: 154 MSIVGVLQDDADPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGI 213

Query: 249 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 308
            PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A  
Sbjct: 214 KPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGE 273

Query: 309 KKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 368
           +   IIF DE+                E+QRTMLEL+ QLDGFD RG++KV+ ATN+  T
Sbjct: 274 QAPSIIFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIET 333

Query: 369 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELR 428
           LDPAL+RPGRIDRK+ F  PDL  +  I  IHT  M++ + + +E +     + +GA+++
Sbjct: 334 LDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSKDVDFETLVTTKDDLSGADIQ 393

Query: 429 SVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           ++CTEAG+ A+R RR   T +DF +A ++V+
Sbjct: 394 AMCTEAGLLALRERRMQVTGEDFKQAKERVM 424

>KLLA0E21209g Chr5 complement(1893904..1895202) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 432

 Score =  274 bits (701), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 129 MVGL---VDPVKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 185

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 186 KQIEELVEAIVLPMKQGEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 245

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 246 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 305

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 306 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 365

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 366 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNAQSTIKHEDFVEAIGEV--QAR 423

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 424 KSKSVSFY 431

>NCAS0F03330 Chr6 (674144..675448) [1305 bp, 434 aa] {ON} Anc_5.428
          Length = 434

 Score =  273 bits (698), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 194/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V PT ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPTKLKPNDLVGVNKDSYLILEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  +GRA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDGRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0G02376g Chr7 (198787..200091) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  273 bits (698), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKQSEKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEEARAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KTKSVSFY 433

>TPHA0H01770 Chr8 (408198..409502) [1305 bp, 434 aa] {ON} Anc_5.251
           YKL145W
          Length = 434

 Score =  273 bits (697), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P +++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 LVGL---VDPKNLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  E RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEESRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W  ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWSELARSTDEFNGAQLKAVAVEAGMIALRNGQSSVKHEDFVEAISEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLTH0F16214g Chr6 complement(1313746..1315050) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P33297 Saccharomyces
           cerevisiae YOR117W RPT5 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates recruited to
           the GAL1-10 promoter region upon induction of
           transcription
          Length = 434

 Score =  271 bits (694), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEG+++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>NDAI0A07290 Chr1 (1663036..1664166) [1131 bp, 376 aa] {ON}
           Anc_3.216
          Length = 376

 Score =  269 bits (688), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 137/331 (41%), Positives = 202/331 (61%), Gaps = 5/331 (1%)

Query: 129 IRSNPSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 188
           IR NP      S     E  +D   ++    +  F V +   V    +  G  V +    
Sbjct: 38  IRGNP-----LSIGTLEEIIDDDHAIVTSPTMPDFYVSILSFVDKELLGPGCAVSLHHKT 92

Query: 189 YFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGI 248
             I   L   +DP V++M +++ P  +Y D+GG + QI++++E VELPL  PE +  +GI
Sbjct: 93  MSIVGVLQDDVDPMVSVMKIDKSPTESYGDIGGLEAQIQEIKEAVELPLTHPELYEEMGI 152

Query: 249 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 308
            PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A  
Sbjct: 153 KPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVASE 212

Query: 309 KKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 368
               IIF DE+                E+QRTMLEL+ QLDGFD    +KV+ ATN+  T
Sbjct: 213 NSPSIIFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSEVKVIMATNKIET 272

Query: 369 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELR 428
           LDPAL+RPGRIDRK+ F  PDL  +  I  IHT  M++   + +E +     + +GA+++
Sbjct: 273 LDPALIRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDFETLVTTKDDLSGADIQ 332

Query: 429 SVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           ++CTEAG+ A+R RR   T +DF +A ++V+
Sbjct: 333 AMCTEAGLLALRERRMQVTAEDFKQAKERVM 363

>KAFR0F02440 Chr6 (477459..478769) [1311 bp, 436 aa] {ON} Anc_3.216
           YDL007W
          Length = 436

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 164 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 223

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 224 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 283

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 284 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 343

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 344 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLEKLVTSKDDLSGADIQAMCTEAGLLAL 403

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 404 RERRMQVTSEDFEQAKERVL 423

>YDL007W Chr4 (438047..439360) [1314 bp, 437 aa] {ON}  RPT2One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; required for normal peptide hydrolysis by
           the core 20S particle
          Length = 437

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>KNAG0C04960 Chr3 complement(957096..958367) [1272 bp, 423 aa] {ON}
           Anc_5.428 YOR117W
          Length = 423

 Score =  271 bits (692), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 120 MVGL---VDPDTLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 176

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 177 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 236

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 237 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 296

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF    N+KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 297 LLNQLDGFSSDDNVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 356

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF+ A+ +V    +
Sbjct: 357 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQASVKHEDFVDAIGEV--QAR 414

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 415 KSKSVSFY 422

>Kwal_55.21453 s55 complement(844026..845330) [1305 bp, 434 aa] {ON}
           YOR117W (RPT5) - 26S protease regulatory subunit [contig
           130] FULL
          Length = 434

 Score =  271 bits (693), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LPL   E+F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPLKQAEKFTNMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEG+++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGSKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSQVKHEDFVEAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>AER254W Chr5 (1106478..1107860) [1383 bp, 460 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR117W (RPT5)
          Length = 460

 Score =  271 bits (694), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 217/367 (59%), Gaps = 13/367 (3%)

Query: 113 KLSERHPLQVARCTKIIRSNPSADASRS---GANTGEDDEDAKYVINLKQIAKF-----V 164
           K +++ P  VA   +I+  +   D + S   G N   D+    Y   +K  ++      +
Sbjct: 98  KNNKQLPYLVANVVEIMDMDELDDTNESTTQGGNLNLDNAAKGYAAVVKTSSRQTVFLPM 157

Query: 165 VGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKE 224
           VGL   V P  ++    VGV++  Y I   LP   D  V  M V++KP  TYSDVGG  +
Sbjct: 158 VGL---VDPKQLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDDKPTETYSDVGGLDK 214

Query: 225 QIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIG 284
           QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++  
Sbjct: 215 QIEELVEAIVLPMKQADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLAA 274

Query: 285 SELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLEL 344
            +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLEL
Sbjct: 275 PQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLEL 334

Query: 345 ITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSM 404
           + QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ M
Sbjct: 335 LNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRKM 394

Query: 405 SVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYKK 464
           + +  I W+ ++R      GA+L++V  EAGM A+R+ + V   +DF++A+ +V    +K
Sbjct: 395 TSDDSINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSVIKHEDFVEAIGEV--QARK 452

Query: 465 FSSTSRY 471
             S S Y
Sbjct: 453 TKSVSFY 459

>Suva_4.246 Chr4 (435306..436619) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>CAGL0A02750g Chr1 (292470..293759) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117w YTA1
          Length = 429

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 126 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 182

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 183 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 242

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 243 APQLVQMFIGEGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 302

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 303 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 362

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 363 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMLALRNGQSSVKHEDFVEAIGEV--QAR 420

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 421 KSKSVSFY 428

>Smik_4.229 Chr4 (417215..418528) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  271 bits (692), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>TDEL0D04060 Chr4 (744364..745677) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 186/273 (68%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP +++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  MS+   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVINGYKKFSSTSRYM 472
           R RR   T +DF +A ++V+    + +    YM
Sbjct: 405 RERRMQVTAEDFKQAKERVMKNKVEENLEGLYM 437

>KNAG0K01530 Chr11 complement(315711..317018) [1308 bp, 435 aa] {ON}
           Anc_3.216 YDL007W
          Length = 435

 Score =  270 bits (691), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 163 DPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 222

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 223 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGDNAPSIVFIDEI 282

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 283 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 342

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA++++VCTEAG+ A+
Sbjct: 343 DRKILFESPDLATKKKILGIHTSKMNLSADVDLEKLVTSKDDLSGADIQAVCTEAGLLAL 402

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 403 RERRMQVTAEDFKQAKERVM 422

>YOR117W Chr15 (545029..546333) [1305 bp, 434 aa] {ON}  RPT5One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; recruited to the GAL1-10 promoter region
           upon induction of transcription; similar to human TBP1
          Length = 434

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Smik_15.295 Chr15 (506228..507532) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>ZYRO0A04224g Chr1 (341547..342860) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 437

 Score =  270 bits (690), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 125/260 (48%), Positives = 180/260 (69%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP +  M +++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           EVQRTMLEL+ QLDGFD RG+IKV+ ATNR  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PD+  +  I  IHT  M++   +R + +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTAEDFKQAKERVM 424

>Suva_8.170 Chr8 (302825..304129) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  270 bits (689), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_1010.74 s1010 complement(182279..183592) [1314 bp, 437 aa]
           {ON} complement(182279..183592) [1314 nt, 438 aa]
          Length = 437

 Score =  270 bits (689), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 136/331 (41%), Positives = 204/331 (61%), Gaps = 5/331 (1%)

Query: 129 IRSNPSADASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSK 188
           IR NP      S     E  +D   ++    +  + V +   V    +E G  V +    
Sbjct: 99  IRGNP-----LSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKT 153

Query: 189 YFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGI 248
             I   L    DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI
Sbjct: 154 MSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGI 213

Query: 249 DPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMART 308
            PPKG++LYG PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A  
Sbjct: 214 KPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAE 273

Query: 309 KKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNT 368
               I+F DE+                E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +
Sbjct: 274 NAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIES 333

Query: 369 LDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELR 428
           LDPAL+RPGRIDRK+ F  PDL+ +  I  IHT  M++   +  E +     + +GA+++
Sbjct: 334 LDPALIRPGRIDRKILFEQPDLQTKRKILTIHTSKMNLSEDVNLEQLVTSKDDLSGADIQ 393

Query: 429 SVCTEAGMFAIRSRRKVATEKDFLKAVDKVI 459
           ++CTEAG+ A+R RR   T +DF +  ++V+
Sbjct: 394 AMCTEAGLLALRERRMQVTAEDFKQGKERVL 424

>Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007W
           (RPT2) - (putative) 26S protease subunit [contig 31]
           FULL
          Length = 376

 Score =  268 bits (684), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 132/324 (40%), Positives = 200/324 (61%)

Query: 149 EDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTV 208
           +D   +I       F V +   V    +E G  V +      I   L    DP + +M +
Sbjct: 53  DDDHAIITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKI 112

Query: 209 EEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCA 268
           ++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A
Sbjct: 113 DKSPTESYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLA 172

Query: 269 RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX 328
           +AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F+ A      I+F DE+         
Sbjct: 173 KAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYD 232

Query: 329 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                  E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  P
Sbjct: 233 SNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENP 292

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
           D+  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R RR   T 
Sbjct: 293 DISTKRKILTIHTSKMNLAPDVDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTA 352

Query: 449 KDFLKAVDKVINGYKKFSSTSRYM 472
           +DF +A ++++    + +  S Y+
Sbjct: 353 EDFKQAKERILKNKVEENLESLYL 376

>ZYRO0F11946g Chr6 complement(973218..974552) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P53549 Saccharomyces
           cerevisiae YOR259C RPT4 One of six ATPases of the 19S
           regulatory particle of the 26S proteasome involved in
           the degradation of ubiquitinated substrates required for
           spindle pole body duplication localized mainly to the
           nucleus throughout the cell cycle
          Length = 444

 Score =  270 bits (689), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 197/322 (61%), Gaps = 1/322 (0%)

Query: 152 KYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEK 211
           KY++      +++VG+   V  + +++G+RV +D +   I   LP   DP V  MT  ++
Sbjct: 123 KYIVKASSGPRYIVGVRNSVERSKLKKGVRVTLDITTLTIMRVLPRETDPLVYNMTSFDQ 182

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
            ++++  +GG  +QI +LREV+ELPL +PE F  +GI  P G+LLYGPPGTGKTL A+AV
Sbjct: 183 DNISFDGIGGLTDQIRELREVIELPLKNPEIFQRVGIKSPTGVLLYGPPGTGKTLLAKAV 242

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A    A FI    S +V KY+GE AR++RE+F  A+  + CIIF DE+            
Sbjct: 243 AATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEIDAIGGRRFSEGT 302

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
               E+QRT++EL+TQ+DGFD  G  K++ ATNRP+TLDPALLRPGR+DRK+E  LP+  
Sbjct: 303 SADREIQRTLMELLTQMDGFDSLGQTKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEA 362

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDF 451
           GR  +F+IHT ++       +E   ++     GA++R+  TEAG FAIR  R     +D 
Sbjct: 363 GRLEVFKIHTTNVKKAGEFDFEAAVKMSDGFNGADIRNCVTEAGFFAIRDDRDHIIPEDM 422

Query: 452 LKAVDKVINGYKKFSSTSRYMQ 473
           +KAV KV    KK   T  Y +
Sbjct: 423 MKAVRKVAES-KKLEGTVDYQK 443

>KAFR0E03890 Chr5 (770235..771539) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  269 bits (688), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMQRADKFKDLGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Kpol_1062.33 s1062 complement(71197..72501) [1305 bp, 434 aa] {ON}
           complement(71197..72501) [1305 nt, 435 aa]
          Length = 434

 Score =  269 bits (688), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TDEL0E01970 Chr5 complement(371140..372444) [1305 bp, 434 aa] {ON}
           Anc_5.428 YOR117W
          Length = 434

 Score =  269 bits (687), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDTLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIKAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF+ A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVDAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>Skud_15.280 Chr15 (501467..502771) [1305 bp, 434 aa] {ON} YOR117W
           (REAL)
          Length = 434

 Score =  269 bits (687), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 191/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILDTLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ Y+GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+    I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 368 MTTADDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>SAKL0C11440g Chr3 complement(1028353..1029660,1029734..1029736)
           [1311 bp, 436 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 436

 Score =  269 bits (687), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 202/324 (62%)

Query: 149 EDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTV 208
           +D   ++       F V +   V    +E G  V +      I   L    DP V++M +
Sbjct: 113 DDDHAIVTSPTTPDFYVSILSFVDKEMLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKI 172

Query: 209 EEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCA 268
           ++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A
Sbjct: 173 DKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLA 232

Query: 269 RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX 328
           +AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+         
Sbjct: 233 KAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKRYD 292

Query: 329 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                  E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  P
Sbjct: 293 SNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENP 352

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
           D+  +  I  IHT  M++   I  E +     + +GA+++++CTEAG+ A+R RR   T 
Sbjct: 353 DISTKRKILGIHTSKMNLSGDIDLENLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTA 412

Query: 449 KDFLKAVDKVINGYKKFSSTSRYM 472
           +DF +A ++V+    + +  S Y+
Sbjct: 413 EDFKQAKERVMKNKVEENLESLYL 436

>CAGL0I04884g Chr9 (446336..447637) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007w YTA5
          Length = 433

 Score =  269 bits (687), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 161 DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 220

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 221 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 280

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 281 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 340

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 341 DRKILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMCTEAGLLAL 400

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 401 RERRMQVTAEDFKQAKERVM 420

>Skud_4.247 Chr4 (429639..430952) [1314 bp, 437 aa] {ON} YDL007W
           (REAL)
          Length = 437

 Score =  268 bits (686), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 182/260 (70%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKRKILGIHTSKMNLCEDVNLETLVTTKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 405 RERRMQVTGEDFKQAKERVM 424

>TPHA0A04270 Chr1 (962488..963801) [1314 bp, 437 aa] {ON} Anc_3.216
           YDL007W
          Length = 437

 Score =  268 bits (686), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 181/260 (69%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  +YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 165 DPMVSVMKMDKSPTESYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 224

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  TLDPAL+RPGRI
Sbjct: 285 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRI 344

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+
Sbjct: 345 DRKILFENPDLSTKKKILGIHTSKMNLAEDVDLETLVTSKDDLSGADIQAMCTEAGLLAL 404

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +  ++V+
Sbjct: 405 RERRMQVTAEDFKQGKERVL 424

>NDAI0B05620 Chr2 (1374568..1376016) [1449 bp, 482 aa] {ON}
           Anc_5.428
          Length = 482

 Score =  270 bits (689), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 193/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V PT ++    VGV++  Y +   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 179 MVGL---VDPTKLKPNDLVGVNKDSYLVLEKLPSEFDSRVKAMEVDEKPTETYSDVGGLD 235

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 236 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 295

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 296 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 355

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 356 LLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDSRAQILQIHSRK 415

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 416 MTTDNDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 473

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 474 KSKSVSFY 481

>Ecym_5286 Chr5 (578258..579571) [1314 bp, 437 aa] {ON} similar to
           Ashbya gossypii AEL011W
          Length = 437

 Score =  268 bits (684), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 198/313 (63%), Gaps = 2/313 (0%)

Query: 147 DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMM 206
           DD+ A  ++       F V +   V    +E G  V +      I   L    DP V++M
Sbjct: 114 DDDHA--IVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGALQDDADPMVSVM 171

Query: 207 TVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTL 266
            +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL
Sbjct: 172 KIDKSPAESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTL 231

Query: 267 CARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXX 326
            A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+       
Sbjct: 232 LAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKR 291

Query: 327 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 386
                    E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F 
Sbjct: 292 YDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFE 351

Query: 387 LPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVA 446
            PD+  +  I  IHT  M++   +  E +       +GA+++++CTEAG+ A+R RR   
Sbjct: 352 NPDITTKRKILGIHTSKMNLSEDVNLETLVTSKDELSGADIKAMCTEAGLLALRERRMQV 411

Query: 447 TEKDFLKAVDKVI 459
           T +DF +A ++V+
Sbjct: 412 TVEDFKQAKERVM 424

>TBLA0A03740 Chr1 (935676..936980) [1305 bp, 434 aa] {ON} Anc_5.428
           YOR117W
          Length = 434

 Score =  268 bits (684), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 138/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y +   LP   D  V  M V+EKP   YSDVGG  
Sbjct: 131 MVGL---VDPNKLKPNDLVGVNKDSYLVLDTLPSEFDSRVKAMEVDEKPTENYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  LGI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     IKV+ ATNR + LDPALLR GR+DRK+EF LP  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRIKVLAATNRVDVLDPALLRSGRLDRKIEFPLPTEDARAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++A+ +V    +
Sbjct: 368 MTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEAIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>TBLA0F00690 Chr6 (177827..179131) [1305 bp, 434 aa] {ON} Anc_3.216
           YDL007W
          Length = 434

 Score =  267 bits (683), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 180/260 (69%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P  TYSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTETYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+VR++F++A      I+F DE+
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLVRQIFKVAGENAPSIVFIDEI 281

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD   ++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDTSDVKVIMATNKIESLDPALIRPGRI 341

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PDL  +  I  IHT  MS+   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDLSTKRKILAIHTSKMSLSEDVSLDELVTSKDDLSGADIQAMCTEAGLLAL 401

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T KDF +  ++V+
Sbjct: 402 RERRMQVTAKDFEQGKERVL 421

>AEL011W Chr5 (613775..615088) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL007W (RPT2)
          Length = 437

 Score =  267 bits (682), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 199/313 (63%), Gaps = 2/313 (0%)

Query: 147 DDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMM 206
           DD+ A  ++       F V +   V    +E G  V +      I   L    DP V++M
Sbjct: 114 DDDHA--IVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVM 171

Query: 207 TVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTL 266
            +++ P  +Y+D+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL
Sbjct: 172 KIDKSPTESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTL 231

Query: 267 CARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXX 326
            A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+       
Sbjct: 232 LAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEIDAIGTKR 291

Query: 327 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 386
                    E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F 
Sbjct: 292 YDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFE 351

Query: 387 LPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVA 446
            PD+  +  I  IHT  M++   +  E +     + +GA+++++CTEAG+ A+R RR   
Sbjct: 352 NPDVSTKRKILGIHTSKMNLSADVDLETLVTSKDDLSGADIKAMCTEAGLLALRERRMQV 411

Query: 447 TEKDFLKAVDKVI 459
           T +DF +A ++V+
Sbjct: 412 TVEDFKQAKERVM 424

>ZYRO0F09900g Chr6 (804272..805576) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P33297 Saccharomyces cerevisiae
           YOR117W RPT5 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates recruited to the
           GAL1-10 promoter region upon induction of transcription
          Length = 434

 Score =  266 bits (680), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 192/308 (62%), Gaps = 5/308 (1%)

Query: 164 VVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCK 223
           +VGL   V P  ++    VGV++  Y I   LP   D  V  M V+EKP  TYSDVGG  
Sbjct: 131 MVGL---VDPDKLKPNDLVGVNKDSYLILETLPSEFDSRVKAMEVDEKPTETYSDVGGLD 187

Query: 224 EQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI 283
           +QIE+L E + LP+   ++F  +GI  PKG L+YGPPGTGKTL ARA A +T+ATF+++ 
Sbjct: 188 KQIEELVEAIVLPMKRADKFTDMGIRAPKGALMYGPPGTGKTLLARACAAQTNATFLKLA 247

Query: 284 GSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLE 343
             +LVQ ++GEGA++VR+ F +A+ K   IIF DE+                EVQRTMLE
Sbjct: 248 APQLVQMFIGEGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKSGDREVQRTMLE 307

Query: 344 LITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS 403
           L+ QLDGF     +KV+ ATNR + LDPALLR GR+DRK+EF +P  + RA I +IH++ 
Sbjct: 308 LLNQLDGFGSDDRVKVVAATNRVDVLDPALLRSGRLDRKIEFPIPSEDSRAQILQIHSRK 367

Query: 404 MSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVDKVINGYK 463
           M+ +  I W+ ++R      GA+L++V  EAGM A+R+ +     +DF++ + +V    +
Sbjct: 368 MATDDDINWQELARSTDEFNGAQLKAVSVEAGMIALRNGQSSVKHEDFVEGIGEV--QAR 425

Query: 464 KFSSTSRY 471
           K  S S Y
Sbjct: 426 KSKSVSFY 433

>KLLA0F14707g Chr6 (1361964..1363268) [1305 bp, 434 aa] {ON} highly
           similar to uniprot|P40327 Saccharomyces cerevisiae
           YDL007W RPT2 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates required for
           normal peptide hydrolysis by the core 20S particle
          Length = 434

 Score =  265 bits (678), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 181/260 (69%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           DP V++M +++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG 
Sbjct: 162 DPMVSVMKMDKSPTENYSDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGA 221

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F++A      I+F DE+
Sbjct: 222 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFIDEI 281

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                           E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRI
Sbjct: 282 DAIGTKRYESNSGGEKEIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRI 341

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           DRK+ F  PD+  +  I  IHT  M++   +  + +     + +GA+++++CTEAG+ A+
Sbjct: 342 DRKILFENPDITTKRKIVGIHTSKMNLAEDVDLDNLVTSKDDLSGADIKAMCTEAGLLAL 401

Query: 440 RSRRKVATEKDFLKAVDKVI 459
           R RR   T +DF +A ++V+
Sbjct: 402 RERRMQVTAQDFKEAKERVL 421

>KLTH0G16698g Chr7 complement(1451637..1452941,1453023..1453085)
           [1368 bp, 455 aa] {ON} highly similar to uniprot|P40327
           Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases
           of the 19S regulatory particle of the 26S proteasome
           involved in the degradation of ubiquitinated substrates
           required for normal peptide hydrolysis by the core 20S
           particle
          Length = 455

 Score =  266 bits (679), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 129/311 (41%), Positives = 194/311 (62%)

Query: 149 EDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTV 208
           +D   +I       F V +   V    +E G  V +      I   L    DP + +M +
Sbjct: 132 DDDHAIITSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDTDPMINVMKI 191

Query: 209 EEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCA 268
           ++ P   YSD+GG + QI++++E VELPL  PE +  +GI PPKG++LYG PGTGKTL A
Sbjct: 192 DKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLA 251

Query: 269 RAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX 328
           +AVAN+T ATF+R++GSEL+QKY+G+G R+ R++F+ A      I+F DE+         
Sbjct: 252 KAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKAAGENAPSIVFIDEIDAIGTKRYD 311

Query: 329 XXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLP 388
                  E+QRTMLEL+ QLDGFD RG++KV+ ATN+  +LDPAL+RPGRIDRK+ F  P
Sbjct: 312 SNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENP 371

Query: 389 DLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
           D+  +  I  IHT  M++   +  + +     + +GA+++++CTEAG+ A+R RR   T 
Sbjct: 372 DITTKRKILAIHTSKMNLATDVDLDNLVTSKDDLSGADIKAMCTEAGLLALRERRMQVTA 431

Query: 449 KDFLKAVDKVI 459
           +DF +A ++++
Sbjct: 432 EDFKQAKERIL 442

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score =  254 bits (650), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 177/278 (63%), Gaps = 5/278 (1%)

Query: 180 MRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+ 
Sbjct: 135 MSVALHRHSNALVDILPPDSDSSISIMGANEKPDVTYADVGGLDMQKQEIREAVELPLVQ 194

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMV
Sbjct: 195 ADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMV 254

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           R++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 255 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 314

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 315 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 372

Query: 419 CPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 373 VRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>ZYRO0D11528g Chr4 (970060..971421) [1362 bp, 453 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 453

 Score =  254 bits (650), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/292 (47%), Positives = 180/292 (61%), Gaps = 8/292 (2%)

Query: 180 MRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           M V + R    + + LPP  D S+++M   EKPDVTYSDVGG   Q +++RE VELPL  
Sbjct: 160 MSVALHRHSNALVVILPPDSDSSISIMNESEKPDVTYSDVGGLDIQKQEIREAVELPLTQ 219

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMV
Sbjct: 220 ADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMV 279

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           R++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 280 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELMTQMDGFDQSTNVKV 339

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 340 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 397

Query: 419 CPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKAVD---KVINGYKKF 465
             N   +GA + ++  EAG+ A+R  R V  + D  +A D   K  N   KF
Sbjct: 398 IRNDSLSGAVIAAIMQEAGLRAVRRNRYVILQSDLEEAYDAQVKTENDVDKF 449

>KLLA0C06534g Chr3 (572219..573505) [1287 bp, 428 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates
          Length = 428

 Score =  253 bits (646), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 133/262 (50%), Positives = 171/262 (65%), Gaps = 3/262 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 150 LPPDSDSSISIMAANEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 209

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 210 LLYGPPGTGKTMLVKAVANATEAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 269

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 270 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 329

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 432
           RPGR+DRK+EF SL D   R  IF      MS+      + LI R  P S GA + ++  
Sbjct: 330 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 388

Query: 433 EAGMFAIRSRRKVATEKDFLKA 454
           EAG+ A+R  R V  + D  +A
Sbjct: 389 EAGLRAVRKNRYVILQSDLEEA 410

>NDAI0A04290 Chr1 complement(967063..968343) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  253 bits (645), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 176/278 (63%), Gaps = 5/278 (1%)

Query: 180 MRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+ 
Sbjct: 133 MSVALHRHSNALVDILPPDSDSSISVMGSNEKPDVTYADVGGLDMQKQEIREAVELPLVQ 192

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMV
Sbjct: 193 GDLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMV 252

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           R++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 253 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 312

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 313 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTVASKMSL--APEADLDSLI 370

Query: 419 CPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 371 IRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>NCAS0A11980 Chr1 (2374708..2375988) [1281 bp, 426 aa] {ON}
           Anc_5.486
          Length = 426

 Score =  252 bits (644), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 177/279 (63%), Gaps = 5/279 (1%)

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 132 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 191

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RM
Sbjct: 192 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRM 251

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VR++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 252 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 311

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 417
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 312 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 369

Query: 418 LCPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>Ecym_4548 Chr4 complement(1081534..1082811) [1278 bp, 425 aa] {ON}
           similar to Ashbya gossypii AFR394W
          Length = 425

 Score =  252 bits (643), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 132/262 (50%), Positives = 173/262 (66%), Gaps = 3/262 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISILGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 326

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 432
           RPGR+DRK+EF SL D   R  IF      MS+   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 433 EAGMFAIRSRRKVATEKDFLKA 454
           EAG+ A+R  R V  ++D  +A
Sbjct: 386 EAGLRAVRKNRYVILQRDLEEA 407

>Smik_4.668 Chr4 (1182472..1183758) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  251 bits (642), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VR++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 417
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 418 LCPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TPHA0J02860 Chr10 (633666..634961) [1296 bp, 431 aa] {ON} Anc_5.486
           YDR394W
          Length = 431

 Score =  251 bits (642), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 131/263 (49%), Positives = 172/263 (65%), Gaps = 5/263 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISIMGDNEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T+A+FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 272

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS--TGAELRSVC 431
           RPGR+DRK+EF SL D   R  IF      MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLIVRNDSLSGAIIAAIM 390

Query: 432 TEAGMFAIRSRRKVATEKDFLKA 454
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>CAGL0K09526g Chr11 (939503..940798) [1296 bp, 431 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394w YTA2 26S proteasome regulatory subunit
          Length = 431

 Score =  251 bits (642), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 131/263 (49%), Positives = 171/263 (65%), Gaps = 5/263 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 153 LPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGV 212

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T A FIRV GSE VQKY+GEG RMVR++F +AR     I+
Sbjct: 213 LLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIV 272

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 273 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 332

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNS--TGAELRSVC 431
           RPGR+DRK+EF SL D   R  IF      MS+      +L S +  N   +GA + ++ 
Sbjct: 333 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSLIIRNDAISGAVIAAIM 390

Query: 432 TEAGMFAIRSRRKVATEKDFLKA 454
            EAG+ A+R  R V  + D  +A
Sbjct: 391 QEAGLRAVRKNRYVILQSDLEEA 413

>YDR394W Chr4 (1261681..1262967) [1287 bp, 428 aa] {ON}  RPT3One of
           six ATPases of the 19S regulatory particle of the 26S
           proteasome involved in the degradation of ubiquitinated
           substrates; substrate of N-acetyltransferase B
          Length = 428

 Score =  251 bits (641), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VR++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 417
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 418 LCPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>AFR394W Chr6 (1143880..1145298) [1419 bp, 472 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR394W (RPT3)
          Length = 472

 Score =  253 bits (645), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 170/259 (65%), Gaps = 3/259 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 189 LPPDSDSSISIMGNNEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 248

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 249 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 308

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 309 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRHDTLDPALL 368

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 432
           RPGR+DRK+EF SL D   R  IF      MS+   +  + LI R  P S GA + ++  
Sbjct: 369 RPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSLAPEVDLDSLIIRNDPLS-GALIAAIMQ 427

Query: 433 EAGMFAIRSRRKVATEKDF 451
           EAG+ A+R  R V  + D 
Sbjct: 428 EAGLRAVRKNRYVILQSDL 446

>Skud_4.668 Chr4 (1183563..1184849) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  251 bits (641), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 134/279 (48%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
            M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLV 193

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VR++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 417
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 418 LCPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>TBLA0D01860 Chr4 complement(456813..458102) [1290 bp, 429 aa] {ON}
           Anc_5.486 YDR394W
          Length = 429

 Score =  251 bits (641), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 133/278 (47%), Positives = 175/278 (62%), Gaps = 5/278 (1%)

Query: 180 MRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           M V + R    +   LPP  D S++++   EKPDVTY+DVGG   Q +++RE VELPL+ 
Sbjct: 136 MSVALHRHSNALVDILPPDSDSSISILGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQ 195

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            + +  +GIDPP G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMV
Sbjct: 196 ADLYEQIGIDPPSGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMV 255

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           R++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 256 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 315

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 316 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APEADLDSLI 373

Query: 419 CPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 374 IRNDSLSGATIAAIMQEAGLRAVRKNRYVILQNDLEEA 411

>KAFR0E03580 Chr5 complement(720946..722223) [1278 bp, 425 aa] {ON}
           Anc_5.486 YDR394W
          Length = 425

 Score =  250 bits (639), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 133/278 (47%), Positives = 175/278 (62%), Gaps = 5/278 (1%)

Query: 180 MRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           M V + R    +   LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL  
Sbjct: 132 MSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLTQ 191

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            + +  +G+DPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMV
Sbjct: 192 ADLYEQIGVDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMV 251

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           R++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 252 RDVFRLARENAPAIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 311

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 312 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFSTIAGKMSL--APETDLDSLI 369

Query: 419 CPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 370 IRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 407

>SAKL0G03828g Chr7 (315123..316400) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  250 bits (638), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/262 (50%), Positives = 170/262 (64%), Gaps = 3/262 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M   EKPDVTY+DVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGSGEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTSAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENSPSII 266

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALL 326

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 432
           RPGR+DRK+EF SL D   R  IF      MS+      + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDPLS-GALIAAIMQ 385

Query: 433 EAGMFAIRSRRKVATEKDFLKA 454
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>Suva_2.571 Chr2 (1012937..1014223) [1287 bp, 428 aa] {ON} YDR394W
           (REAL)
          Length = 428

 Score =  249 bits (637), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/279 (47%), Positives = 175/279 (62%), Gaps = 5/279 (1%)

Query: 179 GMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLL 238
            M V + R    +   LPP  D S+++M   EKPDV+Y+DVGG   Q +++RE VELPL+
Sbjct: 134 SMSVALHRHSNALVDILPPDSDSSISVMGESEKPDVSYADVGGLDMQKQEIREAVELPLV 193

Query: 239 SPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARM 298
             + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T A FIRV GSE V KY+GEG RM
Sbjct: 194 QADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRM 253

Query: 299 VRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIK 358
           VR++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+K
Sbjct: 254 VRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVK 313

Query: 359 VMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISR 417
           V+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S 
Sbjct: 314 VIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIASKMSL--APEADLDSL 371

Query: 418 LCPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
           +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 372 IIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 410

>KNAG0C04590 Chr3 complement(901771..903069) [1299 bp, 432 aa] {ON}
           Anc_5.486 YDR394W
          Length = 432

 Score =  250 bits (638), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 135/296 (45%), Positives = 181/296 (61%), Gaps = 5/296 (1%)

Query: 162 KFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGG 221
            +VV +   +    ++  M V + R    +   LPP  D S+ +M   EKPDVTY+DVGG
Sbjct: 121 NYVVRILSTLDREQLKPSMSVALHRHSNALVDILPPDSDSSIAVMGENEKPDVTYADVGG 180

Query: 222 CKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIR 281
              Q +++RE VELPL   + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIR
Sbjct: 181 LDMQKQEIREAVELPLTQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIR 240

Query: 282 VIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTM 341
           V GSE V KY+GEG RMVR++F +AR     IIF DEV                EVQR +
Sbjct: 241 VNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRIL 300

Query: 342 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIH 400
           +EL+TQ+DGFD   N+KV+ ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF   
Sbjct: 301 IELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTV 360

Query: 401 TKSMSVERGIRWELISRLCPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
              M++      +L S +  N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 361 AAKMAL--APEADLDSLIIRNDSLSGAVIAAIMQEAGLRAVRKNRYVILQSDLEEA 414

>TDEL0A03500 Chr1 (623972..625252) [1281 bp, 426 aa] {ON} Anc_5.486
           YDR394W
          Length = 426

 Score =  242 bits (617), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 176/278 (63%), Gaps = 5/278 (1%)

Query: 180 MRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           M V + R    +   LPP  D S+++M+  EKPDVTY+DVGG   Q +++RE VELPL  
Sbjct: 133 MSVALHRHSNALVDILPPDSDSSISIMSENEKPDVTYADVGGLDMQKQEIREAVELPLTQ 192

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            + +  +GIDPP+G+LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMV
Sbjct: 193 ADLYQQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMV 252

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           R++F +AR     IIF DEV                EVQR ++EL+TQ+DGFD   N+KV
Sbjct: 253 RDVFRLARENAPSIIFIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKV 312

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWELISRL 418
           + ATNR +TLDPALLRPGR+DRK+EF SL D   R  IF      MS+      +L S +
Sbjct: 313 IMATNRADTLDPALLRPGRLDRKIEFPSLRDRRERRLIFGTIAAKMSL--APETDLDSLI 370

Query: 419 CPNS--TGAELRSVCTEAGMFAIRSRRKVATEKDFLKA 454
             N   +GA + ++  EAG+ A+R  R V  + D  +A
Sbjct: 371 IRNDSLSGATIAAIMQEAGLRAVRKNRYVILQSDLEEA 408

>KLTH0G02662g Chr7 (206550..207827) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P33298 Saccharomyces cerevisiae
           YDR394W RPT3 One of six ATPases of the 19S regulatory
           particle of the 26S proteasome involved in the
           degradation of ubiquitinated substrates substrate of N-
           acetyltransferase B
          Length = 425

 Score =  241 bits (614), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 172/262 (65%), Gaps = 3/262 (1%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M+  EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMSANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGV 206

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T+  FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALL 374
           F DEV                EVQR ++EL+TQ+DGFD   N+KV+ ATNR +TLDPALL
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALL 326

Query: 375 RPGRIDRKVEF-SLPDLEGRANIFRIHTKSMSVERGIRWE-LISRLCPNSTGAELRSVCT 432
           RPGR+DRK+EF SL D   R  IF      M++   +  + LI R  P S GA + ++  
Sbjct: 327 RPGRLDRKIEFPSLRDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLS-GALIAAIMQ 385

Query: 433 EAGMFAIRSRRKVATEKDFLKA 454
           EAG+ A+R  R V  + D  +A
Sbjct: 386 EAGLRAVRKNRYVILQSDLEEA 407

>Kpol_1020.9 s1020 complement(19429..21867) [2439 bp, 812 aa] {ON}
           complement(19429..21867) [2439 nt, 813 aa]
          Length = 812

 Score =  208 bits (529), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F T+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 202 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 261

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 262 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 317

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 318 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 377

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 378 GRLEVLRIHTKNMKLADDVDLESIAAETHGFVGADIASLCSEAAMQQIREK 428

 Score =  181 bits (458), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/251 (36%), Positives = 142/251 (56%), Gaps = 3/251 (1%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 462 NPSALRETVVENVNVTWDDIGGLDEIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 521

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 522 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 581

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 582 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 638

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 639 DQLIYVPLPDETARLSILKAQLRKSPLEPGLDLNAIAKSTQGFSGADLSYIAQRAAKFAI 698

Query: 440 RSRRKVATEKD 450
           +   +   E++
Sbjct: 699 KDSIQANIERE 709

>TBLA0J00640 Chr10 (149521..152079) [2559 bp, 852 aa] {ON} Anc_7.288
           YDL126C
          Length = 852

 Score =  208 bits (530), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 214 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 273

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 274 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 329

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 330 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAA 389

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 390 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 440

 Score =  181 bits (458), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 136/241 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 474 NPSALRETVVENVNVTWDDIGGLDDIKNELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 533

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 534 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 593

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 594 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 653

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 654 DQLIYVPLPDEVARESILSAQLRKSPIEPGVDLTAIAKATKGFSGADLSYIAQRAAKFAI 713

Query: 440 R 440
           +
Sbjct: 714 K 714

>TDEL0H01560 Chr8 complement(267940..270456) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  208 bits (529), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLAEDVDLESLASETHGYVGADIASLCSEAAMQQIREK 436

 Score =  185 bits (470), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 144/256 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I +   +   +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSIMKAQLRKAPLEPGLDLNAISKATQGFSGADLSYIVQRAAKFAI 709

Query: 440 RSRRKVATEKDFLKAV 455
           +   +   + +  KAV
Sbjct: 710 KDSIEAQRQLEAKKAV 725

>NCAS0E03580 Chr5 (711229..713034) [1806 bp, 601 aa] {ON} Anc_7.288
          Length = 601

 Score =  203 bits (516), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 43  DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 102

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 103 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 158

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN +DPAL R GR DR+V+  +PD  
Sbjct: 159 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNAIDPALRRFGRFDREVDIGIPDAV 218

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I RIHTK+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 219 GRLEILRIHTKNMKLADDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 269

 Score =  180 bits (456), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 142/250 (56%), Gaps = 1/250 (0%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 303 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 362

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 363 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 422

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 423 -DSIAKARGGSMGEGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 481

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     ++  +E G+   LI++     +GA+L  +   A  FAI
Sbjct: 482 DQLIYVPLPDEVARLSILHAQLRNTPLEPGLDLSLIAKASQGFSGADLSYIVQRAAKFAI 541

Query: 440 RSRRKVATEK 449
           +   +   E+
Sbjct: 542 KESIEAQVER 551

>TBLA0C04840 Chr3 (1172444..1174987) [2544 bp, 847 aa] {ON}
           Anc_7.288 YDL126C
          Length = 847

 Score =  207 bits (526), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           D+ Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 217 DIGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLIYGPPGTGKTLMARAVA 276

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 277 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 332

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 333 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGVPDAT 392

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E+I+       GA++ S+C+EA M  IR +
Sbjct: 393 GRLEVLRIHTKNMKLSDDVDLEVIASETHGFVGADIASLCSEAAMQQIREK 443

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  +   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 477 NPSALRETVVENVNVTWDDIGGLDDIKSELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 536

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 537 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 596

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ LDPA+LRPGR+
Sbjct: 597 DSIAKARGHNAGDDASD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQLDPAILRPGRL 654

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 655 DQLIYVPLPDEVARLSILKAQLRKSPLEPGVDLTAIAKATKGFSGADLSYIAQRAAKYAI 714

Query: 440 R 440
           +
Sbjct: 715 K 715

>Kpol_2000.15 s2000 complement(25249..27720) [2472 bp, 823 aa] {ON}
           complement(25249..27720) [2472 nt, 824 aa]
          Length = 823

 Score =  206 bits (524), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F T+GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKTIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLVDDVDLESLAAETHGYVGADIASLCSEAAMQQIREK 435

 Score =  181 bits (459), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 91/254 (35%), Positives = 144/254 (56%), Gaps = 3/254 (1%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG ++   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWDDIGGLEDIKNELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 528

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILNAQLRKTPLEPGLDLGAIAKTTQGFSGADLSYIVQRAAKFAI 708

Query: 440 RSR---RKVATEKD 450
           +     ++V +E+D
Sbjct: 709 KESIEAQRVKSEED 722

>SAKL0F09834g Chr6 (753930..756458) [2529 bp, 842 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 842

 Score =  206 bits (525), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPSIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (463), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG     E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDGIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I +   ++  +E G+    IS+     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDDTARLSILKAQLRNTPLEPGLDLGAISKATQGFSGADLSYIAQRAAKFAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>KLLA0F05676g Chr6 complement(553406..555898) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane
           and cytosol with homology to mammalian p97 in a complex
           with Npl4p and Ufd1p participates in retrotranslocation
           of ubiquitinated proteins from the ER into the cytosol
           for degradation by the proteasome
          Length = 830

 Score =  206 bits (524), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PPKGIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPKGILMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R NI V+ ATNRPN++DPAL R GR DR+V+  +PD+ 
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNIVVIAATNRPNSIDPALRRFGRFDREVDIGVPDVT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEKLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 140/241 (58%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD  GR +I     ++  +E G+  + I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDETGRLSILSAQLRNTPLEPGLDLKTIAQATQGFSGADLLYIVQRAAKFAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>KLTH0A05324g Chr1 (442339..444837) [2499 bp, 832 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 832

 Score =  206 bits (523), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  186 bits (473), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 147/262 (56%), Gaps = 5/262 (1%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELSTIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 440 R-----SRRKVATEKDFLKAVD 456
           +      RR +A ++  +K  D
Sbjct: 710 KDSIEAQRRALAEQQSRVKTED 731

>KNAG0B02940 Chr2 complement(564664..567180) [2517 bp, 838 aa] {ON}
           Anc_7.288 YDL126C
          Length = 838

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILGAQLRNTPLEPGLDLTAIAKATTGFSGADLSYIAQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>NCAS0A13760 Chr1 (2701600..2704077) [2478 bp, 825 aa] {ON} 
          Length = 825

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 270

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E I+       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEVLRIHTKNMKLADDVDLEYIASETHGYVGADIASLCSEAAMQQIREK 437

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%), Gaps = 2/241 (0%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDIGGLDEIKQELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 530

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARASAPTVVFLDEL 590

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 --DSIAKARGNSAGDNGSDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 648

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 649 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLNAIAKAAQGFSGADLSYIVQRAAKFAI 708

Query: 440 R 440
           +
Sbjct: 709 K 709

>NDAI0A03040 Chr1 complement(680017..682545) [2529 bp, 842 aa] {ON} 
          Length = 842

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           DV Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 216 DVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 275

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 276 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 331

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 332 TNGEVERRVVSQLLTLMDGMKTRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAV 391

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I RIHTK+M +   +  E ++       G+++ S+C+EA M  IR +
Sbjct: 392 GRLEILRIHTKNMKLSDDVDLEYLANETHGYVGSDVASLCSEAAMQQIREK 442

 Score =  187 bits (474), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 142/250 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 476 NPSALRETVVESVNVTWEDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 535

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 536 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 595

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 596 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 655

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 656 DQLIYVPLPDEIARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 715

Query: 440 RSRRKVATEK 449
           +   +   EK
Sbjct: 716 KESIEAQKEK 725

>Smik_4.111 Chr4 complement(212808..215315) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 145/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (461), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 137/241 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKDELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>NDAI0A02280 Chr1 complement(512577..515054) [2478 bp, 825 aa] {ON}
           Anc_7.288
          Length = 825

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 209 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 268

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 269 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 324

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 325 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 384

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 385 GRLEVLRIHTKNMKLADDVDLEYLANETHGYVGADIASLCSEAAMQQIREK 435

 Score =  187 bits (474), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 143/241 (59%), Gaps = 2/241 (0%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT++D+GG  E  ++L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 469 NPSALRETVVESVNVTWNDIGGLDEIKQELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 528

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 529 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 588

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                          ++  R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 589 DSIAKARGNSMGDGGSD--RVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD E R +I R   +   +E G+  E I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEEARLSILRAQLRKTPLEPGLELEAIAKASQGFSGADLSYIVQRAAKFAI 706

Query: 440 R 440
           +
Sbjct: 707 K 707

>Kwal_23.5996 s23 (1408496..1410991) [2496 bp, 831 aa] {ON} YDL126C
           (CDC48) - microsomal ATPase [contig 12] FULL
          Length = 831

 Score =  204 bits (520), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+GIL+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  184 bits (466), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     ++  +E G+    I++     +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEMARLSILNAQLRNTPLEPGLELTSIAKATQGFSGADLSYIVQRAAKFAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>YDL126C Chr4 complement(236157..238664) [2508 bp, 835 aa] {ON}
           CDC48AAA ATPase involved in multiple processes; subunit
           of a polyubiquitin-selective segregase complex involved
           in ERAD, cell wall integrity during heat stress and
           mitotic spindle disassembly; subunit of a complex
           involved in mitochondria-associated degradation; role in
           mobilizing membrane bound transcription factors by
           regulated ubiquitin/proteasome-dependent processing;
           roles in macroautophagy, PMN, ribophagy, and homotypic
           ER membrane fusion; functional ortholog of p97/VCP
          Length = 835

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (465), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 137/241 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>Ecym_8037 Chr8 (84479..86989) [2511 bp, 836 aa] {ON} similar to
           Ashbya gossypii AFR158W
          Length = 836

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I  IHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILHIHTKNMRLADDVNLETLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  185 bits (470), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 145/254 (57%), Gaps = 4/254 (1%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEVGRISILKAQLRKAPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 440 R----SRRKVATEK 449
           R    ++++ A EK
Sbjct: 711 RDSIEAQKRSAAEK 724

>KAFR0L01190 Chr12 (222427..224901) [2475 bp, 824 aa] {ON} Anc_7.288
           YDL126C
          Length = 824

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEILRIHTKNMKLADDVDLETLAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  +  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDDIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     ++  +E G+    IS+     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILNAQLRNTPLEPGLDLSAISKATQGFSGADLSYIVQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>Suva_4.119 Chr4 complement(224752..227262) [2511 bp, 836 aa] {ON}
           YDL126C (REAL)
          Length = 836

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 137/241 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGMELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>Skud_4.129 Chr4 complement(231893..234400) [2508 bp, 835 aa] {ON}
           YDL126C (REAL)
          Length = 835

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 137/241 (56%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I     +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDENARLSILNAQLRKTPLEPGLELTAIAKATQGFSGADLLYIVQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>AFR158W Chr6 (720212..722710) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL126C (CDC48)
          Length = 832

 Score =  204 bits (519), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PPKG+L+YGPPGTGKTL ARAVA
Sbjct: 211 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVA 270

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 271 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 326

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 327 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 386

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I  IHTK+M +   +  E+++       GA++ S+C+EA M  IR +
Sbjct: 387 GRLEILNIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREK 437

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 138/241 (57%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  +   +L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 471 NPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPVLHPDQYIKFGLSPSKGVLFYGP 530

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 531 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 590

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 591 DSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 650

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD  GR +I +   +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 651 DQLIYVPLPDEAGRMSILKAQLRKAPLEPGLDLGAIAKATQGFSGADLSYIVQRAAKFAI 710

Query: 440 R 440
           R
Sbjct: 711 R 711

>CAGL0J09350g Chr10 complement(922018..924510) [2493 bp, 830 aa]
           {ON} highly similar to uniprot|P25694 Saccharomyces
           cerevisiae YDL126c CDC48
          Length = 830

 Score =  204 bits (518), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREK 436

 Score =  182 bits (463), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 138/241 (57%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ DVGG  E  E+L+E VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R +I +   +   +E G+    I++     +GA+L  +   A  +AI
Sbjct: 650 DQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSGADLSYIVQRAAKYAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>ZYRO0C09262g Chr3 (703476..705968) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|P25694 Saccharomyces cerevisiae
           YDL126C CDC48 ATPase in ER nuclear membrane and cytosol
           with homology to mammalian p97 in a complex with Npl4p
           and Ufd1p participates in retrotranslocation of
           ubiquitinated proteins from the ER into the cytosol for
           degradation by the proteasome
          Length = 830

 Score =  203 bits (517), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 101/231 (43%), Positives = 144/231 (62%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIRELVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+EA M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLADDVDLEALAAETHGYVGADVASLCSEAAMQQIREK 436

 Score =  185 bits (469), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 140/241 (58%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +V+++DVGG +E  E+LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVSWADVGGLEEIKEELRETVEYPVLHPDQYTKFGLAPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                              R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 DSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNTKKNVFVIGATNRPDQIDPAILRPGRL 649

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD   R  I +   +   +E G+    ++++    +GA+L  +   A  FAI
Sbjct: 650 DQLIYVPLPDEAARLGIMKAQLRKTPLEPGLELSQLAKVTQGFSGADLSYIVQRAAKFAI 709

Query: 440 R 440
           +
Sbjct: 710 K 710

>TPHA0A03260 Chr1 complement(718294..720774) [2481 bp, 826 aa] {ON}
           Anc_7.288 YDL126C
          Length = 826

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 143/231 (61%), Gaps = 5/231 (2%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V Y D+GGC++Q+ ++RE+VELPL  P+ F  +GI PP+G+L+YGPPGTGKTL ARAVA
Sbjct: 210 EVGYDDIGGCRKQMAQIREMVELPLRHPQLFKAVGIKPPRGVLMYGPPGTGKTLMARAVA 269

Query: 273 NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX 332
           N T A F  + G E++ K  GE    +R+ FE A      IIF DE+             
Sbjct: 270 NETGAFFFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEI----DSIAPKRDK 325

Query: 333 XXNEVQRTML-ELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              EV+R ++ +L+T +DG   R N+ V+ ATNRPN++DPAL R GR DR+V+  +PD  
Sbjct: 326 TNGEVERRVVSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDAT 385

Query: 392 GRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  + RIHTK+M +   +  E ++       GA++ S+C+E  M  IR +
Sbjct: 386 GRLEVLRIHTKNMKLSDDVDLETLAAETHGYVGADIASLCSEGAMQQIREK 436

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 145/260 (55%), Gaps = 12/260 (4%)

Query: 200 DPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGP 259
           +PS    TV E  +VT+ D+GG  E   +LRE VE P+L P+++   G+ P KG+L YGP
Sbjct: 470 NPSALRETVVESVNVTWDDIGGLDEIKRELRETVEYPVLHPDQYTKFGLSPSKGVLFYGP 529

Query: 260 PGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEV 319
           PGTGKTL A+AVA    A FI V G EL+  + GE    +R++F+ AR     ++F DE+
Sbjct: 530 PGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKARAAAPTVVFLDEL 589

Query: 320 XXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRI 379
                          N   R + +L+T++DG + + N+ V+ ATNRP+ +DPA+LRPGR+
Sbjct: 590 ---DSIAKARGNSQDNVGDRVVNQLLTEMDGMNAKKNVFVIGATNRPDQIDPAILRPGRL 646

Query: 380 DRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           D+ +   LPD  GR +I     +   +E G+    I++     +GA+L  +   A  FAI
Sbjct: 647 DQLIYVPLPDEVGRLSILEAQLRKSPLEPGLDLRAIAKASQGFSGADLSYIAQRAAKFAI 706

Query: 440 RS---------RRKVATEKD 450
           +           +KV +E+D
Sbjct: 707 KDSIEAHKLAESKKVKSEED 726

>NCAS0E04050 Chr5 (792784..796773) [3990 bp, 1329 aa] {ON} Anc_5.34
          Length = 1329

 Score =  194 bits (494), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 158/279 (56%), Gaps = 25/279 (8%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 393 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 452

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 453 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 512

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 513 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 569

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PDL+ RA I +IHTK  +      + E +++L     GA+LR++CTEA +F+I       
Sbjct: 570 PDLKARAKILQIHTKKWNPPLDPEFIENLAKLTKGYGGADLRALCTEAALFSIQRKFPQI 629

Query: 440 -RSRRKVATE--------KDFLKAVDKVINGYKKFSSTS 469
            RS  K+  +         DF+ A++K++    + S  S
Sbjct: 630 YRSSEKLQVDPKLVRVHTTDFMLALEKIVPSSARSSGNS 668

>KAFR0D01900 Chr4 complement(382890..386675) [3786 bp, 1261 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1261

 Score =  194 bits (494), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 107/269 (39%), Positives = 153/269 (56%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++++ DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 347 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLVARALA 406

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 407 ASCSSDSKKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 466

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ LDPAL RPGR DR+  F L
Sbjct: 467 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDALDPALRRPGRFDREFYFPL 523

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PD + RA I +IHTK+        + E + ++     GA+LR++CTEA +F I       
Sbjct: 524 PDSKARAKILKIHTKNWHPSLSDEFIENLVKMTKGYGGADLRALCTEAALFCIQRKFPQI 583

Query: 440 -RSRRKV--------ATEKDFLKAVDKVI 459
            RS  K+         T  DF+ A+DK++
Sbjct: 584 YRSDEKLMVNPRHLRVTLNDFILALDKIV 612

>ZYRO0D07414g Chr4 complement(643893..648155) [4263 bp, 1420 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1420

 Score =  193 bits (491), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 156/269 (57%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 432 NVKFEDVGGLDNYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 491

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+ ++  +IFFDE+        
Sbjct: 492 ASCSSEGRKITFFMRKGADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRS 551

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 552 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 608

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PD+ GR  I +IHTK+      +++ + ++ L     GA+LR++CTEA + +I       
Sbjct: 609 PDVRGREKIIKIHTKNWKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQI 668

Query: 440 -RSRRKVATE--------KDFLKAVDKVI 459
            RS  K+A +        KDF+ A+ K++
Sbjct: 669 YRSNEKLAVDPNKVKVGVKDFMMALKKIV 697

>Kwal_47.18848 s47 complement(997574..998479) [906 bp, 302 aa] {OFF}
           YDR394W (RPT3) - ATPase (AAA family) component of the
           26S proteasome complex [contig 189] PARTIAL
          Length = 302

 Score =  181 bits (459), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 84/156 (53%), Positives = 108/156 (69%)

Query: 195 LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGI 254
           LPP  D S+++M   EKPDV+YSDVGG   Q +++RE VELPL+  + +  +GIDPP+G+
Sbjct: 147 LPPDSDSSISIMGANEKPDVSYSDVGGLDMQKQEIREAVELPLVQADLYRQIGIDPPRGV 206

Query: 255 LLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACII 314
           LLYGPPGTGKT+  +AVAN T+A FIRV GSE V KY+GEG RMVR++F +AR     II
Sbjct: 207 LLYGPPGTGKTMLVKAVANSTNAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSII 266

Query: 315 FFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 350
           F DEV                EVQR ++EL+TQ+DG
Sbjct: 267 FIDEVDSIATKRFDAQTGSDREVQRILIELLTQMDG 302

>TDEL0G00590 Chr7 complement(120616..124500) [3885 bp, 1294 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1294

 Score =  191 bits (485), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 99/236 (41%), Positives = 142/236 (60%), Gaps = 9/236 (3%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 372 NVKFGDIGGLDNFIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 431

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDE+        
Sbjct: 432 ASCSSEGHKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS 491

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 492 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 548

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           P+LE RA I RIHTKS        + + ++ L     GA+LR++CTEA + +I+ +
Sbjct: 549 PNLESRAQILRIHTKSWKTSLSDDFVKHLALLTKGYGGADLRALCTEAALLSIQRK 604

>NDAI0B00780 Chr2 complement(178836..182882) [4047 bp, 1348 aa] {ON}
           Anc_5.34
          Length = 1348

 Score =  191 bits (484), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 158/279 (56%), Gaps = 25/279 (8%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++++ DVGG    I++L+E+V LPLL PE + T  I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NISFDDVGGLDNYIDQLKEMVALPLLYPELYQTFNITPPRGVLFHGPPGTGKTLMARALA 470

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                +    TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 471 ASCSSDSQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 530

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 587

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PD + R+ I +IHTK  +      + + ++ L     GA+LR++CTEA +F I       
Sbjct: 588 PDEKARSKILKIHTKKWNPPLSDDFIDNLATLTKGYGGADLRALCTEAALFCIQRKFPQI 647

Query: 440 -RSRRKV--------ATEKDFLKAVDKVINGYKKFSSTS 469
            RS  K+         T  DF+ A++K++    + + +S
Sbjct: 648 YRSNEKLLVDPKDLKVTPTDFMLALEKIVPSSARSTGSS 686

>TBLA0C06850 Chr3 (1652656..1656936) [4281 bp, 1426 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1426

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 153/269 (56%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 NINFDDVGGLDNYIDQLKEMVSLPLLYPELYQNFNISPPRGVLFHGPPGTGKTLMARALA 495

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 496 ASCSSDDRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKNQPSIIFFDEIDGLAPVRS 555

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 556 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 612

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PDLE R  I  IHTK  +      + + ++RL     GA+LR++CT+A + +I       
Sbjct: 613 PDLEAREKIIGIHTKKWNPPLSSEFRKTLARLTKGFGGADLRALCTDAVLISIQRQYPQI 672

Query: 440 -RSRRKVATE--------KDFLKAVDKVI 459
            RS +K+  +         DF+ A++K+I
Sbjct: 673 YRSNKKLKIDPTSVKININDFMIALEKLI 701

>KNAG0K00280 Chr11 complement(43553..47779) [4227 bp, 1408 aa] {ON}
           Anc_5.34 YGR270W
          Length = 1408

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 155/271 (57%), Gaps = 29/271 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ ++DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 445 NINFNDVGGLDSYIDQLKEMVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALA 504

Query: 273 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXX 326
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDE+       
Sbjct: 505 ASCSTENRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 563

Query: 327 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 386
                     +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 564 SSKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 620

Query: 387 LPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 439
           LPD + RA I  IHTK         + + ++RL     GA+LRS+CTEA +  I      
Sbjct: 621 LPDEKARARILTIHTKKWDPPLTEEFLQNLARLTKGYGGADLRSLCTEAALLCIQRNFPQ 680

Query: 440 -----------RSRRKVATEKDFLKAVDKVI 459
                      +S+ KV T KDF+ A+ K++
Sbjct: 681 IYRSDEKLVVDKSKLKVNT-KDFILALQKIV 710

>SAKL0H01276g Chr8 complement(136032..140045) [4014 bp, 1337 aa]
           {ON} similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270W YTA7 Protein of unknown function member of
           CDC48/PAS1/SEC18 family of ATPases potentially
           phosphorylated by Cdc28p
          Length = 1337

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 105/269 (39%), Positives = 155/269 (57%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++++ +VGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 387 NISFENVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 446

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 447 ASCSTEQRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 506

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 507 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 563

Query: 388 PDLEGRANIFRIHTKSMSVERG-IRWELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PDL+ R+ I +IHTK        +  E ++ L     GA+LR++CTEA + +I       
Sbjct: 564 PDLKARSKILQIHTKEWKPPLSQVFVEKLASLTKGYGGADLRALCTEAALISIQRKFPQI 623

Query: 440 -RSRRKVATE--------KDFLKAVDKVI 459
            +S  K++ +        +DF+ A+DK+I
Sbjct: 624 YQSNLKLSIDPKDVKVKARDFMIALDKII 652

>TPHA0L02210 Chr12 (459500..463702) [4203 bp, 1400 aa] {ON} Anc_5.34
           YGR270W
          Length = 1400

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 155/270 (57%), Gaps = 27/270 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    I++L+E++ LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 429 NINFDDVGGLDNYIDQLKEMITLPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 488

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 489 ASCSSDTRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 548

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 549 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 605

Query: 388 PDLEGRANIFRIHTKSMS--VERGIRWELISRLCPNSTGAELRSVCTEAGMFAI------ 439
           PD++ RA I  IHT+  +  +++ +  +L + L     GA+LR++CTEA + +I      
Sbjct: 606 PDIDARAKILEIHTRKWNPPLQKPVILQL-ANLTKGYGGADLRALCTEAALISIQHKYPQ 664

Query: 440 --RSRRKV--------ATEKDFLKAVDKVI 459
             RS  K+         +  DF+ A++K++
Sbjct: 665 IYRSNDKLDVDPSKITVSTSDFMLALEKIV 694

>Ecym_4769 Chr4 complement(1496524..1500543) [4020 bp, 1339 aa] {ON}
           similar to Ashbya gossypii ABR139W
          Length = 1339

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 151/269 (56%), Gaps = 27/269 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 419 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 478

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                ++   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 479 VSCSTDKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 538

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 539 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 595

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRSRR--- 443
           PD   RA I  IHTK  +      + E ++ L     GA+LR++CTEA + +I+ +    
Sbjct: 596 PDTSARAKILEIHTKKWNPPLPKEFIEKLASLTKGYGGADLRALCTEAALVSIQRKFPQI 655

Query: 444 --------------KVATEKDFLKAVDKV 458
                         KV T KDF+ A+DK+
Sbjct: 656 YQSESKLVINPKDVKVKT-KDFMAAMDKI 683

>Kpol_513.19 s513 (53678..57811) [4134 bp, 1377 aa] {ON}
           (53678..57811) [4134 nt, 1378 aa]
          Length = 1377

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 158/270 (58%), Gaps = 27/270 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           D+ + +VGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 436 DINFEEVGGLDNYIDQLKEMVTLPLLYPEVYQNFNITPPRGVLFHGPPGTGKTLMARALA 495

Query: 273 ------NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXX 326
                 NR    F+R  G++++ K+VGE  R +R LFE A+ ++  IIFFDE+       
Sbjct: 496 ASCSTGNRKITFFMRK-GADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVR 554

Query: 327 XXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFS 386
                   + +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F 
Sbjct: 555 SSKQEQIHSSIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFP 611

Query: 387 LPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------ 439
           LPD++ R+ I  IHTK  +     +  + ++RL     GA+LRS+CTEA + +I      
Sbjct: 612 LPDVKARSIILGIHTKKWNPPPNKKLIDDLARLTKGYGGADLRSLCTEAALISIQRKFPQ 671

Query: 440 --RSRRKVATEK--------DFLKAVDKVI 459
             +S +K+  +         DF+ A++K++
Sbjct: 672 IYKSEQKLMVDPTKIRVSYGDFMLALEKIV 701

>KLLA0A09823g Chr1 (858458..862417) [3960 bp, 1319 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1319

 Score =  189 bits (479), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 106/271 (39%), Positives = 154/271 (56%), Gaps = 29/271 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 400 NINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 459

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 460 ASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFFDEIDGLAPVRS 519

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG I ++ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 520 SKQEQIHASIVSTMLAL---MDGMDNRGQIIIIGATNRPDAVDPALRRPGRFDREFYFPL 576

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 439
           PDL+ R  I  IHTK  +    I  + IS+L   +    GA+LR++CTEA + +I     
Sbjct: 577 PDLKARDKILHIHTKKWNPP--ISDQFISKLASLTKGYGGADLRALCTEASLISIQRKFP 634

Query: 440 ---RSRRKVATE--------KDFLKAVDKVI 459
              +S  K+  +        +DF+ A++K++
Sbjct: 635 QIYKSEEKLKIDPKSVRVKARDFMLALEKIV 665

>KLTH0B09130g Chr2 (742805..746806) [4002 bp, 1333 aa] {ON} similar
           to uniprot|P40340 Saccharomyces cerevisiae YGR270W YTA7
           Protein of unknown function member of CDC48/PAS1/SEC18
           family of ATPases potentially phosphorylated by Cdc28p
          Length = 1333

 Score =  189 bits (479), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 108/279 (38%), Positives = 154/279 (55%), Gaps = 45/279 (16%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 405 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 464

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                 +   TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDE+        
Sbjct: 465 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 524

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 525 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 581

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWE------LISRLCPNST---GAELRSVCTEAGMFA 438
           PDL  R+ I  IHTK        +W+       I RL   +    GA+LR++CTEA + +
Sbjct: 582 PDLSARSKILEIHTK--------KWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALIS 633

Query: 439 IRSRRKV------------------ATEKDFLKAVDKVI 459
           I  +RKV                     +DF+ A++K++
Sbjct: 634 I--QRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIV 670

>CAGL0G00528g Chr7 complement(54617..58570) [3954 bp, 1317 aa] {ON}
           similar to uniprot|P40340 Saccharomyces cerevisiae
           YGR270w YTA7
          Length = 1317

 Score =  188 bits (478), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 152/271 (56%), Gaps = 29/271 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    IE+L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 392 NIKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARALA 451

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDE+        
Sbjct: 452 ASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 511

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 512 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 568

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNST---GAELRSVCTEAGMFAI----- 439
           PD   R  I +IHTK  S    +  ELI RL   +    GA+LR++CTEA + +I     
Sbjct: 569 PDTNARKTILKIHTKKWSPP--LSDELIHRLASLTKGYGGADLRALCTEAALSSIQRTYP 626

Query: 440 ---RSRRKV--------ATEKDFLKAVDKVI 459
              RS  K+            DF +A++K++
Sbjct: 627 QIYRSSGKLLIDTDLIRVNSSDFTRALEKIV 657

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score =  187 bits (475), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 98/236 (41%), Positives = 138/236 (58%), Gaps = 9/236 (3%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L YGPPGTGKTL ARA+A
Sbjct: 366 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFYGPPGTGKTLMARALA 425

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                 +   TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 426 ASCSTEKRKITFYMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 485

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 486 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 542

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           PD+  RA I  IHT+         + E ++ L     GA+LR++CTEA + +I+ R
Sbjct: 543 PDIRARAKILEIHTRKWHPPVSSAFIEKLASLTKGYGGADLRALCTEAALNSIQRR 598

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score =  186 bits (472), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 146/265 (55%), Gaps = 6/265 (2%)

Query: 206 MTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKT 265
              E    + ++DV GC E  E++ E V+  L  P R+  +G   P+G +L GPPGTGKT
Sbjct: 341 FNTETAVQIRFNDVAGCDEAKEEIMEFVDF-LKQPSRYEKMGAKIPRGAILSGPPGTGKT 399

Query: 266 LCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX 325
           L A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DE+      
Sbjct: 400 LLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTAKENAPSIVFIDEIDAIGKA 459

Query: 326 XXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVE 384
                    N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR V 
Sbjct: 460 RQKGNFSGANDERENTLNQLLVEMDGFSSTDHIVVLAGTNRPDILDRALLRPGRFDRHVN 519

Query: 385 FSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRS 441
             LP+LEGR  IF +H K + +  G  ++L +RL    P  +GA++ +VC EA + A R 
Sbjct: 520 IDLPELEGRKAIFGVHLKKIKIA-GTIYDLQNRLAALTPGFSGADISNVCNEAALIAARY 578

Query: 442 RRKVATEKDFLKAVDKVINGYKKFS 466
                    F KA+++VI G ++ S
Sbjct: 579 NSSFVKLSHFEKAIERVIGGVERKS 603

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score =  185 bits (470), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 149/267 (55%), Gaps = 8/267 (2%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           + PS       E P V +SD+GG  E   KL+E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 VRPSAMREIFLEMPKVYWSDIGGQDELKRKLKEMIQLPLDASETFARLGVSAPKGVLLYG 549

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               N V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDGESTSAANHV---LTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD + R  I R  T   ++E  G+  E +++     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVGPPDYDARLQILRKCTSKFNIESSGVDLEALAQKTDGCSGAEVVLLCQEAGLA 726

Query: 438 AIRSR---RKVATEKDFLKAVDKVING 461
           +I       KV+TE  F KA+  +  G
Sbjct: 727 SIMENVETEKVSTEH-FEKALRDLSRG 752

 Score =  166 bits (419), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/231 (38%), Positives = 129/231 (55%), Gaps = 6/231 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           VTY+ VGG   +IE L+  +ELPL  P+ F   G+ PP+GI+L+GPPGTGKT+  R VA+
Sbjct: 236 VTYNSVGGLFSEIEILKNTIELPLRQPQLFTDFGVTPPRGIMLHGPPGTGKTMILRCVAH 295

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            T+A  + + G  +V KY+GE    +R++F  A   +  I+F DE+              
Sbjct: 296 STNAHVLTIDGPSIVSKYLGETEATLRDIFNEAVKYQPSIVFIDEIDSIAPNRANDDSGE 355

Query: 334 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 393
                R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R
Sbjct: 356 AE--SRVVATLLTLMDGMGASGKVVVIGATNRPNSVDPALRRPGRFDQEVEIGIPDAEAR 413

Query: 394 ANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 440
            +I     + MS +R    E     I+       GA+L ++C EA M  I+
Sbjct: 414 LDILHKQFQRMSSDRQELTEEDIKTIASKTHGYVGADLSALCREAVMKTIQ 464

>Skud_13.245 Chr13 complement(419466..421940) [2475 bp, 824 aa] {ON}
           YMR089C (REAL)
          Length = 824

 Score =  186 bits (471), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 344 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 402

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 403 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 462

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 463 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 522

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H   + +  GI ++L +RL    P  +GA++ +VC EA + A RS       K
Sbjct: 523 RKAIFAVHLHHLKLAGGI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 581

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 582 HFEQAIERVIGGVERKS 598

>Smik_16.38 Chr16 complement(65946..70115) [4170 bp, 1389 aa] {ON}
           YGR270W (REAL)
          Length = 1389

 Score =  186 bits (472), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 152/269 (56%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 415 NIDFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 474

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 475 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 534

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 535 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 591

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PD++ R+ I +I T+  S    I + + ++ L     GA+LRS+CTEA + +I       
Sbjct: 592 PDVKARSKILQIQTRKWSAPLSINFIDKLAFLTKGYGGADLRSLCTEAALISIQRSFPQI 651

Query: 440 -RSRRKVATE--------KDFLKAVDKVI 459
            RS  K+  +         DF+ A+ K++
Sbjct: 652 YRSNDKLLVDPSKIKVKVSDFMLALKKIV 680

>ZYRO0D15290g Chr4 complement(1283982..1286165) [2184 bp, 727 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 727

 Score =  184 bits (466), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V++ DV GC E  +++ E V   L  PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 251 VSFQDVAGCNEAKQEIMEFVHF-LKKPEKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 309

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX--XXXXXX 331
                F+ V GSE V+ +VG GA  VR++FE AR     IIF DE+              
Sbjct: 310 EAGVPFLSVSGSEFVEMFVGVGASRVRDMFEQARQMAPSIIFVDEIDAIGKERGKGGAMG 369

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR V+   PD+E
Sbjct: 370 GANDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDPALMRPGRFDRHVQIDSPDIE 429

Query: 392 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+ +H   +++         +R +    ++ L P   GA++ + C EA + A R +
Sbjct: 430 GRKAIYLVHLHDLNLAPEYTESKEQRELLAGKLAALTPGFAGADISNACNEAALIAARRQ 489

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
               T K F +A+++VI G +K S
Sbjct: 490 AAHVTLKHFEQAIERVIAGLEKKS 513

>Skud_7.603 Chr7 (1001881..1006041) [4161 bp, 1386 aa] {ON} YGR270W
           (REAL)
          Length = 1386

 Score =  186 bits (471), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 101/269 (37%), Positives = 152/269 (56%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 413 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 472

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  +IFFDE+        
Sbjct: 473 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSVIFFDEIDGLAPVRS 532

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 533 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 589

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PD++ R+ I +I TK  S    + + + ++ L     GA+LRS+CTEA + +I       
Sbjct: 590 PDVKARSKILQIQTKKWSSPLSVNFVDKLAILTKGYGGADLRSLCTEAALISIQRNFPQI 649

Query: 440 -RSRRKVATE--------KDFLKAVDKVI 459
            RS  K+  +         DF+ A+ K++
Sbjct: 650 YRSNDKLLVDPSKIKVKVSDFMLALKKIV 678

>Kwal_23.4253 s23 complement(640328..644317) [3990 bp, 1329 aa] {ON}
           YGR270W (YTA7) - 26S proteasome ATPase [contig 1] FULL
          Length = 1329

 Score =  186 bits (471), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 146/258 (56%), Gaps = 25/258 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + DVGG    I++L+E+V LPLL PE +   GI PP+G+L +GPPGTGKTL ARA+A
Sbjct: 411 NIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTLMARALA 470

Query: 273 -----NRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
                 +   TF    G++++ K+VGE  R +R LF+ A+ ++  IIFFDE+        
Sbjct: 471 ASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFDEAKKQQPSIIFFDEIDGLAPVRS 530

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  TML L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 531 SKQEQIHASIVSTMLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFFFPL 587

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW------ELISRLCPNST---GAELRSVCTEAGMFA 438
           P LE R+ I  IHTK        +W        IS+L   +    GA+LR++CTEA + +
Sbjct: 588 PGLEARSKILTIHTK--------KWNPPLPNHFISKLASLTKGYGGADLRALCTEAALIS 639

Query: 439 IRSRRKVATEKDFLKAVD 456
           I+ +     + D    +D
Sbjct: 640 IQRKLPQIYQSDIKLHID 657

>NCAS0J01550 Chr10 complement(274194..276512) [2319 bp, 772 aa] {ON}
           Anc_4.259
          Length = 772

 Score =  184 bits (466), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 138/242 (57%), Gaps = 3/242 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 489 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEASETFARLGVTAPKGVLLYG 548

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 549 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 608

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 609 I--DALSPDRDGGSSSSAASHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRPGR 666

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +  + PD E R  I R  TK   + E  I  E +SR     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIYVAPPDYEARLQILRKCTKKFQIDESTINLEDLSRRTDGCSGAEVVLLCQEAGLA 726

Query: 438 AI 439
           AI
Sbjct: 727 AI 728

 Score =  168 bits (425), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 131/232 (56%), Gaps = 8/232 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +TY  VGG  ++++ L+  + LPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 233 LTYDSVGGLHKEVDLLKTTISLPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVAN 292

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 293 TANAHVLTINGPSIVSKYLGETESALRDIFNEAKKYQPSIIFIDEI---DSIAPNRANDD 349

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGMGSAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 409

Query: 393 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 440
           R +I       MS ER    E     IS       GA+L S+C E+ M  I+
Sbjct: 410 RLDILMKQFSQMSSERHTLTEEDIKTISSKTHGYVGADLSSLCRESVMKTIQ 461

>Ecym_1258 Chr1 (530600..532843) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii AAR025C
          Length = 747

 Score =  183 bits (465), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 147/264 (55%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E   ++ E V   L +P+++  LG   P+G +L G PGTGKTL ARA A 
Sbjct: 271 VNFKDVAGCDEAKMEIMEFVHF-LKNPDKYKALGAQIPRGAILSGAPGTGKTLLARATAG 329

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX--XXXXXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 330 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 389

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 390 GSNDEREATLNQLLVEMDGFTARDQIVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 449

Query: 392 GRANIFRIHTKSMSVERGIRWEL---------ISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+R+H   ++++  ++            ++ L P  +GA++ + C EA + A R +
Sbjct: 450 GRKAIYRVHLPRLNLQPALKTSTLDLDSFAGRLAALTPGFSGADIANACNEAALIAARHQ 509

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
            +    K F +A+++VI G +K S
Sbjct: 510 DEYVELKHFEQAIERVIAGLEKKS 533

>KNAG0L01060 Chr12 complement(193013..195154) [2142 bp, 713 aa] {ON}
           Anc_7.168 YER017C
          Length = 713

 Score =  182 bits (463), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 148/261 (56%), Gaps = 9/261 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V++ DV GC E  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 237 VSFKDVAGCNEAKQEIMEFVHF-LKNPKKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 295

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXX--XX 331
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DE+              
Sbjct: 296 EAAVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSLAPSIIFVDEIDAIGKERGKGGPLG 355

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 356 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDSPDIT 415

Query: 392 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
           GR  I+ +H + ++++  +  +       ++ L P  TGA++ + C EA + A R +   
Sbjct: 416 GRKQIYLVHLERLNLQEKLALDRENLAGKLATLTPGFTGADIANACNEAALIAARHKDAT 475

Query: 446 ATEKDFLKAVDKVINGYKKFS 466
            T   F +A+++VI G +K S
Sbjct: 476 ITLDHFEQAIERVIAGLEKKS 496

>TDEL0A02480 Chr1 (443736..446186) [2451 bp, 816 aa] {ON} Anc_2.472
           YMR089C
          Length = 816

 Score =  183 bits (465), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/257 (39%), Positives = 146/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 338 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 396

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     ++F DE+              
Sbjct: 397 EAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEIDAIGKARQKGNISG 456

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 457 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDVLDKALLRPGRFDRHVNIDKPELSG 516

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R+  K    +
Sbjct: 517 RQAIFEVHMKKIKLASDI-FDLKNRLAALTPGFSGADIANVCNEAALIAARNDAKSVRLE 575

Query: 450 DFLKAVDKVINGYKKFS 466
            F +AV++VI G ++ S
Sbjct: 576 HFEQAVERVIGGVERKS 592

>KLTH0F13904g Chr6 complement(1141955..1144174) [2220 bp, 739 aa]
           {ON} similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017C AFG3 Component with Yta12p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 739

 Score =  182 bits (462), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 146/263 (55%), Gaps = 11/263 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E   ++ E V   L  P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VNFKDVAGCNEAKAEIMEFVHF-LQKPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX--XXXXXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 383

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 384 GANDEREATLNQLLVEMDGFGTNDQVVVLAGTNRPDVLDPALLRPGRFDRHIQIDAPDVE 443

Query: 392 GRANIFRIHTKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRR 443
           GR  I+++H K +++        E+ +    ++ L P   GA++ + C EA + A R ++
Sbjct: 444 GRKAIYQVHLKKLNLSPRYASPGEKEMLAGKLAALTPGFAGADIANACNEAALIAARYKK 503

Query: 444 KVATEKDFLKAVDKVINGYKKFS 466
                 +F +A+++VI G +K S
Sbjct: 504 PFVELANFEQAIERVIAGLEKKS 526

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/261 (37%), Positives = 143/261 (54%), Gaps = 7/261 (2%)

Query: 184 VDRSKYFIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLS 239
           +DRSK  + L         I PS       E P V +SD+GG  +   K++EV++LPL +
Sbjct: 480 IDRSKLQVTLKDVENAMAEIRPSAMREIFLEMPKVYWSDIGGQDDLKRKMKEVIQLPLEA 539

Query: 240 PERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMV 299
            E FA LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +
Sbjct: 540 AETFANLGVSAPKGVLLYGPPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAI 599

Query: 300 RELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKV 359
           RE+F  AR     IIFFDE+                     +  L+ ++DG +    + +
Sbjct: 600 REIFRKARAASPSIIFFDEIDAISAARDGGSSTAA--ASHVLTSLLNEIDGVEELNGVVI 657

Query: 360 MFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRL 418
           + ATNRP+ +DPALLRPGR+DR +  + PD E R  I +  T   ++E   +  E +++ 
Sbjct: 658 VAATNRPDEIDPALLRPGRLDRHIYVAPPDYEARLQILKKRTGKFNLEGSNVNLEELAKH 717

Query: 419 CPNSTGAELRSVCTEAGMFAI 439
               +GAE+  +C EAG+ AI
Sbjct: 718 TEGCSGAEVVLLCQEAGLAAI 738

 Score =  171 bits (434), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 136/230 (59%), Gaps = 8/230 (3%)

Query: 216 YSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 275
           Y+DVGG K +I+ L + +ELPL  P  F+  GI+PP+G+LL+GPPGTGKT+  R VAN +
Sbjct: 245 YNDVGGLKREIDSLTKTIELPLHQPNLFSDFGINPPRGVLLHGPPGTGKTMLLRCVANSS 304

Query: 276 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN 335
           +A  + + G  +V KY+GE    +RE+F+ A+  +  IIF DE+                
Sbjct: 305 NAHVLTINGPSIVSKYLGETEAKLREIFDEAQKYQPSIIFIDEI---DSLAPNRANDDSG 361

Query: 336 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 394
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ R 
Sbjct: 362 EVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVDARF 421

Query: 395 NIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 440
           +I +     MS ER    E     I+       GA+L ++C E+ M  I+
Sbjct: 422 DILKKQFSRMSEERHTLNEDDIKNIASKTHGYVGADLSALCRESVMKTIQ 471

>Kpol_401.3 s401 complement(5130..7490) [2361 bp, 786 aa] {ON}
           complement(5130..7490) [2361 nt, 787 aa]
          Length = 786

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 150/264 (56%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +++ DV GC E  +++ E V   L +P+R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 301 ISFKDVAGCAEAKQEIMEFVHF-LKNPQRYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 359

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR+    IIF DE+              
Sbjct: 360 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARSMSPSIIFIDEIDAIGKERGKGGALG 419

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR +E   PD+E
Sbjct: 420 GANDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDPALMRPGRFDRHIEIDPPDVE 479

Query: 392 GRANIFRIHTKSMSVE------RGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR +I+ +H   ++++      +  + EL   ++ L P   GA++ + C EA + A R  
Sbjct: 480 GRKSIYLVHLSKLNLDPIFTETKEAKDELAGKLAALTPGFAGADIANACNEAALIAARYN 539

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
            K    + F +A+++VI G +K S
Sbjct: 540 DKYVELRHFEQAIERVIAGLEKKS 563

>Kwal_26.7749 s26 (497057..499501) [2445 bp, 814 aa] {ON} YMR089C
           (YTA12) - mitochondrial membrane ATPase of the
           CDC48/PAS1/SEC18 (AAA) family [contig 55] FULL
          Length = 814

 Score =  183 bits (464), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           VT+ DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 341 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 399

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 400 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 459

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 460 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 519

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF++H   + +   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 520 RKQIFQVHLSKIKLAGSID-DLKNRLAALTPGFSGADISNVCNEAALTAARCECTSVKLE 578

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 579 HFEQAIERVIGGVERKS 595

>Suva_13.266 Chr13 complement(427123..429594) [2472 bp, 823 aa] {ON}
           YMR089C (REAL)
          Length = 823

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 343 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 401

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 402 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 461

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 462 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 521

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A RS       K
Sbjct: 522 RKAIFAVHLHHIKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDSVKLK 580

Query: 450 DFLKAVDKVINGYKKFS 466
           +F +A+++VI G ++ S
Sbjct: 581 NFEQAIERVIGGVERKS 597

>KLTH0D05412g Chr4 (483268..485709) [2442 bp, 813 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 813

 Score =  182 bits (463), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           VT+ DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 340 VTFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAQIPRGAILSGPPGTGKTLIAKATAG 398

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 399 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPSIVFVDEIDAIGKARQKGNFSG 458

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 459 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELEG 518

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF++H   + +  G   +L +RL    P  +GA++ +VC EA + A R+       +
Sbjct: 519 RKQIFQVHLAKVKLA-GSMEDLKNRLAALTPGFSGADISNVCNEAALTAARNECTSVKLE 577

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 578 HFEQAIERVIGGVERKS 594

>Ecym_7400 Chr7 complement(822595..825009) [2415 bp, 804 aa] {ON}
           similar to Ashbya gossypii ABL041W
          Length = 804

 Score =  182 bits (462), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VKFKDVAGCDEAKEEIMEFVSF-LKQPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 393 EAGVPFFSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIVFVDEIDAIGKARQKGNFSG 452

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 453 ANDERENTLNQLLVEMDGFTPSDHVVVLAGTNRPDVLDQALLRPGRFDRHINIDKPELEG 512

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF++H   +++   I  +L +RL    P  +GA++ +VC EA + A R        +
Sbjct: 513 RKEIFKVHLSKITLAEDI-VDLENRLAALTPGFSGADIANVCNEAALVAARGDNSSVKLE 571

Query: 450 DFLKAVDKVINGYKKFS 466
            F  A+++VI G ++ S
Sbjct: 572 HFEHAIERVIGGVERKS 588

>Suva_7.566 Chr7 (982174..986370) [4197 bp, 1398 aa] {ON} YGR270W
           (REAL)
          Length = 1398

 Score =  183 bits (465), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 156/281 (55%), Gaps = 29/281 (10%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           ++ + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 421 NINFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 480

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+ ++  IIFFDE+        
Sbjct: 481 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAPVRS 540

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 541 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 597

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAI----- 439
           PD++ R  I +I TK  +    +  E I++L        GA+LRS+CTEA + +I     
Sbjct: 598 PDVKARYKILQIQTKKWT--SPLSTEFINKLAILTKGYGGADLRSLCTEAALISIQRNFP 655

Query: 440 ---RSRRKVATE--------KDFLKAVDKVINGYKKFSSTS 469
              RS  K+  +         DF+ A+ K++    + + +S
Sbjct: 656 QIYRSNDKLLVDPSKIKVKVNDFMLALKKIVPSSARSTGSS 696

>YGR270W Chr7 (1027370..1031509) [4140 bp, 1379 aa] {ON}
           YTA7Protein that localizes to chromatin and has a role
           in regulation of histone gene expression; has a
           bromodomain-like region that interacts with the
           N-terminal tail of histone H3, and an ATPase domain;
           potentially phosphorylated by Cdc28p
          Length = 1379

 Score =  183 bits (465), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/269 (37%), Positives = 150/269 (55%), Gaps = 25/269 (9%)

Query: 213 DVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVA 272
           +V + D+GG    I++L+E+V LPLL PE +    I PP+G+L +GPPGTGKTL ARA+A
Sbjct: 409 NVNFDDIGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTGKTLMARALA 468

Query: 273 NRTDA-----TFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXX 327
               +     TF    G++++ K+VGE  R +R LFE A+  +  IIFFDE+        
Sbjct: 469 ASCSSDERKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPSIIFFDEIDGLAPVRS 528

Query: 328 XXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                    +  T+L L   +DG D RG + V+ ATNRP+ +DPAL RPGR DR+  F L
Sbjct: 529 SKQEQIHASIVSTLLAL---MDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPL 585

Query: 388 PDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMFAI------- 439
           PD++ R  I +I T+  S      + + ++ L     GA+LRS+CTEA + +I       
Sbjct: 586 PDVKARFKILQIQTRKWSSPLSTNFIDKLAFLTKGYGGADLRSLCTEAALISIQRSFPQI 645

Query: 440 -RSRRKVATE--------KDFLKAVDKVI 459
            RS  K+  +         DF+ A+ K++
Sbjct: 646 YRSNDKLLVDPSKIKVKVSDFMLALKKIV 674

>KAFR0A05890 Chr1 (1195474..1197792) [2319 bp, 772 aa] {ON}
           Anc_4.259 YLR397C
          Length = 772

 Score =  181 bits (460), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 106/282 (37%), Positives = 149/282 (52%), Gaps = 14/282 (4%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG  E   K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 490 IRPSAMREIFLEMPKVYWSDIGGQHELKRKMKEMIQLPLEASETFAELGVSAPKGVLLYG 549

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 550 PPGCSKTLTAKALATESGINFFAVKGPEIFSKYVGESERAIREIFRKARAASPSIIFFDE 609

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               + V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 610 IDALSPDRDSGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 666

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD E R  I    TK   +E   +  E ++R     +GAE+  +C EAG+ 
Sbjct: 667 LDRHIFVGPPDYEARLQILHKCTKKFQLEGSDVNLEDLARRTDGCSGAEIVLLCQEAGLA 726

Query: 438 AIRS--RRKVATEKDFLKAVDKVING--------YKKFSSTS 469
           AI    + K      F KA++ +  G        Y  F+S S
Sbjct: 727 AIMENLQAKEVRAAHFEKAMEGISRGITEDMLEYYNNFASRS 768

 Score =  164 bits (414), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 139/254 (54%), Gaps = 11/254 (4%)

Query: 216 YSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 275
           Y  VGG  ++I  L+  +ELPL  P  F+  G+ PP+GILL+GPPGTGKT+  R VAN +
Sbjct: 236 YEAVGGLSKEIGLLKSTIELPLHQPTLFSDFGVSPPRGILLHGPPGTGKTMLLRCVANTS 295

Query: 276 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN 335
           +A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+                
Sbjct: 296 NAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRANDDSG 352

Query: 336 EVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRA 394
           EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD E R 
Sbjct: 353 EVESRVVATLLTLMDGMGAAGRLVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDAEARL 412

Query: 395 NIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIRS--RRKVATE 448
           +I      +MS ER    E     I+       GA+L ++C E+ M  I+       A +
Sbjct: 413 DILLKQFSNMSSERHSLTEDNIKTIASKTHGYVGADLSALCRESVMKTIQRGLTEGTAMD 472

Query: 449 KDFLKA-VDKVING 461
           K  LK  +D V N 
Sbjct: 473 KTLLKVTMDDVENA 486

>KAFR0A00740 Chr1 (132072..134426) [2355 bp, 784 aa] {ON} Anc_2.472
           YMR089C
          Length = 784

 Score =  181 bits (460), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + ++DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 308 IKFNDVAGCDEAKEEIMEFVSF-LKDPVRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 366

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 367 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 426

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 427 ANDERESTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDRALLRPGRFDRHINIDKPELEG 486

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 487 RKEIFAVHLKGLKLANTI-FDLKNRLAALTPGFSGADIANVCNEAALIAARTDSHAVVLT 545

Query: 450 DFLKAVDKVINGYKKFS 466
            F  A+++VI G ++ S
Sbjct: 546 HFEHAIERVIGGVERKS 562

>AAR025C Chr1 complement(385327..387507) [2181 bp, 726 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER017C
           (AFG3)
          Length = 726

 Score =  181 bits (458), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 97/264 (36%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E   ++ E V+  L +PE++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 248 IKFKDVAGCDEAKMEIMEFVDF-LKTPEKYRALGAQIPRGAILSGPPGTGKTLLAKATAG 306

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXX--XXXXXXXXXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 307 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKARGKGGEMG 366

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF  R  I V+  TNRP+ LDPALLRPGR DR ++   PD+E
Sbjct: 367 GSNDEREATLNQLLVEMDGFTSRDQIVVIAGTNRPDVLDPALLRPGRFDRHIQVDAPDVE 426

Query: 392 GRANIFRIHTKSMSVERGIRWE---------LISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+++H   ++++  ++            ++ L P   GA++ + C EA + A R  
Sbjct: 427 GRKAIYKVHLSKLNLDPSLKTTPDTLDNFAGKLAALTPGFAGADISNACNEAALIAARHN 486

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
                 + F +A+++VI G +K S
Sbjct: 487 DAFVEFRHFDQAIERVIAGLEKKS 510

>Smik_13.273 Chr13 complement(429460..431943) [2484 bp, 827 aa] {ON}
           YMR089C (REAL)
          Length = 827

 Score =  181 bits (459), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 346 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 404

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 405 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 464

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 465 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 524

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A RS        
Sbjct: 525 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDENSVKLN 583

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 584 HFEQAIERVIGGVERKS 600

>YMR089C Chr13 complement(445609..448086) [2478 bp, 825 aa] {ON}
           YTA12Component, with Afg3p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 825

 Score =  181 bits (458), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 345 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 403

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 404 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 463

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 464 ANDERENTLNQMLVEMDGFTPADHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 523

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H   + +   I ++L +RL    P  +GA++ +VC EA + A RS        
Sbjct: 524 RKAIFAVHLHHLKLAGEI-FDLKNRLAALTPGFSGADIANVCNEAALIAARSDEDAVKLN 582

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 583 HFEQAIERVIGGVERKS 599

>TPHA0B00730 Chr2 (165929..168259) [2331 bp, 776 aa] {ON} Anc_4.259
           YLR397C
          Length = 776

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 154/282 (54%), Gaps = 13/282 (4%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG +E   K++E+++LPL + + F  LG+  PKG+LLYG
Sbjct: 493 IRPSAMREIFLEMPKVYWSDIGGQEELKRKMKEMIQLPLEAADTFDRLGVSAPKGVLLYG 552

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 553 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSASPSIIFFDE 612

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +                     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 613 IDALSPDRDGGSSSS--AASHVLTSLLNEIDGVEDLKGVVIVAATNRPDEIDPALLRPGR 670

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVERG-IRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +  + P  + R  I + +TK+  VE+  I  E ++R     +GAE+  +C EAG+ 
Sbjct: 671 LDRHIYVAPPTYDARLQILKNNTKNFQVEKANIDLEELARRTDGCSGAEVVLLCQEAGLA 730

Query: 438 AIRSR--RKVATEKDFLKAVDKVING--------YKKFSSTS 469
           AI         T + F KA+  +  G        Y++F+S S
Sbjct: 731 AIMENIDTDFVTPEHFEKALQGIARGITPEMLEYYQEFASRS 772

 Score =  169 bits (428), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 137/239 (57%), Gaps = 6/239 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V+Y+ VG   ++IE LR  VELPL   + FA  GI PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 VSYNSVGALSKEIEVLRNAVELPLNQSQLFADFGITPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            +DA  + + G  +V KY+G+    +R++F  A+  +  IIF DE+              
Sbjct: 297 SSDAHVLTIDGPSIVSKYLGDTENTLRDIFREAQKYQPSIIFIDEIDSIAPNRTNDDSGE 356

Query: 334 XNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGR 393
                R +  L+T +DG +  G + V+ ATNRPN++DPAL RPGR D++VE  +PD+EGR
Sbjct: 357 AE--SRVVATLLTLMDGMNGSGKVVVVAATNRPNSVDPALRRPGRFDQEVEIGIPDVEGR 414

Query: 394 ANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
            +I       MS +R    +    +I+       GA+L ++C E+ M  I+   K A++
Sbjct: 415 LDILSKQFSKMSPKRHNLSDEDIKVIAAKTHGYVGADLTALCRESVMKTIQRGLKTASD 473

>Klac_YGOB_Anc_7.168b Chr2 (1011211..1012701,1012704..1013552) [2340
           bp, 779 aa] {ON} ANNOTATED BY YGOB -
          Length = 779

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/261 (37%), Positives = 145/261 (55%), Gaps = 11/261 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E   ++ E V   L  P+++  LG   PKG +L GPPGTGKTL A+A A 
Sbjct: 297 VKFKDVAGCDEAKGEIMEFVHF-LQKPDKYRKLGAQIPKGAILSGPPGTGKTLLAKATAG 355

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 356 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 415

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 416 GANDEREATLNQLLVEMDGFTSTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQLDAPDVE 475

Query: 392 GRANIFRIHTKSMSVE----RGIRWEL----ISRLCPNSTGAELRSVCTEAGMFAIRSRR 443
           GR  I+++H ++++++    R   +E     ++ L P   GA++ + C EA + A R   
Sbjct: 476 GRKAIYQVHLRNLNLDPKYIRTSEFEALAGKLAALTPGFAGADIANACNEAALIAARHSD 535

Query: 444 KVATEKDFLKAVDKVINGYKK 464
                + F +A+++VI G +K
Sbjct: 536 AFVEFRHFEQAIERVIAGLEK 556

>NDAI0H02210 Chr8 complement(538548..540959) [2412 bp, 803 aa] {ON}
           Anc_2.472
          Length = 803

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 319 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 377

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 378 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 437

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 438 ANDERENTLNQMLVEMDGFTPSDHVVVLAGTNRPDILDKALLRPGRFDRHINIDKPELEG 497

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H + + +  G   +L +RL    P   GA++ +VC EA + A R+ +     +
Sbjct: 498 RKAIFEVHLQKLKLA-GTVLDLKNRLAALTPGFAGADIANVCNEAALIAARNDQPSVRLE 556

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 557 HFEQAIERVIGGVERKS 573

>NCAS0E02020 Chr5 (386327..388648) [2322 bp, 773 aa] {ON} Anc_7.168
          Length = 773

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 148/264 (56%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V++ +V GC E   ++ E V   L +P+++ TLG   P+G +L GPPGTGKTL A+A A 
Sbjct: 295 VSFKNVAGCDEAKVEIMEFVHF-LKNPKKYTTLGAKIPRGAILSGPPGTGKTLLAKATAG 353

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 354 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKMAPSIIFIDEIDAIGKERGKGGALG 413

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPAL+RPGR DR ++   PD+ 
Sbjct: 414 GSNDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALMRPGRFDRHIQIDAPDIN 473

Query: 392 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+ +H K +++E  +      R  L   ++ L P  TGA++ + C EA + A R++
Sbjct: 474 GRKEIYLVHLKKLNLETRLVETDSDRENLAGKLATLTPGFTGADIANACNEAALIAARNK 533

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
                   F +A+++VI G +K S
Sbjct: 534 DPYILLSHFEQAIERVIAGLEKKS 557

>CAGL0J01353g Chr10 (124994..127477) [2484 bp, 827 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089c YTA12
           or uniprot|P39925 Saccharomyces cerevisiae YER017c AFG3
          Length = 827

 Score =  180 bits (456), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L +P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 349 VKFKDVAGCDEAKEEIMEFVSF-LRNPQRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 407

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 408 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 467

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR++    P+LEG
Sbjct: 468 ANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRRIHIDRPELEG 527

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R         
Sbjct: 528 RKAIFEVHLQKLKLAGSI-FDLKNRLAALTPGFSGADIANVCNEAALIAARHDENAVKLS 586

Query: 450 DFLKAVDKVINGYKK 464
            F +A+++VI G ++
Sbjct: 587 HFEQAIERVIGGVER 601

>NDAI0E03580 Chr5 (769293..771641) [2349 bp, 782 aa] {ON} Anc_7.168
          Length = 782

 Score =  179 bits (455), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 96/262 (36%), Positives = 144/262 (54%), Gaps = 12/262 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V++ +V GC E   ++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 304 VSFKNVAGCDEAKVEIMEFVHF-LKNPNKYTVLGAKIPRGAILSGPPGTGKTLLAKATAG 362

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 363 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARKLAPSIIFIDEIDAIGKERGKGGALG 422

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LDPALLRPGR DR ++   PD+ 
Sbjct: 423 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRPDVLDPALLRPGRFDRHIQIDAPDIN 482

Query: 392 GRANIFRIHTKSMSVERGI---------RWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+ +H K +++E  +             ++ L P  TGA++ + C EA + A R +
Sbjct: 483 GRKQIYLVHLKRLNLEEKLVETKEDVENLAGKLATLTPGFTGADIANACNEAALIAARHK 542

Query: 443 RKVATEKDFLKAVDKVINGYKK 464
               T + F +A+++VI G +K
Sbjct: 543 DPFVTIQHFEQAIERVIAGLEK 564

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/272 (38%), Positives = 152/272 (55%), Gaps = 16/272 (5%)

Query: 172 SPTDIEEGMRVGV-DRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLR 230
           S TD+ E ++VG+ D     +E      I PS       E P V +SD+GG ++   K++
Sbjct: 468 STTDMTE-LKVGITDVESAMLE------IRPSAMREIFLEMPKVYWSDIGGQEDLKRKMK 520

Query: 231 EVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQK 290
           E+++LPL + + FA LGI  PKGILLYGPPG  KTL A+A+A  +   F+ V G E+  K
Sbjct: 521 EMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNK 580

Query: 291 YVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDG 350
           YVGE  R +RE+F  AR     IIFFDE+               N V   +  L+ ++DG
Sbjct: 581 YVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAANHV---LTSLLNEIDG 637

Query: 351 FDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGI 410
            +    + ++ ATNRP+ +D ALLRPGR+DR V  S PD   R  I +  TK+  ++   
Sbjct: 638 VEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQILKKCTKNFDLDN-- 695

Query: 411 RWELISRLCPNS---TGAELRSVCTEAGMFAI 439
             EL++ L   +   +GAE+  +C EAG+ AI
Sbjct: 696 TDELLNDLATRTEGCSGAEVVLLCQEAGLAAI 727

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 136/232 (58%), Gaps = 8/232 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           ++Y  VGG K +I+ L++ ++LPL  PE FA  GI PPKGIL++GPPGTGKT+  R VAN
Sbjct: 233 LSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMHGPPGTGKTMLLRCVAN 292

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            ++A  + + G  +V KY+GE    +RE+F  A+  +  IIF DE+              
Sbjct: 293 ASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIFIDEI---DSIAPNRANDD 349

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G I V+ ATNRPN +DPAL RPGR D+++E  +PD++ 
Sbjct: 350 SGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRRPGRFDQEIEIGIPDVDA 409

Query: 393 RANIFRIHTKSMSVERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIR 440
           R +I +   + +S ++    E     I+       GA+L ++C E+ M  I+
Sbjct: 410 RFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTALCRESVMKTIQ 461

>KLLA0B03234g Chr2 (293919..296333) [2415 bp, 804 aa] {ON} similar
           to uniprot|P32794 Saccharomyces cerevisiae YLR397C AFG2
           ATPase of the CDC48/PAS1/SEC18 (AAA) family forms a
           hexameric complex may be involved in degradation of
           aberrant mRNAs
          Length = 804

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 143/245 (58%), Gaps = 8/245 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V Y+ VGG K++   L+  VE PL  P+ F   GI+PP+GILL+GPPGTGKT+  R VAN
Sbjct: 267 VLYNAVGGLKKETSILKSTVEFPLHQPQLFTDFGINPPRGILLHGPPGTGKTMLLRCVAN 326

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            TDA  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 327 ETDAHILTISGPSIVSKYLGETEAALRDIFNEAKRYQPSIIFIDEI---DSLAPNRANDD 383

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG D  G + V+ ATNRPN++DPAL RPGR D+++E S+PD+E 
Sbjct: 384 SGEVESRVVATLLTLMDGMDGSGRLAVVAATNRPNSIDPALRRPGRFDQEIEISIPDVEA 443

Query: 393 RANIFRIHTKSMSVERGIRW-ELISRLCPNS---TGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I R     MS +R +   E IS +   +    GA+L ++C E+ M  I+       E
Sbjct: 444 RHDILRKQFSRMSKQRQLLSPEDISNIASKTHGYVGADLIALCRESVMKTIQRGLNENIE 503

Query: 449 KDFLK 453
           +D LK
Sbjct: 504 RDDLK 508

 Score =  174 bits (442), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 136/242 (56%), Gaps = 3/242 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V + D+GG +E  +K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 521 IRPSAMREIFLETPKVYWDDIGGQEELKQKMKEMIQLPLEAAETFAKLGVSAPKGVLLYG 580

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 581 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDE 640

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 641 I--DALSPDRDSGSGTSAANHVLTSLLNEIDGVEELKGVIIVAATNRPDEIDPALLRPGR 698

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGI-RWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    P  + R  I +  TK  +++  I   + ++      +GAE+  +C EAG+ 
Sbjct: 699 LDRHIYVGPPSYDARLQILQKCTKKFNIDTAIVDLKALAECTDGCSGAEVVLLCQEAGLA 758

Query: 438 AI 439
           AI
Sbjct: 759 AI 760

>SAKL0E03014g Chr5 complement(245756..248248) [2493 bp, 830 aa] {ON}
           highly similar to uniprot|P40341 Saccharomyces
           cerevisiae YMR089C YTA12 Component with Afg3p of the
           mitochondrial inner membrane m-AAA protease that
           mediates degradation of misfolded or unassembled
           proteins and is also required for correct assembly of
           mitochondrial enzyme complexes
          Length = 830

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/257 (38%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV G  E  E++ E V   L  P R+  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 352 VKFKDVAGMDEAKEEVMEFVSF-LKEPSRYEKLGAKIPRGAILSGPPGTGKTLLAKATAG 410

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DE+              
Sbjct: 411 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 470

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  +I V+  TNRP+ LD AL+RPGR DR +    P+LEG
Sbjct: 471 ANDERENTLNQLLVEMDGFTPADHIVVLAGTNRPDILDQALMRPGRFDRHINIDKPELEG 530

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF++H   + +  G  ++L +RL    P  +GA++ +VC EA + A R+       +
Sbjct: 531 RKEIFQVHLAKIKLA-GEMYDLKNRLATLTPGFSGADIANVCNEAALIAARNDCTAVKLE 589

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 590 HFEQAIERVIGGVERKS 606

>NCAS0A07820 Chr1 complement(1556553..1558928) [2376 bp, 791 aa]
           {ON} Anc_2.472
          Length = 791

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 144/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 311 IKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 369

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 370 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNFSG 429

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+LEG
Sbjct: 430 ANDERENTLNQMLVEMDGFTTEDHVVVLAGTNRPDILDQALLRPGRFDRHINLDKPELEG 489

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H   + +   I ++L +RL    P   GA++ +VC EA + A R+ +K    +
Sbjct: 490 RKAIFAVHLGKLKLSSSI-FDLKNRLAALTPGFAGADIANVCNEAALIAARNDQKSVKLE 548

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 549 HFEQAIERVIGGVERKS 565

>SAKL0H02750g Chr8 (273630..275960) [2331 bp, 776 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 776

 Score =  179 bits (454), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 161/309 (52%), Gaps = 17/309 (5%)

Query: 176 IEEGMRVGVDRSKYFIELP----LPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLRE 231
           I+ G+   +DR K  + L         I PS       E P V +SD+GG +E  +K+RE
Sbjct: 466 IQRGLTESIDREKLKVILKDVEEAMMDIRPSAMREIFLEMPKVYWSDIGGQEELKQKMRE 525

Query: 232 VVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKY 291
           +++LPL + E F  LG+  PKG+LLYGPPG  KTL A+A+A  +   F+ V G E+  KY
Sbjct: 526 MIQLPLEAAETFQRLGVSAPKGVLLYGPPGCSKTLTAKALATESGVNFLAVKGPEIFNKY 585

Query: 292 VGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGF 351
           VGE  R +RE+F  AR     IIFFDE+               +     +  L+ ++DG 
Sbjct: 586 VGESERAIREIFRKARAAAPSIIFFDEI--DALSPDRNSGSGTSAANHVLTSLLNEIDGV 643

Query: 352 DPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGI 410
           +    + ++ ATNRP+ +DPALLRPGR+DR +  + PD   R  IF+  TK   +    +
Sbjct: 644 EELNGVVIVAATNRPDEIDPALLRPGRLDRHIYVAPPDHAARLQIFKKCTKKFQLGGSNV 703

Query: 411 RWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVAT--EKDFLKAVDKVING------- 461
             E ++      +GAE+  +C EAG+ AI    + +    + F KA+  +  G       
Sbjct: 704 DLEELASKTEGCSGAEVVLLCQEAGLAAIMEDLETSKVEARHFEKALSGISKGITQEMLA 763

Query: 462 -YKKFSSTS 469
            Y+ FSS S
Sbjct: 764 YYEDFSSRS 772

 Score =  161 bits (407), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 141/249 (56%), Gaps = 8/249 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + Y+ VGG  ++I  L+  +ELPL  P  F    + PP+GILL+GPPGTGKT+  R VAN
Sbjct: 239 IGYNAVGGLAKEISLLKGTIELPLHQPTLFTDFSVTPPRGILLHGPPGTGKTMLLRCVAN 298

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            T+A  + + G  +V KY+GE    +R++F  A+  +  IIF DE+              
Sbjct: 299 ETNAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEI---DSLAPNRAGDD 355

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             E++ R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ 
Sbjct: 356 SGEIESRVVATLLTLMDGMGGAGRLVVVAATNRPNKIDPALRRPGRFDQEVEIGIPDVDA 415

Query: 393 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I       +S +R  +  E IS +   +    GA+L ++C EA M AI+     + +
Sbjct: 416 RLDILTKQFSKISHQRHELIAEDISTIASKTHGYVGADLIALCREAVMKAIQRGLTESID 475

Query: 449 KDFLKAVDK 457
           ++ LK + K
Sbjct: 476 REKLKVILK 484

>Kpol_467.23 s467 (50661..53240) [2580 bp, 859 aa] {ON}
           (50661..53240) [2580 nt, 860 aa]
          Length = 859

 Score =  179 bits (455), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P+R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 379 VKFKDVAGCDEAKEEIMEFVSF-LKEPKRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 437

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ A+     I+F DE+              
Sbjct: 438 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFIDEIDAIGKARQKGNFSG 497

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF    +I V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 498 ANDERENTLNQLLVEMDGFTTSDHIVVLAGTNRPDILDKALLRPGRFDRHINIDKPELSG 557

Query: 393 RANIFRIHTKSMSVERGIRWEL---ISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H K + +   I ++L   +S L P  +GA++ +VC EA + A R+  +    +
Sbjct: 558 RKAIFEVHLKKIKIAGDI-FDLKNRLSALTPGFSGADIANVCNEAALIAARNEARFVKLE 616

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 617 HFEQAIERVIGGVERKS 633

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score =  179 bits (453), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 139/249 (55%), Gaps = 4/249 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG +E   K++E+++LPL + E FA LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 557

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD+  R  I +  TK  + E  G+    ++      +GAE+  +C EAG+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTEESGVDLHELADRTEGYSGAEVVLLCQEAGLA 734

Query: 438 AIRSRRKVA 446
           AI     VA
Sbjct: 735 AIMEDLDVA 743

 Score =  169 bits (428), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 144/250 (57%), Gaps = 10/250 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           ++Y+ VGG  ++IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 LSYAAVGGLDKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DE+              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGKVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 393 RANIFRIHTKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I       MS +R +      + I+       GA+L ++C E+ M  I  +R + T+
Sbjct: 419 RFDILTKQFSRMSSDRHVLDSEAIKYIASKTHGYVGADLTALCRESVMKTI--QRGLGTD 476

Query: 449 KDFLKAVDKV 458
            +  K   KV
Sbjct: 477 ANIDKFSLKV 486

>KLLA0F13706g Chr6 complement(1269550..1272078) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40341 Saccharomyces cerevisiae
           YMR089C YTA12 Component with Afg3p of the mitochondrial
           inner membrane m-AAA protease that mediates degradation
           of misfolded or unassembled proteins and is also
           required for correct assembly of mitochondrial enzyme
           complexes
          Length = 842

 Score =  179 bits (454), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 145/257 (56%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 334 VNFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGKTLLAKATAG 392

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DE+              
Sbjct: 393 EAGVPFYSVSGSEFVEMFVGVGASRVRDLFKTARENAPAIIFVDEIDAIGKARQKGNFSG 452

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD AL+RPGR DR +    P+L+G
Sbjct: 453 ANDERENTLNQLLVEMDGFTTADHVVVLAGTNRPDVLDQALMRPGRFDRHINIDRPELQG 512

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF++H K +++  G   +L +RL    P  +GA++ +VC EA + A R+       +
Sbjct: 513 RQEIFKVHLKKITLA-GDMTDLQNRLAVMTPGFSGADIANVCNEAALIAARNDCDAVRLE 571

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 572 HFEQAIERVIGGVERKS 588

>SAKL0F03894g Chr6 (312042..314270) [2229 bp, 742 aa] {ON} similar
           to uniprot|P39925 Saccharomyces cerevisiae YER017C AFG3
           Component with Yta12p of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 742

 Score =  177 bits (449), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 96/263 (36%), Positives = 144/263 (54%), Gaps = 11/263 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E   ++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 267 VNFKDVAGCDEAKGEIMEFVHF-LKNPDKYKALGAKIPRGAILSGPPGTGKTLLAKATAG 325

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 326 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFENARKMAPAIIFVDEIDAIGKERGKGGAMG 385

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     I V+  TNRP+ LDPAL+RPGR DR ++   PD+E
Sbjct: 386 GANDEREATLNQLLVEMDGFSTTDQIVVLAGTNRPDVLDPALMRPGRFDRHIQIDAPDVE 445

Query: 392 GRANIFRIHTKSMSVERGIRWE--------LISRLCPNSTGAELRSVCTEAGMFAIRSRR 443
           GR  I+++H   ++++  +            ++ L P   GA++ + C EA + A R + 
Sbjct: 446 GRKAIYKVHLTRLTLDPKLSKSENIQSLAGKLAALTPGFAGADIANACNEAALIAARRKE 505

Query: 444 KVATEKDFLKAVDKVINGYKKFS 466
                K F +A+++VI G +K S
Sbjct: 506 PYVEFKHFDQAIERVIAGLEKKS 528

>TBLA0D04490 Chr4 complement(1111512..1113860) [2349 bp, 782 aa]
           {ON} Anc_7.168 YER017C
          Length = 782

 Score =  177 bits (450), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 97/263 (36%), Positives = 146/263 (55%), Gaps = 11/263 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           VT+ DV GC+E  +++ E V+  L +P ++  LG   P+G +L GPPGTGKTL A+AVA 
Sbjct: 310 VTFKDVAGCQEAKQEIMEFVDF-LKNPHKYTELGAKIPRGAILSGPPGTGKTLLAKAVAG 368

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX- 332
                F+ V GSE V+ +VG GA  VR+LFE A      IIF DE+              
Sbjct: 369 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQASKMAPSIIFVDEIDAIGKARGKNGSLG 428

Query: 333 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD ALLRPGR DR V+   PD+E
Sbjct: 429 GSNDEREATLNQLLVEMDGFSTSDQVVVLAGTNRPDVLDKALLRPGRFDRHVQIDAPDVE 488

Query: 392 GRANIFRIHTKSMSV--------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRR 443
           GR  I+ +H K +++        ++ +    ++ L P  TGA++ + C E+ + A R   
Sbjct: 489 GRKLIYLVHLKKLNLDPLYSEDKQKQLLAGKLAALTPGFTGADIANACNESALIAARKMD 548

Query: 444 KVATEKDFLKAVDKVINGYKKFS 466
                  F +A+++VI G +K S
Sbjct: 549 PYVQFTHFEEAIERVIAGLEKKS 571

>KNAG0C03320 Chr3 complement(654346..656646) [2301 bp, 766 aa] {ON}
           Anc_7.430 YPR024W
          Length = 766

 Score =  177 bits (449), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 293 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 351

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 352 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 411

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 412 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 468

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I R+H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 469 RGRADILRLHMKKITMATDVEPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMSH 528

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 529 FEWAKDKILMGAER 542

>NDAI0J02320 Chr10 complement(562320..564656) [2337 bp, 778 aa] {ON}
           Anc_4.259
          Length = 778

 Score =  177 bits (450), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 95/242 (39%), Positives = 137/242 (56%), Gaps = 3/242 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG +E   K++E+++LPL +   FA LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVFWSDIGGQEELKRKMKEMIQLPLEASATFARLGISAPKGVLLYG 554

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARAASPSIIFFDE 614

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               +     +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 I--DALSPDRDGGSSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDPALLRPGR 672

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +  + PD + R  I +  TK   +E   I+ E ++      +GAE+  +C EAG+ 
Sbjct: 673 LDRHIYVAPPDYDARLQILQKCTKKFQIENTNIKLEDLAERTAGCSGAEVVLLCQEAGLA 732

Query: 438 AI 439
           AI
Sbjct: 733 AI 734

 Score =  162 bits (410), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/250 (36%), Positives = 139/250 (55%), Gaps = 10/250 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +TY  +GG ++++E L+  + LPL  P  F   G+ PP+GILL+GPPGTGKT+  + VAN
Sbjct: 239 ITYDAIGGLRKEVELLQSTISLPLHQPTLFTDFGVTPPRGILLHGPPGTGKTMLLQCVAN 298

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
             +A  + + G  +V KY+GE    +R++F  A+  +  IIF DEV              
Sbjct: 299 TANAHVLTINGPSIVSKYLGETEAALRDIFNEAKKYQPSIIFIDEV---DSLAPNRANDD 355

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T + G    G + V+ ATNRPN++DPAL RPGR D++VE  +PD + 
Sbjct: 356 AGEVESRVVATLLTLMSGMSAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDADA 415

Query: 393 RANIFRIHTKSMSVER----GIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I   +   MS ER    G   + I+       GA+L ++C E+ M  I  +R +   
Sbjct: 416 RLDILLKNFSKMSTERHTLTGEDIKTIASKTHGYVGADLSALCRESVMKTI--QRGMHLY 473

Query: 449 KDFLKAVDKV 458
           KD   ++ KV
Sbjct: 474 KDIDSSLLKV 483

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score =  177 bits (448), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 146/259 (56%), Gaps = 9/259 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 286 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 344

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
             +  F  V GSE V+ +VG GA  VR+LF  AR+    IIF DE+              
Sbjct: 345 EANVPFFSVSGSEFVEMFVGVGASRVRDLFTQARSMSPSIIFIDEIDAIGKERGKGGALG 404

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 405 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 464

Query: 392 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
           GR  I+ +H K ++++  +R ++      ++ L P  TGA++ + C EA + A R   + 
Sbjct: 465 GRQQIYLVHLKRLNLDPLLRDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDQY 524

Query: 446 ATEKDFLKAVDKVINGYKK 464
            T   F +A+++VI G +K
Sbjct: 525 ITIHHFEQAIERVIAGLEK 543

>TPHA0C01520 Chr3 (349034..351388) [2355 bp, 784 aa] {ON} Anc_7.168
           YER017C
          Length = 784

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 294 VAFKDVAGCNEAKQEIMEFVHF-LKNPKKYTDLGAKIPRGAILSGPPGTGKTLLAKATAG 352

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX--XXXXXX 331
                F+ V GSE V+ +VG GA  VR+LFE ART    IIF DE+              
Sbjct: 353 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARTMAPSIIFIDEIDAIGKERGKGGALG 412

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR +E   PD+E
Sbjct: 413 GANDEREATLNQLLVEMDGFQTSDQVIVLAGTNRPDVLDKALMRPGRFDRHIEIDPPDVE 472

Query: 392 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR +I+ +H   +++         ++ +    ++ L P   GA++ + C EA + A R  
Sbjct: 473 GRKSIYLVHLSKLNLDPSFLKTKHDKEMLAGKLAALTPGFAGADIANACNEAALIAARYN 532

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
            +    + F +A+++VI G +K S
Sbjct: 533 DEYVEMRHFEQAIERVIAGLEKKS 556

>ABL041W Chr2 (318699..321155) [2457 bp, 818 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR089C (YTA12)
          Length = 818

 Score =  177 bits (449), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 141/256 (55%), Gaps = 4/256 (1%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 331 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYERMGAQIPRGAILSGPPGTGKTLLAKATAG 389

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     IIF DE+              
Sbjct: 390 EAGVPFFSVSGSEFVEMFVGIGASRVRDLFKTARENAPAIIFIDEIDAIGKSRQKGNFSG 449

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  +I V+  TNR + LD AL+RPGR DR +    P+L G
Sbjct: 450 ANDERENTLNQLLVEMDGFTPSDHIVVLAGTNRQDVLDRALMRPGRFDRHIHIDKPELSG 509

Query: 393 RANIFRIHTKSMSV--ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
           R  IF++H   + +  + G   + ++ L P  +GA++ +VC EA + A R        + 
Sbjct: 510 RQEIFKVHLSKIKLAGDIGDLKDRLAALTPGFSGADIANVCNEAALIAARYDSSSVKLEH 569

Query: 451 FLKAVDKVINGYKKFS 466
           F +A+++VI G ++ S
Sbjct: 570 FEQAIERVIGGVERKS 585

>KAFR0K02060 Chr11 (418631..420811) [2181 bp, 726 aa] {ON} Anc_7.430
           YPR024W
          Length = 726

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 254 KTDVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 312

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF+ AR +   IIF DE+           
Sbjct: 313 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFQQARNRSPAIIFIDELDAIGGKRNPKD 372

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 373 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 429

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 430 RGRADILKHHMQKITLAPDVDPTIIARGTPGLSGAELSNLVNQAAVYACQKNAIAVDMSH 489

Query: 451 FLKAVDKVINGYKK 464
           F  A DK + G +K
Sbjct: 490 FEWAKDKTLMGAEK 503

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  176 bits (447), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 148/267 (55%), Gaps = 8/267 (2%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG +E  +K++E+++LPL + E F+ LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEELKKKMKEMIQLPLEASETFSRLGISAPKGVLLYG 557

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEIFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGSSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRPGR 674

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSV-ERGIR-WELISRLCPNSTGAELRSVCTEAGM 436
           +DR +    PD+  R  I +  TK  +  E G+  +EL  R     +GAE+  +C EAG+
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNTKESGVDLYELADR-TEGYSGAEVVLLCQEAGL 733

Query: 437 FAIRSRRKVATE--KDFLKAVDKVING 461
            AI     V     + F KA + +  G
Sbjct: 734 AAIMDNLDVTMVELRHFEKAFEGIARG 760

 Score =  172 bits (437), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/252 (38%), Positives = 146/252 (57%), Gaps = 14/252 (5%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           ++Y+ VGG  ++IE L+  +E+PL  PE F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLNKEIESLKSAIEIPLHQPELFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DE+              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETESALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD++ 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRVVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVDA 418

Query: 393 RANIFRIHTKSMSVER------GIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVA 446
           R +I       MS ER      GI+   I+       GA+L ++C E+ M  I  +R + 
Sbjct: 419 RFDILTKQFSRMSPERHLLNSEGIKH--IASKTHGYVGADLTALCRESVMKTI--QRGLG 474

Query: 447 TEKDFLKAVDKV 458
           T+ +  K   KV
Sbjct: 475 TDANIDKFSLKV 486

>NCAS0A14640 Chr1 (2880847..2883099) [2253 bp, 750 aa] {ON}
           Anc_7.430
          Length = 750

 Score =  176 bits (446), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 278 KTNVKFDDVKGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 336

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 337 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 396

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 397 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 453

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I ++H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 454 RGRADILKLHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQQNAIAVDMSH 513

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 514 FEWAKDKILMGAER 527

>CAGL0H09416g Chr8 (921571..923823) [2253 bp, 750 aa] {ON} highly
           similar to uniprot|P39925 Saccharomyces cerevisiae
           YER017c AFG3 or uniprot|P40341 Saccharomyces cerevisiae
           YMR089c YTA12
          Length = 750

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 146/264 (55%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +++ DV GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 275 ISFKDVAGCDEAKQEIMEFVHF-LKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAG 333

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 334 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGALG 393

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNR + LDPAL+RPGR DR +E   PD+ 
Sbjct: 394 GANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAPDMS 453

Query: 392 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+ +H + ++++  +      R  L   ++ L P  TGA++ + C EA + A R +
Sbjct: 454 GRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALIAARHQ 513

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
            K      F +A+++VI G +K S
Sbjct: 514 DKYVELLHFEQAIERVIAGLEKKS 537

>TDEL0H02770 Chr8 (458980..461214) [2235 bp, 744 aa] {ON} Anc_7.168
           YER017C
          Length = 744

 Score =  175 bits (444), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/264 (35%), Positives = 144/264 (54%), Gaps = 12/264 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  +++ E V   L +P+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 265 VQFKDVAGCNEAKQEIMEFVHF-LKNPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 323

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX--XXXXXX 331
                F+ V GSE V+ +VG GA  VR+LFE  R     IIF DE+              
Sbjct: 324 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQGRKMAPSIIFVDEIDAIGKERGKGGAMG 383

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+E
Sbjct: 384 GSNDEREATLNQLLVEMDGFSTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDVE 443

Query: 392 GRANIFRIHTKSMSVERGI------RWEL---ISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+ +H + +++++        R EL   ++ L P   GA++ + C EA + A R  
Sbjct: 444 GRKAIYLVHMRKLNLDKRFTTLQSEREELAGKLAALTPGFAGADIANACNEAALIAARHN 503

Query: 443 RKVATEKDFLKAVDKVINGYKKFS 466
                   F +A+++VI G +K S
Sbjct: 504 DPCIELHHFEQAIERVIAGLEKKS 527

>KLLA0E06711g Chr5 complement(607187..609496) [2310 bp, 769 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 769

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 297 KTNVRFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 355

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 356 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 415

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 416 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 472

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I R H K ++V   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 473 RGRADILRHHMKKVTVAPDVDPTIIARGTPGLSGAELMNLVNQAAVYACQKNAIAVDMQH 532

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 533 FEWAKDKILMGAER 546

>TPHA0G03130 Chr7 (665530..667908) [2379 bp, 792 aa] {ON} Anc_2.472
           YMR089C
          Length = 792

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/266 (36%), Positives = 143/266 (53%), Gaps = 6/266 (2%)

Query: 205 MMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGK 264
           M   +    V ++ V GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGK
Sbjct: 317 MFNSDTNVKVKFNAVAGCDEAKEEIMEFVSF-LKEPSRYERMGAKIPRGAILSGPPGTGK 375

Query: 265 TLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXX 324
           TL A+A A      F  V GSE V+ +VG GA  VR+LF+ A+     I+F DE+     
Sbjct: 376 TLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTAKENAPSIVFVDEIDAIGK 435

Query: 325 XXXXXXXXXXN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKV 383
                     N E + T+ +L+ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +
Sbjct: 436 ARQKGNFSGANDERENTLNQLLVEMDGFTSSDHVVVLAGTNRPDILDKALLRPGRFDRHI 495

Query: 384 EFSLPDLEGRANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIR 440
               P+L GR  IF +H K + +   I ++L +RL    P  +GA++ +VC EA + A R
Sbjct: 496 NIDKPELSGRKAIFDVHLKKIKISDDI-YDLKNRLAVLTPGFSGADIANVCNEAALIAAR 554

Query: 441 SRRKVATEKDFLKAVDKVINGYKKFS 466
                     F +AV++VI G ++ S
Sbjct: 555 DDSHFVALNHFEQAVERVIGGVERKS 580

>ZYRO0F13024g Chr6 (1063334..1065556) [2223 bp, 740 aa] {ON} similar
           to uniprot|P32795 Saccharomyces cerevisiae YPR024W YME1
           Mitochondrial inner membrane protease of the AAA family
           responsible for degradation of unfolded or misfolded
           mitochondrial gene products mutation causes an elevated
           rate of mitochondrial turnover
          Length = 740

 Score =  175 bits (444), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 268 KTNVKFDDVHGCDEARAELEEIVDF-LKDPAKYESLGGTLPKGVLLTGPPGTGKTLLARA 326

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ VRELF  AR++   I+F DE+           
Sbjct: 327 TAGEAGVDFFFMSGSEFDEVYVGVGAKRVRELFSQARSRAPAIVFIDELDAIGGKRNPKD 386

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 387 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKLVNVDLPDV 443

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A +          
Sbjct: 444 RGRADILKHHMKKITLANDVDPTLIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 503

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 504 FEWAKDKILLGAER 517

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score =  175 bits (443), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 135/242 (55%), Gaps = 4/242 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG  E   K++E+++LPL + E FA LGI  PKG+LLYG
Sbjct: 495 IRPSAMREIFLEMPKVYWSDIGGQDELKTKMKEMIQLPLEASETFARLGISAPKGVLLYG 554

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F  V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGINFFAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 614

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               N V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 615 IDALSPVRDGGSTSAANHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDGALLRPGR 671

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVE-RGIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD   R  I +  TK  + E  G+  + ++      +GAE+  +C EAG+ 
Sbjct: 672 LDRHIYVGPPDANARLEILKKCTKKFNTEGSGVDLQELAARTKGYSGAEVVLLCQEAGLA 731

Query: 438 AI 439
           AI
Sbjct: 732 AI 733

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 151/283 (53%), Gaps = 16/283 (5%)

Query: 171 VSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 222
           VS  D+      G    +Y++  P   R   +    T E +          ++Y+ VGG 
Sbjct: 188 VSQLDLNSDEVYGSSNGQYYLSPPFIFRKGSTHIAFTKEMQASRKYNLPEPISYAAVGGL 247

Query: 223 KEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 282
            ++IE L+  +E+PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN ++A  + +
Sbjct: 248 NKEIESLKSAIEIPLHQPTLFSSFGVSPPRGILLHGPPGTGKTMLLRVVANTSNAHVLTI 307

Query: 283 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQ-RTM 341
            G  +V KY+GE    +RE+F  AR  +  IIF DE+                EV+ R +
Sbjct: 308 NGPSIVSKYLGETESALREIFNEARKYQPSIIFIDEI---DSIAPNRANDDSGEVESRVV 364

Query: 342 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHT 401
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE  +PD++ R +I     
Sbjct: 365 ATLLTLMDGMGAAGRLIVIAATNRPNCVDPALRRPGRFDQEVEIGIPDVDARFDILTRQF 424

Query: 402 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 440
             MS +R  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 425 SKMSPDRHALNLEEIKHIASKTHGYVGADLTALCRESVMKTIQ 467

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score =  174 bits (442), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 284 ISFRNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 342

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DE+              
Sbjct: 343 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 402

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 403 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 462

Query: 392 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 463 GRQQIYLVHLKKLNLDPLLTDDMDNLSGKLATLTPGFTGADIANACNEAALIAARHNDSY 522

Query: 446 ATEKDFLKAVDKVINGYKK 464
            T   F +A+++VI G +K
Sbjct: 523 ITIHHFEQAIERVIAGLEK 541

>ZYRO0G03212g Chr7 (245037..247529) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40341 Saccharomyces cerevisiae YMR089C YTA12
           Component with Afg3p of the mitochondrial inner membrane
           m-AAA protease that mediates degradation of misfolded or
           unassembled proteins and is also required for correct
           assembly of mitochondrial enzyme complexes
          Length = 830

 Score =  175 bits (443), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 140/255 (54%), Gaps = 6/255 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L G PGTGKTL A+A A 
Sbjct: 351 VKFKDVAGCDEAKEEIEEFVSF-LKEPSRYEKMGAKIPRGAILSGAPGTGKTLLAKATAG 409

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     +IF DE+              
Sbjct: 410 EAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMIFVDEIDAIGKARQKGNFSG 469

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +L+ ++DGF P  ++ V+  TNRP+ LD ALLRPGR DR V    P+L G
Sbjct: 470 ANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDRALLRPGRFDRHVNIDKPELSG 529

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R  IF +H K + +   I ++L +RL    P  +GA++ + C EA + A R+        
Sbjct: 530 RQAIFEVHLKKIKLAGDI-FDLKNRLAALTPGFSGADIANACNEAALIAARNESDSVKLV 588

Query: 450 DFLKAVDKVINGYKK 464
            F +A+++VI G ++
Sbjct: 589 HFEQAIERVIGGVER 603

>Ecym_7123 Chr7 complement(247275..249458) [2184 bp, 727 aa] {ON}
           similar to Ashbya gossypii AGL274W
          Length = 727

 Score =  174 bits (441), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 147/255 (57%), Gaps = 6/255 (2%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 255 KTNVKFEDVRGCDEARAELEEIVDF-LKDPTKYESLGGNLPKGVLLTGPPGTGKTLLARA 313

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR     IIF DE+           
Sbjct: 314 TAGEAGVDFFFMSGSEFDEIYVGVGAKRIRELFAHARAHAPAIIFIDELDAIGGKRNPKD 373

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 374 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVTVDLPDV 430

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++  G+   +I+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 431 RGRADILQHHMKKVTLAAGVDPYIIARGTPGLSGAELMNLVNQAAVYACQ-QNAIAVDMS 489

Query: 451 FLK-AVDKVINGYKK 464
            L+ A DK++ G ++
Sbjct: 490 HLEWAKDKILMGAER 504

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score =  174 bits (442), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 287 ISFKNVAGCDEAKQEIMEFVHF-LKNPAKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 345

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXX--XXXXXX 331
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DE+              
Sbjct: 346 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 405

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 406 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 465

Query: 392 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 466 GRQQIYLVHLKRLNLDPLLTDDMGNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 525

Query: 446 ATEKDFLKAVDKVINGYKK 464
            T   F +A+++VI G +K
Sbjct: 526 ITIHHFEQAIERVIAGLEK 544

>KLTH0D14586g Chr4 complement(1190295..1192619) [2325 bp, 774 aa]
           {ON} similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18 (AAA) family
           forms a hexameric complex may be involved in degradation
           of aberrant mRNAs
          Length = 774

 Score =  174 bits (442), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 143/267 (53%), Gaps = 5/267 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG ++   K++E+++LPL +PE F+ L +  PKG+LLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQEDLKLKMKEMIQLPLEAPESFSRLSVSAPKGVLLYG 550

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREVFRKARAAAPSIIFFDE 610

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMS-VERGIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD E R  I R  TK    ++     +  ++     +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFEARLQILRKSTKDFHLIDSDALLQEFAQKTEGCSGAEVVLLCQEAGLA 728

Query: 438 AIRSRRKVATEKDFLKAVDKVINGYKK 464
           AI     +  EK   K  DK I G  +
Sbjct: 729 AI--MENLDAEKVDRKHFDKAIAGISR 753

 Score =  163 bits (412), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 141/245 (57%), Gaps = 8/245 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           ++Y+ VGG +++IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA+
Sbjct: 237 MSYNSVGGLQKEIELLKRTIELPLHQPTLFADFGVTPPRGILLHGPPGTGKTMLLRCVAS 296

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
             +A  + + G  +V KY+GE    +R++F  AR  +  IIF DE+              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARIYQPSIIFIDEI---DSLAPSRTSDD 353

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G + V+ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSTGRVVVVAATNRPNAVDMALRRPGRLDQEVEIGIPDVES 413

Query: 393 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M  ++     +  
Sbjct: 414 RHDILLKQFRKVSEKRHELTLEDIQAIASKTHGYVGADLVALCREAVMKTLQRGVSHSLT 473

Query: 449 KDFLK 453
           KD +K
Sbjct: 474 KDEMK 478

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score =  174 bits (442), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 139/242 (57%), Gaps = 4/242 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG ++   K++E+++LPL + E F  LGI  PKG+LLYG
Sbjct: 498 IRPSAMREIFLEMPKVYWSDIGGQEDLKTKMKEMIQLPLEASETFTRLGITAPKGVLLYG 557

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 558 PPGCSKTLTAKALATESGINFLAVKGPEVFNKYVGESERAIREIFRKARSAAPSIIFFDE 617

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               + V   +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 618 IDALSPDRDGGSTSAASHV---LTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 674

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVER-GIRWELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD+  R  I +  TK  ++E  GI  + ++R     +GAE+  +C E+G+ 
Sbjct: 675 LDRHIYVGPPDVNARLEILKKCTKKFNIEESGIDLQELARRTEGYSGAEVVLLCQESGLS 734

Query: 438 AI 439
           AI
Sbjct: 735 AI 736

 Score =  169 bits (428), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 145/250 (58%), Gaps = 10/250 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           ++Y+ VGG +++IE L+  +++PL  P  F++ G+ PP+GILL+GPPGTGKT+  R VAN
Sbjct: 242 ISYTAVGGLRKEIELLKSAIDIPLHQPALFSSFGVSPPRGILLHGPPGTGKTMLLRVVAN 301

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
            ++A  + + G  +V KY+GE    +R++F  AR  +  IIF DE+              
Sbjct: 302 TSNAHVLTINGPSIVSKYLGETEAALRDIFNEARKYQPSIIFIDEI---DSIAPNRANDD 358

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G + V+ ATNRPN++DPAL RPGR D++VE  +PD+E 
Sbjct: 359 SGEVESRVVATLLTLMDGMGAAGRLVVIAATNRPNSVDPALRRPGRFDQEVEIGIPDVEA 418

Query: 393 RANIFRIHTKSMSVERGI----RWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I       MS +R        +LI+       GA+L ++C E+ M  I  +R + T+
Sbjct: 419 RFDILTKQVSRMSPDRHSLDSEAIKLIASKTHGYVGADLTALCRESVMKTI--QRGLGTD 476

Query: 449 KDFLKAVDKV 458
            +  K   KV
Sbjct: 477 ANIDKFSLKV 486

>KNAG0E02550 Chr5 (503696..506233) [2538 bp, 845 aa] {ON} Anc_2.472
           YMR089C
          Length = 845

 Score =  175 bits (443), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 143/257 (55%), Gaps = 6/257 (2%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           V + DV GC E  E++ E V   L  P R+  +G   P+G +L GPPGTGKTL A+A A 
Sbjct: 366 VKFKDVAGCDEAKEEIMEFVSF-LKEPSRYEKMGAKIPRGAILSGPPGTGKTLLAKATAG 424

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
                F  V GSE V+ +VG GA  VR+LF+ AR     I+F DE+              
Sbjct: 425 EAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGKARQKGNISG 484

Query: 334 XN-EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
            N E + T+ +++ ++DGF    ++ V+  TNRP+ LD ALLRPGR DR +    P+L G
Sbjct: 485 ANDERENTLNQMLVEMDGFTAADHVVVLAGTNRPDILDKALLRPGRFDRHINLDNPELSG 544

Query: 393 RANIFRIHTKSMSVERGIRWELISRLC---PNSTGAELRSVCTEAGMFAIRSRRKVATEK 449
           R +IF +H + + +   I ++L +RL    P  +GA++ +VC EA + A R+        
Sbjct: 545 RKDIFAVHLQKLKLAGDI-YDLKNRLAALTPGFSGADIANVCNEAALIAARNDCDSVKLV 603

Query: 450 DFLKAVDKVINGYKKFS 466
            F +A+++VI G ++ S
Sbjct: 604 HFEQAIERVIGGVERKS 620

>ZYRO0G08008g Chr7 complement(649595..652075) [2481 bp, 826 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 826

 Score =  175 bits (443), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 107/322 (33%), Positives = 164/322 (50%), Gaps = 19/322 (5%)

Query: 129 IRSNPSADASRSGANTGEDDEDAKYVIN------LKQIAKFVVGLGERVSPTDIEEGMRV 182
           I ++   D  +   N  ED++  K   N      L  I KF+    E   P + E+   +
Sbjct: 428 IATDNKMDIDQDTENKDEDEKSLKNTANMIDPLPLTIIQKFIQNFPE---PLNDEQLSNL 484

Query: 183 GVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPER 242
            +    +   LP    I P+         PDVT++ VG   +   +L   +  P+  PE 
Sbjct: 485 SIQYEDFLKALP---TIQPTAKREGFATVPDVTWASVGALTKVRVELNMAIVQPIKKPEL 541

Query: 243 FATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVREL 302
           +  +GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++
Sbjct: 542 YEKVGISAPAGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQV 601

Query: 303 FEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFA 362
           F  AR    C+IFFDE+               + V  T+L   T+LDG + R  I V+ A
Sbjct: 602 FTRARASVPCVIFFDELDALVPRRDSTLSESSSRVVNTLL---TELDGLNDRRGIFVVGA 658

Query: 363 TNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIF----RIHTKSMSVERGIRWELISRL 418
           TNRP+ +DPA+LRPGR+D+ +   LP+ E + +I     R +   MS +  +   +    
Sbjct: 659 TNRPDMIDPAMLRPGRLDKTLFIELPNAEEKLDILKTLVRTNGTPMSSDVDLETVIADDR 718

Query: 419 CPNSTGAELRSVCTEAGMFAIR 440
           C N +GA++ S+  E+ + A++
Sbjct: 719 CKNFSGADIASLVRESSVLALK 740

 Score =  143 bits (360), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P      +GG ++ + +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 187 PQSRLESIGGMEDVVAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 246

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      F+ +    +V    GE  + +R+LF+ AR+   C++FFDE+            
Sbjct: 247 AGELQVPFLSISAPSVVSGMSGESEKKIRDLFDEARSLAPCLMFFDEIDAITPKRDGGAQ 306

Query: 332 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D  +        + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 307 REME--RRIVAQLLTSMDELNMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 364

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +   +++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 365 PNELSRVHILKKLAQNLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 417

>NDAI0A01390 Chr1 complement(310386..312524) [2139 bp, 712 aa] {ON}
           Anc_7.430
          Length = 712

 Score =  173 bits (439), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/255 (38%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 305 KTNVKFDDVQGCDEARAELEEIVDF-LKDPTKYESLGGTLPKGVLLTGPPGTGKTLLARA 363

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 364 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 423

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 424 QAY---AKQTLNQLLVELDGFSQSTGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 480

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   LI+R  P  +GAEL ++  +A ++A + +  +A +  
Sbjct: 481 RGRADILKHHMKKVTLASDVDPTLIARGTPGLSGAELSNLVNQAAVYACQ-QNAIAVDMS 539

Query: 451 FLK-AVDKVINGYKK 464
            L+ A DK++ G ++
Sbjct: 540 HLEWAKDKILMGAER 554

>SAKL0F13376g Chr6 (1058414..1060639) [2226 bp, 741 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024W YME1 Mitochondrial inner membrane protease of
           the AAA family responsible for degradation of unfolded
           or misfolded mitochondrial gene products mutation causes
           an elevated rate of mitochondrial turnover
          Length = 741

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 269 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 327

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 328 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 387

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 388 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 444

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 445 RGRADILKHHMKKVTLASEVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMSH 504

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 505 FEWAKDKILMGAER 518

>Suva_16.351 Chr16 (616052..618295) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 510

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>YER017C Chr5 complement(189503..191788) [2286 bp, 761 aa] {ON}
           AFG3Component, with Yta12p, of the mitochondrial inner
           membrane m-AAA protease that mediates degradation of
           misfolded or unassembled proteins and is also required
           for correct assembly of mitochondrial enzyme complexes
          Length = 761

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 145/259 (55%), Gaps = 9/259 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           +++ +V GC E  +++ E V   L +P ++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 285 ISFKNVAGCDEAKQEIMEFVHF-LKNPGKYTKLGAKIPRGAILSGPPGTGKTLLAKATAG 343

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXX--XXX 331
             +  F+ V GSE V+ +VG GA  VR+LF  AR+    IIF DE+              
Sbjct: 344 EANVPFLSVSGSEFVEMFVGVGASRVRDLFTQARSMAPSIIFIDEIDAIGKERGKGGALG 403

Query: 332 XXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 404 GANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVN 463

Query: 392 GRANIFRIHTKSMSVERGIRWEL------ISRLCPNSTGAELRSVCTEAGMFAIRSRRKV 445
           GR  I+ +H K ++++  +  ++      ++ L P  TGA++ + C EA + A R     
Sbjct: 464 GRQQIYLVHLKRLNLDPLLTDDMNNLSGKLATLTPGFTGADIANACNEAALIAARHNDPY 523

Query: 446 ATEKDFLKAVDKVINGYKK 464
            T   F +A+++VI G +K
Sbjct: 524 ITIHHFEQAIERVIAGLEK 542

>CAGL0K05093g Chr11 (495585..497822) [2238 bp, 745 aa] {ON} highly
           similar to uniprot|P32795 Saccharomyces cerevisiae
           YPR024w protease
          Length = 745

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 272 KTNVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 330

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 331 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKD 390

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 391 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 447

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 448 RGRADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTH 507

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 508 FEWAKDKILMGAER 521

>YLL034C Chr12 complement(70633..73146) [2514 bp, 837 aa] {ON}
           RIX7Putative ATPase of the AAA family, required for
           export of pre-ribosomal large subunits from the nucleus;
           distributed between the nucleolus, nucleoplasm, and
           nuclear periphery depending on growth conditions
          Length = 837

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 146/259 (56%), Gaps = 7/259 (2%)

Query: 188 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLG 247
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRLELNMAIVQPIKRPELYEKVG 563

Query: 248 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 307
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 308 TKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 367
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 368 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMS--VERGIRWELISR--LCPNST 423
            +DPA+LRPGR+D+ +   LP+ E + +I +  TKS    +   + +E I R   C N +
Sbjct: 681 MIDPAMLRPGRLDKSLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEEIIRNEKCNNFS 740

Query: 424 GAELRSVCTEAGMFAIRSR 442
           GA+L ++  E+ + A++ +
Sbjct: 741 GADLAALVRESSVLALKRK 759

 Score =  147 bits (370), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ AR+   C++FFDE+            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEARSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 332 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSDNLKIDGAIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>TBLA0F01470 Chr6 (359540..361948) [2409 bp, 802 aa] {ON} Anc_7.430
           YPR024W
          Length = 802

 Score =  173 bits (439), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K DV + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 332 KTDVKFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARA 390

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F+ + GSE  + YVG GA+ +R+LF  AR K   IIF DE+           
Sbjct: 391 TAGEAGVDFLFMSGSEFDEVYVGVGAKRIRDLFAQARAKAPAIIFIDELDAIGGKRNPKD 450

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P+ LD AL RPGR D+ V   LPD+
Sbjct: 451 QAY---AKQTLNQLLVELDGFSQTTGIIIIGATNFPDALDKALTRPGRFDKIVNVDLPDV 507

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GR++I R H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 508 RGRSDILRHHMKKITLAPDVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVNMSH 567

Query: 451 FLKAVDKVINGYKK 464
              A DK++ G +K
Sbjct: 568 LEWAKDKILMGAEK 581

>TDEL0C02930 Chr3 (516526..518748) [2223 bp, 740 aa] {ON} Anc_7.430
           YPR024W
          Length = 740

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 267 KTNVKFDDVCGCDEARAELEEIVDF-LKDPAKYESLGGSLPKGVLLTGPPGTGKTLLARA 325

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 326 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 385

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 386 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 442

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GR++I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +        + 
Sbjct: 443 RGRSDILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMQH 502

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 503 FEWAKDKILMGAER 516

>YPR024W Chr16 (610481..612724) [2244 bp, 747 aa] {ON}
           YME1Catalytic subunit of the mitochondrial inner
           membrane i-AAA protease complex, which is responsible
           for degradation of unfolded or misfolded mitochondrial
           gene products; mutation causes an elevated rate of
           mitochondrial turnover
          Length = 747

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>Smik_16.265 Chr16 (486410..488653) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  173 bits (438), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAVSVDMSH 510

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>KAFR0G02800 Chr7 complement(581262..583613) [2352 bp, 783 aa] {ON}
           Anc_7.168 YER017C
          Length = 783

 Score =  173 bits (438), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 141/262 (53%), Gaps = 12/262 (4%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           + + DV GC+E  +++ E V   L SP+++  LG   P+G +L GPPGTGKTL A+A A 
Sbjct: 303 IQFKDVAGCQEAKQEIMEFVHF-LKSPDKYTALGAKIPRGAILSGPPGTGKTLLAKATAG 361

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXX- 332
                F+ V GSE V+ +VG GA  VR+LFE AR     IIF DE+              
Sbjct: 362 EAGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKNGALG 421

Query: 333 -XXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLE 391
              +E + T+ +L+ ++DGF     + V+  TNRP+ LD AL+RPGR DR ++   PD+ 
Sbjct: 422 GANDEREATLNQLLVEMDGFTTTDQVVVLAGTNRPDVLDSALMRPGRFDRHIQIDAPDIT 481

Query: 392 GRANIFRIHTKSMSV---------ERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSR 442
           GR  I+ +H   + +         +  +    ++ L P  TGA++ + C EA + A R +
Sbjct: 482 GRKEIYLVHLAKLHLDPVFTKTKKDGDMLAGKLATLTPGFTGADIANACNEAALIAARYK 541

Query: 443 RKVATEKDFLKAVDKVINGYKK 464
                   F +A+++VI G +K
Sbjct: 542 DPYVGLSHFEQAIERVIAGLEK 563

>Skud_12.33 Chr12 complement(61780..64293) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 146/257 (56%), Gaps = 7/257 (2%)

Query: 188 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLG 247
           KY   L   P I P+         PDVT+++VG  +    +L   +  P+  PE +  +G
Sbjct: 504 KYEDFLKALPTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVG 563

Query: 248 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 307
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 564 ISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRAR 623

Query: 308 TKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 367
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 624 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPD 680

Query: 368 TLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKSMS--VERGIRWELI--SRLCPNST 423
            +DPA+LRPGR+D+ +   LP++E + +I +  TKS    +   + +E I  +  C N +
Sbjct: 681 MIDPAMLRPGRLDKTLFIELPNMEEKLDIIKTLTKSHGTPLSGDVDFEKIIKNEKCNNFS 740

Query: 424 GAELRSVCTEAGMFAIR 440
           GA+L ++  E+ + A++
Sbjct: 741 GADLAALVRESSVLALK 757

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKTLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDE+            
Sbjct: 260 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 332 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I R  +  + ++  I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILRKMSDDLKIDGAIDFAKLSKLTPGFVGADLKALVTAAGTCAIK 430

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  173 bits (438), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 141/248 (56%), Gaps = 7/248 (2%)

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
           P I P+         PDVT+++VG  +    +L   +  P+  PE +  +GI  P G+LL
Sbjct: 513 PTIQPTAKREGFATVPDVTWANVGALQRVRIELNMAIVQPIKRPELYEKVGISAPGGVLL 572

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFF
Sbjct: 573 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFF 632

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 633 DELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDPAMLRP 689

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNSTGAELRSVCT 432
           GR+D+ +   LP+ E + +I +  TKS    +S +      + +  C N +GA+L ++  
Sbjct: 690 GRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSSDVDFEKIITNEKCNNFSGADLAALVR 749

Query: 433 EAGMFAIR 440
           E+ + A++
Sbjct: 750 ESSVLALK 757

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P+ +   +GG  + + +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVVAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDE+            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 332 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--KRIVAQLLTSMDELTMEKTNGKPVIIIGATNRPDSLDAALRRAGRFDREICLNV 377

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 378 PNEVSRLHILKKMSNNLKIDGIIDFAKLAKLTPGFVGADLKALVTAAGTCAIK 430

>Skud_16.309 Chr16 (575130..577373) [2244 bp, 747 aa] {ON} YPR024W
           (REAL)
          Length = 747

 Score =  172 bits (436), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 141/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 275 KTNVKFDDVCGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 333

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +R+LF  AR++   IIF DE+           
Sbjct: 334 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFAQARSRAPAIIFIDELDAIGGKRNPKD 393

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P  LD AL RPGR D+ V   LPD+
Sbjct: 394 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDV 450

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 451 RGRADILKHHMKKITLADNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAISVDMSH 510

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 511 FEWAKDKILMGAER 524

>SAKL0H25630g Chr8 (2244348..2246840) [2493 bp, 830 aa] {ON} highly
           similar to uniprot|Q07844 Saccharomyces cerevisiae
           YLL034C RIX7 Putative ATPase of the AAA family required
           for export of pre-ribosomal large subunits from the
           nucleus distributed between the nucleolus nucleoplasm
           and nuclear periphery depending on growth conditions
          Length = 830

 Score =  172 bits (437), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 94/248 (37%), Positives = 141/248 (56%), Gaps = 7/248 (2%)

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
           P I P+         PDVT+S+VG   +   +L   +  P+  PE +  +GI  P G+LL
Sbjct: 507 PTIQPTAKREGFATVPDVTWSNVGALGKTRIELNMAIVQPIKRPELYEKVGISAPAGVLL 566

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    CIIFF
Sbjct: 567 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCIIFF 626

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 627 DELDALVPRRDTALSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRP 683

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNSTGAELRSVCT 432
           GR+D+ +   LP+ + + +I +   KS    +S +  I+  +    C N +GA+L ++  
Sbjct: 684 GRLDKTLFIELPNYDEKLDIVKTLIKSNGTPLSSDVDIQCIVADERCRNFSGADLAALVR 743

Query: 433 EAGMFAIR 440
           E+ + A++
Sbjct: 744 ESSVLALK 751

 Score =  152 bits (384), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 134/233 (57%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P    + +GG  + I +L E++ LP+L PE +A+ G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PTTNLATLGGMDDVIAQLMELIGLPILHPEIYASTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDE+            
Sbjct: 263 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKNLAPCLVFFDEIDAITPKRDGGAQ 322

Query: 332 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D   F+  G   + V+ ATNRP++LDPAL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSFEKTGGKPVIVIGATNRPDSLDPALRRAGRFDREICLNV 380

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEISRLHILKKMSSALKIDGTIDFSKLAKLTPGFVGADLKALTTAAGTCAIK 433

>AGL274W Chr7 (191481..193679) [2199 bp, 732 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR024W (YME1)
          Length = 732

 Score =  172 bits (435), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 95/254 (37%), Positives = 142/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG + PKG+LL GPPGTGKTL ARA
Sbjct: 260 KTNVKFEDVRGCDEARAELEEIVDF-LKDPAKYESLGGNLPKGVLLTGPPGTGKTLLARA 318

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   IIF DE+           
Sbjct: 319 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFAQARARAPAIIFIDELDAIGGKRNPKD 378

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 379 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKIVNVDLPDV 435

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I + H + +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 436 RGRADILQHHMRKVTLAPDVDPSIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMTH 495

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 496 FEWAKDKILMGAER 509

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score =  172 bits (437), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 141/248 (56%), Gaps = 7/248 (2%)

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
           P I P+         PDVT+++VG  +    +L   +  P+  PE +  +GI  P G+LL
Sbjct: 514 PTIQPTAKREGFATVPDVTWANVGALQRVRVELNMAIVQPIKRPELYEKVGISAPGGVLL 573

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFF
Sbjct: 574 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFF 633

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 634 DELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDPAMLRP 690

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNSTGAELRSVCT 432
           GR+D+ +   LP+ E + +I +  TKS    +S +      + +  C N +GA+L ++  
Sbjct: 691 GRLDKTLFIELPNTEEKLDIIKTLTKSHGTPLSDDVDFEKIITNEKCNNYSGADLAALVR 750

Query: 433 EAGMFAIR 440
           E+ + A++
Sbjct: 751 ESSVLALK 758

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 129/232 (55%), Gaps = 6/232 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P+ +   +GG  + I +L E++ LP+L PE F + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 200 PNSSLKSLGGMDDVIAQLMELIGLPILHPEIFLSTGVEPPRGVLLHGPPGCGKTSIANAL 259

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDE+            
Sbjct: 260 AGELKVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 319

Query: 332 XXXNEVQRTMLELITQLDGFDPRGN----IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D           + ++ ATNRP++LD AL R GR DR++  ++
Sbjct: 320 REME--RRIVAQLLTSMDELTMEKTNGKPVIIVGATNRPDSLDSALRRAGRFDREICLNV 377

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAI 439
           P+   R +I +  +  + ++  I +  +++L P   GA+L+++ T AG  AI
Sbjct: 378 PNEVSRLHILKKMSDKLKIDGTIDFAKLAKLTPGFVGADLKALVTAAGTCAI 429

>TDEL0E01110 Chr5 (227041..229377) [2337 bp, 778 aa] {ON} Anc_4.259
           YLR397C
          Length = 778

 Score =  172 bits (436), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 143/267 (53%), Gaps = 7/267 (2%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           + PS       E P V +SD+GG +E   K+ E+++LPL + E F+ LG+  PKG+LLYG
Sbjct: 495 VRPSAMREIFLEMPKVYWSDIGGQEELKRKMVEMIQLPLEASETFSRLGVSAPKGVLLYG 554

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 555 PPGCSKTLTAKALATESGLNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 614

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +                 V   +  L+ ++DG +    + ++ ATNRP+ +DPALLRPGR
Sbjct: 615 IDALSPDRDGPSSSAAGHV---LTSLLNEIDGVEELNGVVIVGATNRPDEIDPALLRPGR 671

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 436
           +DR +  + PD   R  I    +   S E    ++L  ++R     +GAE+  +C EAG+
Sbjct: 672 LDRHIYVAPPDYAARLQILTKCSSKFSTEEEPDYDLENLARRTEGCSGAEVVLLCQEAGL 731

Query: 437 FAIRSR--RKVATEKDFLKAVDKVING 461
            AI      K    + F KA+  +  G
Sbjct: 732 AAIMENLDTKRVEARHFEKALSGISRG 758

 Score =  153 bits (387), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 130/234 (55%), Gaps = 16/234 (6%)

Query: 216 YSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRT 275
           YS VGG  ++I+ L++ +ELPL  P  F    + PP+G+LL+GPPGTGKT+  R  AN  
Sbjct: 243 YSLVGGLAKEIDSLKKTIELPLHQPTLFTRFAVSPPRGVLLHGPPGTGKTMLLRCFANTC 302

Query: 276 DATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXN 335
           +A  + + G  +V K++GE    +RE+F+ A+  +  IIF DE+                
Sbjct: 303 NAHVLTINGPSIVSKFLGETEATLREIFDEAKKYQPSIIFIDEIDSIAPNRAHDDSGEAE 362

Query: 336 EVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRAN 395
              R +  L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD++ R  
Sbjct: 363 --SRVVATLLTLMDGMGGAGRVVVVAATNRPNAVDPALRRPGRFDQEVEIAVPDVDARLE 420

Query: 396 IFR---------IHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           I +         +HT S   +  IR   I+       GA+L ++C E+ M AI+
Sbjct: 421 ILKKQFDKMNSDLHTLS---DDDIRN--IASRTHGYVGADLIALCRESVMKAIQ 469

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score =  172 bits (436), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 156/288 (54%), Gaps = 13/288 (4%)

Query: 157 LKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPDVTY 216
           L  I KF+    E   P + E+  ++ +    +   LP    I P+         PDVT+
Sbjct: 496 LSIIQKFIQNFPE---PLNDEQLAQLSIKYEDFLKALP---TIQPTAKREGFATVPDVTW 549

Query: 217 SDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTD 276
           ++VG   +   +L   +  P+  PE +  +GI+ P G+LL+GPPG GKTL A+AVAN + 
Sbjct: 550 ANVGALGKVRVELNMAIVQPIKRPELYEKVGINAPAGVLLWGPPGCGKTLLAKAVANESR 609

Query: 277 ATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNE 336
           A FI + G EL+ KYVGE  R +R++F  AR    C+IFFDE+               + 
Sbjct: 610 ANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRRDTSLSESSSR 669

Query: 337 VQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANI 396
           V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRPGR+D+ +   LP+ E + +I
Sbjct: 670 VVNTLL---TELDGLNDRRGIFVVAATNRPDMIDPAMLRPGRLDKTIFIELPNYEEKVDI 726

Query: 397 FRIHTKSMS--VERGIRWELI--SRLCPNSTGAELRSVCTEAGMFAIR 440
               ++S    +  G+ +  I     C N +GA+L ++  E+ + A++
Sbjct: 727 ITTVSRSSGTPLAEGVDFRKIIQDERCRNFSGADLAALVRESSVLALK 774

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 132/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P    + +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 203 PSSDLNSLGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 262

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +RELFE A++   C++FFDE+            
Sbjct: 263 AGELKVPFISISAPSVVSGMSGESEKKLRELFEEAKSLAPCLMFFDEIDAITPKRDGGAQ 322

Query: 332 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 323 REME--RRIVAQLLTSMDELSMEQTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 380

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  + ++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 381 PNEVSRLHILKKMSNNLKIDGEIDFLKLAKLTPGFVGADLKALTTAAGTCAIK 433

>KLTH0C05742g Chr3 complement(499428..501662) [2235 bp, 744 aa] {ON}
           highly similar to uniprot|P32795 Saccharomyces
           cerevisiae YPR024W YME1 Mitochondrial inner membrane
           protease of the AAA family responsible for degradation
           of unfolded or misfolded mitochondrial gene products
           mutation causes an elevated rate of mitochondrial
           turnover
          Length = 744

 Score =  171 bits (433), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 94/254 (37%), Positives = 140/254 (55%), Gaps = 4/254 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +V + DV GC E   +L E+V+  L  P ++ +LG   PKG+LL GPPGTGKTL ARA
Sbjct: 273 KTNVKFDDVRGCDEARAELEEIVDF-LKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARA 331

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +RELF  AR +   I+F DE+           
Sbjct: 332 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIVFIDELDAIGGKRNPKD 391

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 392 QAY---AKQTLNQLLVELDGFSQSSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 448

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GR +I + H K +++   +   +I+R  P  +GAEL ++  +A ++A +          
Sbjct: 449 RGRTDILKHHMKKVTLASDVDPTIIARGTPGLSGAELMNLVNQAAVYACQQNAIAVDMNH 508

Query: 451 FLKAVDKVINGYKK 464
           F  A DK++ G ++
Sbjct: 509 FEWAKDKILMGAER 522

>CAGL0D02838g Chr4 complement(296403..298907) [2505 bp, 834 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034c
          Length = 834

 Score =  172 bits (435), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 167/318 (52%), Gaps = 19/318 (5%)

Query: 136 DASRSGANTGEDDEDAKYVINLKQIAKFVVGLGERV---------SPTDIEEGMRVGVDR 186
           D ++  +  G   +D+   INLK  A  +  L   V          P + ++  ++ +  
Sbjct: 445 DKNKLDSVEGNSQKDSDSEINLKNTANMIDPLPLSVIQRFIHNYPDPLNDDQLNQLTIKY 504

Query: 187 SKYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATL 246
             +   LP    I P+         PDVT+S+VG  ++   +L   +  P+  PE +  +
Sbjct: 505 EDFLKALP---TIQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKV 561

Query: 247 GIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMA 306
           GI  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  A
Sbjct: 562 GISAPGGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRA 621

Query: 307 RTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRP 366
           R    C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP
Sbjct: 622 RASVPCVIFFDELDALVPRRDTSMSESSSRVVNTLL---TELDGLNDRHGIFVVGATNRP 678

Query: 367 NTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNS 422
           + +DPA+LRPGR+D+ +   LP+ + + +I R  T S    +S +  ++  +    C N 
Sbjct: 679 DMIDPAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNF 738

Query: 423 TGAELRSVCTEAGMFAIR 440
           +GA+L ++  E+ + A++
Sbjct: 739 SGADLAALVRESSVLALK 756

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P  + S +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 193 PTSSLSALGGMDDVIAQLMELIGLPILHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANAL 252

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +RELF+ A++   C++FFDE+            
Sbjct: 253 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 312

Query: 332 XXXNEVQRTMLELITQLDGF---DPRGN-IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D     +  G  + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 313 REME--RRIVAQLLTSMDELTLSNTNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 370

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +     + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 371 PNEISRLHILKKMAGKLKIDGEIDFHKLAKLTPGFVGADLKALTTAAGTCAIK 423

>Ecym_6218 Chr6 complement(409972..412488) [2517 bp, 838 aa] {ON}
           similar to Ashbya gossypii AFR188W
          Length = 838

 Score =  172 bits (435), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 142/257 (55%), Gaps = 7/257 (2%)

Query: 188 KYFIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLG 247
           KY   L   P I P+         PDVT+++VG   +   +L   +  P+  PE +  +G
Sbjct: 502 KYEDFLKALPTIQPTAKREGFATVPDVTWTNVGALTKIRMELNMAIVQPIKRPELYEKVG 561

Query: 248 IDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMAR 307
           I  P G+LL+GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR
Sbjct: 562 ISAPAGVLLWGPPGCGKTLIAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRAR 621

Query: 308 TKKACIIFFDEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPN 367
               C+IFFDE+               + V  T+L   T+LDG + R  I V+ ATNRP+
Sbjct: 622 ASVPCVIFFDELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIAATNRPD 678

Query: 368 TLDPALLRPGRIDRKVEFSLPDLEGRANIFR--IHTKSMSVERGIRWELI--SRLCPNST 423
            +DPA+LRPGR+D+ +   LPDL  + +I +  I +    +   I   +I     C N +
Sbjct: 679 IIDPAMLRPGRLDKTLFIELPDLTEKHDILKTLIRSNGTPLAPNIDLSVIVSDERCRNFS 738

Query: 424 GAELRSVCTEAGMFAIR 440
           GA+L S+  E+ + A++
Sbjct: 739 GADLASLVRESSVLALK 755

 Score =  150 bits (378), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P    S +GG  + + +L E++ LP+L PE +A+ GI+PP+G+L +GPPG GKT  A A+
Sbjct: 206 PQTDLSSLGGMDDVVAQLMELIGLPILHPEIYASTGIEPPRGVLFHGPPGCGKTSIANAL 265

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ A++   C++FFDE+            
Sbjct: 266 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKSLAPCLVFFDEIDAIAPKRDGGAQ 325

Query: 332 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D   FD      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 326 REME--RRIVAQLLTSMDELSFDKTDGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 383

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  T ++ +   I +  +S+L P   GA+L+++ T AG  AI+
Sbjct: 384 PNEASRMHILKKMTSNLKINGQIDFVKLSKLTPGFVGADLKALVTAAGTCAIK 436

>Kwal_23.4194 s23 (612204..614528) [2325 bp, 774 aa] {ON} YLR397C
           (AFG2) - homology to the CDC48 gene product [contig 1]
           FULL
          Length = 774

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/282 (35%), Positives = 147/282 (52%), Gaps = 13/282 (4%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V +SD+GG  +   K++E+++LPL + E F  LG++ PKGILLYG
Sbjct: 491 IRPSAMREIFLEMPKVYWSDIGGQHDLKLKMKEMIQLPLEASESFKRLGVNAPKGILLYG 550

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR     IIFFDE
Sbjct: 551 PPGCSKTLTAKALATESGVNFLAVKGPEIFNKYVGESERAIREIFRKARAAAPSIIFFDE 610

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +               +     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 611 I--DALSPDRDSGGSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDAALLRPGR 668

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRW-ELISRLCPNSTGAELRSVCTEAGMF 437
           +DR +    PD + R  I    TK+  +E   +  E ++      +GAE+  +C EAG+ 
Sbjct: 669 LDRHIYVGPPDFDARLQILNKCTKNFHMENQDQMLEDLAHKTEGCSGAEVVLLCQEAGLA 728

Query: 438 AIRSRRKVAT--EKDFLKAVDKVING--------YKKFSSTS 469
           AI    +     ++ F KA+  +  G        Y  F S S
Sbjct: 729 AIMENLETENVEQRHFEKALSGISRGINAEMLQYYSDFQSRS 770

 Score =  162 bits (409), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 139/249 (55%), Gaps = 8/249 (3%)

Query: 214 VTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVAN 273
           ++Y+ VGG  ++IE L+  +ELPL  P  FA  G+ PP+GILL+GPPGTGKT+  R VA 
Sbjct: 237 MSYNSVGGLNKEIELLKRTIELPLHQPTLFAEFGVTPPRGILLHGPPGTGKTMLLRCVAG 296

Query: 274 RTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXX 333
             +A  + + G  +V KY+GE    +R++F  AR  +  I+F DE+              
Sbjct: 297 EANAHVLTINGPSIVSKYLGETEAALRDIFNEARLYQPSIVFIDEI---DSLAPSRASDD 353

Query: 334 XNEVQ-RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEG 392
             EV+ R +  L+T +DG    G + ++ ATNRPN +D AL RPGR+D++VE  +PD+E 
Sbjct: 354 SGEVESRVVATLLTLMDGMGSSGRVVIVAATNRPNAIDTALRRPGRLDQEVEIGIPDVES 413

Query: 393 RANIFRIHTKSMSVERG-IRWELISRLCPNS---TGAELRSVCTEAGMFAIRSRRKVATE 448
           R +I     + +S +R  +  E I  +   +    GA+L ++C EA M  ++        
Sbjct: 414 RHDILTKQFRKVSEKRHELTLEDIESIASKTHGYVGADLVALCREAVMKTLQRGVVHNLS 473

Query: 449 KDFLKAVDK 457
           KD LK   K
Sbjct: 474 KDELKVTMK 482

>TPHA0E00660 Chr5 complement(125411..127759) [2349 bp, 782 aa] {ON}
           Anc_7.430 YPR024W
          Length = 782

 Score =  171 bits (432), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/255 (37%), Positives = 145/255 (56%), Gaps = 6/255 (2%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K +VT+ DV GC E   +L E+V+  L  P ++ +LG   P G+LL GPPGTGKTL ARA
Sbjct: 309 KTNVTFDDVRGCDEARAELEEIVDF-LKDPAKYESLGGKLPSGVLLTGPPGTGKTLLARA 367

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +R+LF  AR K   IIF DE+           
Sbjct: 368 TAGEAGVDFFFMSGSEFDEVYVGVGAKRIRDLFSQARAKAPAIIFIDELDAIGGKRNPKD 427

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++T+ +L+ +LDGF     I ++ ATN P +LD AL RPGR D+ V   LPD+
Sbjct: 428 QAY---AKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDV 484

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GRA+I   H K +++   +   +I+R  P  +GAEL ++  +A ++A + +  ++ +  
Sbjct: 485 RGRADILAHHLKKITLAPNVDATVIARGTPGLSGAELANLVNQAAVYACQ-QNAISVDMS 543

Query: 451 FLK-AVDKVINGYKK 464
            L+ A DK++ G ++
Sbjct: 544 HLEWAKDKILLGAER 558

>KLLA0E00837g Chr5 complement(84426..86870) [2445 bp, 814 aa] {ON}
           highly similar to uniprot|Q07844 Saccharomyces
           cerevisiae YLL034C RIX7 Putative ATPase of the AAA
           family required for export of pre-ribosomal large
           subunits from the nucleus distributed between the
           nucleolus nucleoplasm and nuclear periphery depending on
           growth conditions
          Length = 814

 Score =  171 bits (432), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 139/248 (56%), Gaps = 7/248 (2%)

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
           P I P+         PDVT+S VG   +   +L   +  P+  PE +  +GI  P G+LL
Sbjct: 494 PTIQPTAKREGFATVPDVTWSSVGALDKIRIELNMAIVQPIKRPELYEKVGISAPAGVLL 553

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    CIIFF
Sbjct: 554 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFNRARASVPCIIFF 613

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 614 DELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRRGIFVVGATNRPDMIDPAMLRP 670

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTKS----MSVERGIRWELISRLCPNSTGAELRSVCT 432
           GR+D+ +   LP+ E + +I R   +S    ++ +  I   +    C N +GA++ ++  
Sbjct: 671 GRLDKTLFIELPNFEEKVDIMRTLIRSNGTPIADDVDINRIVNDERCKNFSGADIAALVR 730

Query: 433 EAGMFAIR 440
           E+ + A++
Sbjct: 731 ESSVLALK 738

 Score =  144 bits (363), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 130/233 (55%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P    S +GG  + I +L E++ LP+L PE ++  G++PP+G+LL+GPPG GKT  A A+
Sbjct: 194 PSSNLSTLGGMDDVIAQLMELIGLPILHPEIYSATGVEPPRGVLLHGPPGCGKTSIANAL 253

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +RELF+ A++   C++FFDE+            
Sbjct: 254 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLVFFDEIDAITPKRDGGAQ 313

Query: 332 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D   F+      + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 314 REME--RRIVAQLLTSMDELSFEKMEGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 371

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R  I +    S+ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 372 PNETSRYFILKKMASSLKIDGEIDFIKLAKLTPGFVGADLKALITAAGTCAIK 424

>ZYRO0B12606g Chr2 complement(1013826..1016159) [2334 bp, 777 aa]
           {ON} highly similar to uniprot|P32794 Saccharomyces
           cerevisiae YLR397C AFG2 ATPase of the CDC48/PAS1/SEC18
           (AAA) family forms a hexameric complex may be involved
           in degradation of aberrant mRNAs
          Length = 777

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 153/283 (54%), Gaps = 16/283 (5%)

Query: 171 VSPTDIEEGMRVGVDRSKYFIELPLPPRIDPSVTMMTVEEKPD--------VTYSDVGGC 222
           VS  D+ +     V+ S  ++  P+  R   +    T   KP         + Y  VGG 
Sbjct: 185 VSKCDLNQDSTTTVEDSSPYLSPPVIFRRGSTKVEFTKASKPSSRFNLSHSIGYDSVGGL 244

Query: 223 KEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRV 282
            ++IE L+  + LPL  P+ F+  G+ PP+GILL+GPPGTGKT+  R VAN TDA  + +
Sbjct: 245 AKEIEVLKNAIHLPLHKPKLFSEFGVAPPRGILLHGPPGTGKTMLLRCVANTTDAHILTI 304

Query: 283 IGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXXXXXNEVQ-RTM 341
            G  +V KY+GE    +RE+F+ A+  +  IIF DE+                EV+ R +
Sbjct: 305 NGPSIVSKYLGETEATLREIFDEAKLYQPSIIFIDEI---DSIAPNRASDDSGEVESRVV 361

Query: 342 LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHT 401
             L+T +DG    G + V+ ATNRPN +DPAL RPGR D++VE ++PD+E R +I     
Sbjct: 362 ATLLTLMDGMGAAGRLVVVAATNRPNNIDPALRRPGRFDQEVEIAIPDVEERIDILMKQF 421

Query: 402 KSMSVER-GIRWELISRLCPNS---TGAELRSVCTEAGMFAIR 440
           + MS E+  +  E I  +   +    GA+L ++C E+ M  I+
Sbjct: 422 ERMSSEKHSLSAEDIKEVAAKTHGYVGADLTALCRESVMKTIQ 464

 Score =  169 bits (427), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 132/243 (54%), Gaps = 3/243 (1%)

Query: 199 IDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYG 258
           I PS       E P V ++D+GG      K++E+++LPL + E FA LG+  PKG+LLYG
Sbjct: 492 IRPSAMREIFLEMPKVYWTDIGGQDVLKRKMKEMIQLPLEASETFARLGVSAPKGVLLYG 551

Query: 259 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDE 318
           PPG  KTL A+A+A  +   F+ V G E+  KYVGE  R +RE+F  AR+    IIFFDE
Sbjct: 552 PPGCSKTLTAKALATESGVNFLAVKGPEIFSKYVGESERAIREIFHKARSAAPSIIFFDE 611

Query: 319 VXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGR 378
           +                     +  L+ ++DG +    + ++ ATNRP+ +D ALLRPGR
Sbjct: 612 I-DAISSSRDDGGSSTTAASNVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRPGR 670

Query: 379 IDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWEL--ISRLCPNSTGAELRSVCTEAGM 436
           +DR +    PD   R  I +  T   S++    + L  ++      +GAE+  +C EAG+
Sbjct: 671 LDRHIYVGPPDYSARLQILKKCTSKFSIDSQPDYNLEKLAEHTDGCSGAEIVLLCQEAGL 730

Query: 437 FAI 439
            AI
Sbjct: 731 AAI 733

>Kpol_1044.15 s1044 complement(29676..32195) [2520 bp, 839 aa] {ON}
           complement(29676..32195) [2520 nt, 840 aa]
          Length = 839

 Score =  170 bits (430), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 92/248 (37%), Positives = 140/248 (56%), Gaps = 7/248 (2%)

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
           P I P+         PDVT+++VG   +   +L   +  P+  PE +  +GI  P G+LL
Sbjct: 521 PTIQPTAKREGFATVPDVTWANVGALDKTRVELNMAIVQPIKRPELYEKVGISAPAGVLL 580

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFF
Sbjct: 581 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERSIRQVFTRARASVPCVIFF 640

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 641 DELDALVPRRDTSLSESSSRVVNTLL---TELDGLNDRRGIFVIGATNRPDMIDPAMLRP 697

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTKSMSVERGIRWELISRL----CPNSTGAELRSVCT 432
           GR+D+ +   LP+ + + +I +  T+S         EL + +    C N +GA+L ++  
Sbjct: 698 GRLDKTLFIELPNEDEKLDIIKTLTRSNGTPLADDVELQTIISDERCRNFSGADLAALVR 757

Query: 433 EAGMFAIR 440
           E+ + A++
Sbjct: 758 ESSVLALK 765

 Score =  143 bits (360), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 131/233 (56%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P      +GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 205 PSSDLKSLGGMDDVIAQLMELIGLPILHPEIYQSTGVEPPRGVLLHGPPGCGKTSIANAL 264

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +R+LF+ A+    C++FFDE+            
Sbjct: 265 AGELQVPFISISAPSVVSGMSGESEKKIRDLFDEAKAIAPCLMFFDEIDAITPKRDGGAQ 324

Query: 332 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 325 REME--RRIVAQLLTSMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 382

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  ++++ ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 383 PNEVSRLHILKKMSENLKIDGEIDFAQLAKLTPGFVGADLKALSTAAGTCAIK 435

>Kpol_1045.11 s1045 complement(28898..30985) [2088 bp, 695 aa] {ON}
           complement(28898..30985) [2088 nt, 696 aa]
          Length = 695

 Score =  169 bits (427), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 144/256 (56%), Gaps = 4/256 (1%)

Query: 211 KPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARA 270
           K DV + DV GC E   +L EVV+  L +P ++ +LG   PKGIL+ GPPGTGKTL ARA
Sbjct: 252 KSDVRFEDVCGCNEARAELEEVVDF-LKNPSKYESLGGKLPKGILITGPPGTGKTLLARA 310

Query: 271 VANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXX 330
            A      F  + GSE  + YVG GA+ +R+LF  A+     IIF DE+           
Sbjct: 311 TAGEAGVKFFMMSGSEFDEVYVGVGAKRIRDLFTEAKANAPAIIFIDELDAVGVRRTTLD 370

Query: 331 XXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDL 390
                  ++++ +L+ +LDGF     I V+ ATN P  LD AL RPGR D+ V  SLPD+
Sbjct: 371 PAY---TKQSLNQLLVELDGFSQTSGIIVIGATNFPEGLDKALTRPGRFDKIVNVSLPDV 427

Query: 391 EGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRSRRKVATEKD 450
            GR  I + H ++++++  +   +++R  P  +GA+L ++  +A ++A ++  K      
Sbjct: 428 RGRTEILKRHMRNITLDLDVDPVILARGTPGFSGADLANLVNQAAVYACQNNAKTVNMSH 487

Query: 451 FLKAVDKVINGYKKFS 466
           F  + DK++ G +K S
Sbjct: 488 FEWSKDKILLGAEKKS 503

>TPHA0K02220 Chr11 (473969..476431) [2463 bp, 820 aa] {ON} Anc_4.23
           YLL034C
          Length = 820

 Score =  169 bits (429), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 93/248 (37%), Positives = 137/248 (55%), Gaps = 7/248 (2%)

Query: 197 PRIDPSVTMMTVEEKPDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILL 256
           P I P+         PDVT++ VG       +L   +  P+  PE +  +GI  P G+LL
Sbjct: 503 PTIQPTAKREGFATVPDVTWASVGALGNIRIELNMAIVQPIKRPELYEKVGISAPAGVLL 562

Query: 257 YGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFF 316
           +GPPG GKTL A+AVAN + A FI + G EL+ KYVGE  R +R++F  AR    C+IFF
Sbjct: 563 WGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFF 622

Query: 317 DEVXXXXXXXXXXXXXXXNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRP 376
           DE+               + V  T+L   T+LDG + R  I V+ ATNRP+ +DPA+LRP
Sbjct: 623 DELDALVPRRDASLSESSSRVVNTLL---TELDGLNDRNGIFVIGATNRPDMIDPAMLRP 679

Query: 377 GRIDRKVEFSLPDLEGRANIFRIHTK--SMSVERGIRWELISR--LCPNSTGAELRSVCT 432
           GR+D+ +   LP+ + + +I    TK     ++  +    I R   C N +GA+L S+  
Sbjct: 680 GRLDKTLFIELPNFQEKLDIINTITKVNGTPLDDSVNLSEIIRDDRCKNFSGADLASLVR 739

Query: 433 EAGMFAIR 440
           E+ + A++
Sbjct: 740 ESSVLALK 747

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 133/233 (57%), Gaps = 6/233 (2%)

Query: 212 PDVTYSDVGGCKEQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 271
           P    S++GG  + I +L E++ LP+L PE + + G++PP+G+LL+GPPG GKT  A A+
Sbjct: 189 PTSLLSNLGGMDDVIAQLMELIGLPILHPEIYISTGVEPPRGVLLHGPPGCGKTSIANAL 248

Query: 272 ANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEVXXXXXXXXXXXX 331
           A      FI +    +V    GE  + +RELF+ A++   C++FFDE+            
Sbjct: 249 AGELQVPFISISAPSVVSGMSGESEKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQ 308

Query: 332 XXXNEVQRTMLELITQLD--GFDPRGN--IKVMFATNRPNTLDPALLRPGRIDRKVEFSL 387
                 +R + +L+T +D    +  G   + V+ ATNRP++LD AL R GR DR++  ++
Sbjct: 309 REME--RRIVAQLLTAMDELSMEKTGGKPVIVIGATNRPDSLDAALRRAGRFDREICLNV 366

Query: 388 PDLEGRANIFRIHTKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIR 440
           P+   R +I +  ++ + ++  I +  +++L P   GA+L+++ T AG  AI+
Sbjct: 367 PNEVSRLHILKKMSEHLKIKGEIDYLKLAKLTPGFVGADLKALVTAAGTCAIK 419

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,542,727
Number of extensions: 1924635
Number of successful extensions: 8929
Number of sequences better than 10.0: 555
Number of HSP's gapped: 8487
Number of HSP's successfully gapped: 660
Length of query: 475
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 362
Effective length of database: 40,524,141
Effective search space: 14669739042
Effective search space used: 14669739042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)