Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR022W6.5ON75475436980.0
Ecym_30076.5ON76970323340.0
KLLA0D00748g6.5ON78964322930.0
SAKL0E00748g6.5ON77459822830.0
Kwal_56.223296.5ON77665122560.0
KLTH0C11616g6.5ON74059622240.0
TDEL0G046606.5ON73960620800.0
Suva_16.356.5ON76762320590.0
YPL270W (MDL2)6.5ON77360320410.0
Skud_16.76.5ON77361120410.0
Smik_6.4786.5ON77360320390.0
Kpol_1045.836.5ON74859120280.0
CAGL0A01133g6.5ON80162620220.0
NCAS0D022106.5ON77362320170.0
NDAI0I027306.5ON83262120160.0
TBLA0A071906.5ON79460720060.0
TPHA0J002206.5ON74062119920.0
ZYRO0F00396g6.5ON73264519900.0
KNAG0E028006.5ON74161819160.0
KAFR0B064806.5ON75160517450.0
TPHA0B046201.67ON72065314050.0
TDEL0C063501.67ON69360213930.0
Ecym_10721.67ON68360613731e-180
Kpol_2000.791.67ON70762713711e-180
NDAI0A005601.67ON71461013591e-178
KLLA0C01991g1.67ON70660513541e-177
YLR188W (MDL1)1.67ON69562213521e-177
ZYRO0F17050g1.67ON71460313531e-177
SAKL0C02244g1.67ON71263713521e-177
NCAS0B087001.67ON71560913471e-176
Skud_12.2531.67ON69262113311e-174
Smik_12.2481.67ON69663013251e-173
AFR683C1.67ON67763913131e-171
Suva_10.2841.67ON69360513001e-169
Kwal_33.133081.67ON70662812931e-168
KLTH0F02024g1.67ON73462712901e-167
CAGL0E00385g1.67ON60860612591e-164
TBLA0A053001.67ON70761612551e-162
TBLA0B100701.527ON12965155504e-58
SAKL0A10208g1.527ON13105515372e-56
YKL209C (STE6)1.527ON12905225363e-56
TDEL0F003401.527ON12575235354e-56
SAKL0H00968g5.20ON7004585164e-55
Kpol_1018.1851.527ON12765245231e-54
Suva_11.111.527ON12905255176e-54
Skud_11.111.527ON12955215161e-53
AFR432W1.527ON12844985151e-53
KNAG0G001901.527ON12755155132e-53
ZYRO0G02244g1.527ON12735075062e-52
Kwal_26.94805.20ON7195034929e-52
TPHA0O001601.527ON12535084945e-51
KNAG0E013205.20ON6954544849e-51
NDAI0D015401.527ON12935184911e-50
Smik_13.5185.20ON6874324775e-50
KLTH0B09482g5.20ON6944594751e-49
Suva_13.4915.20ON6934424732e-49
Skud_13.4755.20ON6914244732e-49
KAFR0E002301.527ON12705184813e-49
YMR301C (ATM1)5.20ON6904244723e-49
KLLA0A10131g5.20ON7204544691e-48
AGL335W5.20ON6914524662e-48
Smik_11.141.527ON13165194742e-48
Ecym_36121.527ON13155164715e-48
NCAS0D024305.20ON7024564635e-48
KLTH0B01100g1.527ON12985174681e-47
NCAS0G035101.527ON12885094652e-47
KAFR0I025805.20ON7094564582e-47
Ecym_56495.20ON6964544573e-47
CAGL0M13739g5.20ON7274564575e-47
CAGL0K00363g1.527ON12275104635e-47
TPHA0L022705.20ON7113904541e-46
KLLA0B14256g1.527ON12715184601e-46
TDEL0G004305.20ON6964564493e-46
TBLA0C070005.20ON7253624461e-45
ZYRO0D07106g5.20ON7094594423e-45
Kpol_513.235.20ON7083724414e-45
NDAI0I024405.20ON7304604399e-45
Kwal_33.155611.527ON12975164449e-45
Ecym_42658.303ON15054994031e-39
TDEL0E056104.52ON15355303898e-38
NDAI0J011508.303ON15174963871e-37
KNAG0E011204.6ON17175463843e-37
NDAI0B006405.10ON14915303843e-37
CAGL0G00242g5.10ON14775343763e-36
KNAG0I009908.303ON15354913754e-36
YHL035C (VMR1)4.6ON15925243755e-36
ZYRO0G07612g4.6ON16955113721e-35
Suva_2.2978.303ON15164933692e-35
NCAS0E041605.10ON15065133674e-35
Kpol_1060.75.10ON14605323665e-35
Skud_4.3958.303ON15164933665e-35
AGR047W8.303ON14925043656e-35
Kpol_311.34.6ON16574923657e-35
ZYRO0G22176g4.52ON15705033631e-34
KNAG0K001705.10ON14425283631e-34
SAKL0H00704g5.10ON14395133622e-34
NCAS0B034708.303ON15124913622e-34
CAGL0E03982g4.6ON16595203613e-34
YDR135C (YCF1)8.303ON15154933603e-34
CAGL0C03289g4.6ON16485093603e-34
NCAS0J00160singletonON16544923603e-34
KAFR0B056308.303ON15154963603e-34
KAFR0C065105.10ON14575153594e-34
CAGL0E03355g4.52ON15355283594e-34
Suva_10.234.6ON16615163586e-34
TPHA0A056205.10ON14775133576e-34
TDEL0G018504.6ON16424873578e-34
SAKL0H16016g8.303ON14994913551e-33
Suva_8.164.6ON15995183551e-33
KNAG0J027304.52ON15375203541e-33
Suva_7.5775.10ON14785463542e-33
CAGL0L06402g8.303ON15354963542e-33
KLLA0F20075g8.303ON15164903532e-33
SAKL0H26026g4.6ON16535023532e-33
Smik_4.3808.303ON15164723523e-33
Kwal_34.157704.6ON14365193523e-33
KLTH0H16038g4.6ON16495263514e-33
KAFR0I013004.52ON15365103505e-33
KLLA0E00529g4.6ON16505293505e-33
Skud_7.6145.10ON14775423496e-33
Smik_12.484.52ON15575113488e-33
TPHA0F001804.6ON16464883461e-32
Smik_8.64.6ON15855083462e-32
NCAS0C059304.6ON16575363462e-32
TPHA0K023104.6ON16494883452e-32
Ecym_84184.6ON16784953442e-32
KLTH0C09240gna 1ON15465273434e-32
TBLA0G007104.6ON16914963434e-32
NDAI0H001904.6ON16825313425e-32
YLL048C (YBT1)4.6ON16615223425e-32
YGR281W (YOR1)5.10ON14775423415e-32
Smik_16.275.10ON14775363416e-32
KAFR0L001904.6ON16534993417e-32
TPHA0F004104.52ON15705183399e-32
TPHA0C009608.303ON15234993399e-32
KLTH0G12716g8.303ON15005143399e-32
Skud_12.224.6ON16615233391e-31
Smik_12.114.6ON16615223372e-31
Kwal_56.238448.303ON14944923372e-31
Kpol_1033.288.303ON15315153344e-31
Kwal_56.22747na 1ON15384993344e-31
TDEL0F043008.303ON15144893311e-30
KLTH0B09724g5.10ON14865323301e-30
Suva_10.594.52ON15615243282e-30
ZYRO0D06160g8.303ON15254773282e-30
Suva_10.60singletonON9905403253e-30
Skud_8.94.6ON15875073264e-30
Skud_12.524.52ON15615193264e-30
KLLA0C14234g5.10ON14545323255e-30
TDEL0G003305.10ON14655313202e-29
KLTH0B00396gsingletonON15075173193e-29
Smik_11.367na 2ON15955363193e-29
Skud_18.2singletonON15805353183e-29
TBLA0C071005.10ON14855353158e-29
ACL072C4.6ON16274893159e-29
Kwal_26.95325.10ON14715223042e-27
Zrou_YGOB_Anc_5.105.10ON9925393013e-27
KLLA0D04059g4.52ON15684903023e-27
TBLA0A06840singletonON10582672996e-27
YKR104WsingletonON3062652828e-27
TBLA0C06400singletonON13775192952e-26
YLL015W (BPT1)4.52ON15595162891e-25
SAKL0H23958g4.52ON15585242845e-25
Kpol_YGOB_1041.454.52ON15682642801e-24
Kpol_1041.45singletonOFF15962642792e-24
AGL346W5.10ON14005152792e-24
TBLA0A038008.303ON15464602569e-22
Ecym_56605.10ON15363732112e-16
YKR103W (NFT1)na 2ON12182412041e-15
SAKL0H21010gsingletonON14472451891e-13
Kwal_26.87308.661ON8312131833e-13
Kpol_175.1singletonON13772071809e-13
TDEL0B057601.427ON10362631791e-12
ACR128C8.661ON8271971781e-12
KNAG0I005301.427ON10472441782e-12
KLTH0D10890g8.661ON8302521744e-12
ZYRO0E04092g1.427ON10622431736e-12
KAFR0A037908.661ON8762031727e-12
ZYRO0B05588g3.133ON12702251737e-12
SAKL0D10208g1.366ON7522361692e-11
TPHA0D011708.661ON9152031664e-11
Kpol_1049.234.6ON110941504e-11
ABR125C3.220ON14882641664e-11
ZYRO0B14762gsingletonON15152351655e-11
Kwal_0.3271.427ON10192191648e-11
AGL142CsingletonON14972441631e-10
Ecym_24108.661ON8282061621e-10
YPL147W (PXA1)8.661ON8702011621e-10
Ecym_36043.220ON14742281612e-10
NCAS0B015308.661ON8682011602e-10
KLLA0D04554g1.427ON10222241602e-10
Kpol_1053.483.133ON12882301602e-10
CAGL0K10472g1.366ON7522111602e-10
AER190W1.427ON10112431602e-10
Smik_6.3448.661ON8702011602e-10
TPHA0O010001.427ON10113191593e-10
ZYRO0D11880g5.500ON14982391593e-10
NDAI0E012408.661ON8972051583e-10
KAFR0C012003.133ON12732281584e-10
TBLA0D043501.427ON11192451584e-10
TBLA0D017805.500ON15952021584e-10
Suva_16.1638.661ON8702011575e-10
KAFR0C052205.500ON14992491585e-10
ZYRO0F07018g8.661ON8612351575e-10
Kpol_1050.161.427ON10472771575e-10
KNAG0K009503.133ON12842201576e-10
TBLA0D01820singletonON15512001576e-10
ZYRO0A04114g3.220ON15182091566e-10
NCAS0A085701.427ON10602491566e-10
YOL075C3.133ON12942371567e-10
NDAI0G050201.427ON10972881567e-10
Skud_16.1358.661ON8702011557e-10
KLTH0H13442g1.366ON7522451549e-10
CAGL0L07744g1.427ON10552431551e-09
KNAG0A029808.661ON8711971541e-09
AEL032W1.366ON7532401541e-09
Kwal_23.51613.220ON14892351541e-09
Suva_15.913.133ON13022371541e-09
YNR070W (PDR18)na 3ON13332391531e-09
Kpol_1012.108.661ON8551531531e-09
KNAG0B038705.500ON15132001532e-09
Smik_3.971.427ON10493211522e-09
Skud_14.404na 3ON14242061522e-09
Smik_14.399na 3ON14212051522e-09
NCAS0B053003.133ON12732381513e-09
Kwal_27.9666singletonON14742811513e-09
SAKL0H06908g8.661ON8361881503e-09
KLLA0F11484g8.661ON8451951503e-09
KAFR0C05210na 4ON14932211504e-09
KAFR0C00820na 5ON15172381504e-09
TDEL0A060708.661ON8721881494e-09
Skud_4.2623.220ON15012381494e-09
KLTH0H12760g1.427ON10202411486e-09
Smik_15.843.133ON12952481486e-09
YDR011W (SNQ2)3.220ON15012411486e-09
Kpol_1037.473.220ON15072521486e-09
Smik_7.3131.366ON7522111477e-09
KAFR0E034405.500ON15492351478e-09
KNAG0G010407.123aON14012661478e-09
SAKL0C11616g3.220ON14842451478e-09
TBLA0C017808.661ON8881911478e-09
NCAS0A120605.500ON15432361479e-09
KAFR0F014601.427ON10572351479e-09
KLTH0A01914g3.220ON14992311479e-09
NCAS0E016303.220ON15652461479e-09
NDAI0H035701.366ON7552101461e-08
KNAG0C019601.366ON7522411451e-08
YFR009W (GCN20)1.366ON7522111451e-08
ZYRO0G01144g1.366ON7522111451e-08
Smik_4.2443.220ON15012411461e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR022W
         (754 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...  1429   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   903   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   887   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   884   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   873   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   861   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   805   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   797   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   790   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   790   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   790   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   785   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   783   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      781   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   781   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   777   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   771   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   771   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   742   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   676   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   545   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   541   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   533   e-180
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   532   e-180
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   528   e-178
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   526   e-177
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   525   e-177
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   525   e-177
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   525   e-177
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   523   e-176
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   517   e-174
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   514   e-173
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   510   e-171
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   505   e-169
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   502   e-168
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   501   e-167
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   489   e-164
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   488   e-162
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   216   4e-58
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   211   2e-56
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   211   3e-56
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   210   4e-56
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   203   4e-55
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   206   1e-54
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   203   6e-54
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   203   1e-53
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   202   1e-53
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   202   2e-53
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   199   2e-52
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   194   9e-52
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   194   5e-51
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   191   9e-51
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   193   1e-50
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   188   5e-50
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   187   1e-49
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   186   2e-49
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   186   2e-49
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   189   3e-49
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   186   3e-49
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   185   1e-48
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   184   2e-48
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   187   2e-48
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   186   5e-48
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     182   5e-48
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   184   1e-47
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   183   2e-47
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   181   2e-47
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   180   3e-47
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   180   5e-47
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   182   5e-47
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   179   1e-46
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   181   1e-46
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   177   3e-46
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   176   1e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   174   3e-45
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   174   4e-45
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   173   9e-45
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   175   9e-45
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   159   1e-39
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   154   8e-38
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   153   1e-37
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   152   3e-37
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    152   3e-37
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   149   3e-36
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   149   4e-36
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   149   5e-36
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   147   1e-35
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   146   2e-35
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    145   4e-35
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   145   5e-35
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   145   5e-35
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   145   6e-35
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   145   7e-35
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   144   1e-34
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   144   1e-34
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   144   2e-34
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   144   2e-34
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   143   3e-34
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   143   3e-34
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   143   3e-34
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   143   3e-34
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   143   3e-34
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   142   4e-34
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   142   4e-34
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   142   6e-34
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   142   6e-34
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   142   8e-34
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   141   1e-33
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   141   1e-33
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   140   1e-33
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   140   2e-33
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   140   2e-33
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   140   2e-33
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   140   2e-33
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   140   3e-33
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   140   3e-33
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   139   4e-33
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   139   5e-33
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   139   5e-33
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   139   6e-33
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   138   8e-33
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   137   1e-32
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   137   2e-32
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   137   2e-32
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   137   2e-32
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   137   2e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   136   4e-32
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   136   4e-32
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   136   5e-32
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   136   5e-32
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   135   5e-32
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   135   6e-32
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   135   7e-32
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   135   9e-32
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   135   9e-32
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   135   9e-32
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   135   1e-31
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   134   2e-31
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   134   2e-31
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   133   4e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   133   4e-31
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   132   1e-30
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   131   1e-30
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   130   2e-30
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   130   2e-30
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   129   3e-30
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   130   4e-30
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   130   4e-30
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   129   5e-30
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   127   2e-29
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   127   3e-29
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   127   3e-29
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   127   3e-29
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           125   8e-29
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   125   9e-29
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   121   2e-27
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   120   3e-27
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   120   3e-27
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   119   6e-27
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   113   8e-27
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   118   2e-26
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   115   1e-25
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   114   5e-25
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   112   1e-24
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   112   2e-24
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   112   2e-24
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   103   9e-22
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    86   2e-16
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    83   1e-15
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    77   1e-13
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    75   3e-13
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    74   9e-13
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    74   1e-12
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    73   1e-12
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    73   2e-12
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    72   4e-12
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    71   6e-12
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    71   7e-12
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    71   7e-12
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    70   2e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    69   4e-11
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    62   4e-11
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    69   4e-11
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    68   5e-11
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    68   8e-11
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    67   1e-10
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    67   1e-10
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    67   1e-10
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    67   2e-10
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    66   2e-10
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    66   2e-10
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    66   2e-10
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    66   2e-10
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    66   2e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    66   2e-10
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    66   3e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    66   3e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     65   3e-10
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    65   4e-10
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    65   4e-10
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    65   4e-10
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    65   5e-10
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    65   5e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    65   5e-10
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    65   5e-10
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    65   6e-10
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              65   6e-10
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    65   6e-10
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    65   6e-10
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    65   7e-10
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    65   7e-10
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    64   7e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    64   9e-10
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    64   1e-09
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    64   1e-09
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    64   1e-09
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    64   1e-09
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    64   1e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    64   1e-09
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    64   1e-09
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    64   2e-09
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    63   2e-09
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    63   2e-09
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    63   2e-09
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    63   3e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    63   3e-09
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    62   3e-09
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    62   3e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            62   4e-09
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              62   4e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    62   4e-09
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    62   4e-09
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    62   6e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    62   6e-09
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    62   6e-09
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    62   6e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    61   7e-09
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    61   8e-09
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     61   8e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    61   8e-09
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    61   8e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    61   9e-09
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    61   9e-09
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    61   9e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    61   9e-09
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    61   1e-08
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    60   1e-08
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    60   1e-08
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    60   1e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    61   1e-08
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    61   1e-08
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    60   1e-08
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    61   1e-08
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    61   1e-08
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    60   1e-08
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    60   1e-08
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    60   2e-08
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            60   2e-08
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    60   2e-08
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    60   2e-08
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    60   2e-08
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    60   2e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    60   2e-08
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    60   2e-08
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    59   2e-08
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    60   2e-08
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    60   3e-08
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    59   3e-08
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    59   4e-08
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    59   4e-08
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    59   4e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    59   4e-08
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    59   4e-08
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    59   4e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   4e-08
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    59   5e-08
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    59   5e-08
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    59   5e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    59   5e-08
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    58   5e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    59   5e-08
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    59   6e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    59   6e-08
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    58   7e-08
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    58   8e-08
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    58   8e-08
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    56   8e-08
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    58   9e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    58   9e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    58   9e-08
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    58   1e-07
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    57   1e-07
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    56   1e-07
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    58   1e-07
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    58   1e-07
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    58   1e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    58   1e-07
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    57   1e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    57   1e-07
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    57   1e-07
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    57   1e-07
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    57   1e-07
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    57   1e-07
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    57   2e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    57   2e-07
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    57   2e-07
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    57   2e-07
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    57   2e-07
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    57   2e-07
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    57   2e-07
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    57   2e-07
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    57   2e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    57   2e-07
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    57   2e-07
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    56   2e-07
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                57   2e-07
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    57   2e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    57   2e-07
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    56   3e-07
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    56   3e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    56   3e-07
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     56   3e-07
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    56   3e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    56   3e-07
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    56   4e-07
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    56   4e-07
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    55   4e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    56   4e-07
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    55   4e-07
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    55   5e-07
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    54   5e-07
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    55   5e-07
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 55   6e-07
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    55   6e-07
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    55   7e-07
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    54   8e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   8e-07
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    54   8e-07
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    55   9e-07
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    55   9e-07
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    55   9e-07
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    55   1e-06
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    54   1e-06
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             54   1e-06
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    54   1e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    54   1e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    54   1e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    54   2e-06
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    54   2e-06
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       53   2e-06
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    53   2e-06
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    54   2e-06
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    53   2e-06
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              53   3e-06
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    52   3e-06
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    52   3e-06
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    53   3e-06
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    52   4e-06
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    52   4e-06
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    51   5e-06
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    52   5e-06
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    52   6e-06
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    52   6e-06
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    52   7e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    52   7e-06
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    52   7e-06
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    52   7e-06
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    50   8e-06
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    52   8e-06
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    51   9e-06
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    51   1e-05
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    50   3e-05
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    50   3e-05
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    50   3e-05
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    49   3e-05
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    50   3e-05
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    50   3e-05
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    49   4e-05
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    49   4e-05
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    49   4e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    49   5e-05
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    49   5e-05
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    47   6e-05
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    48   6e-05
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              49   6e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    49   6e-05
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    49   6e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    49   7e-05
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    49   7e-05
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    48   7e-05
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    48   8e-05
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    48   8e-05
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    48   8e-05
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    48   8e-05
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    47   9e-05
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    47   1e-04
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    47   1e-04
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    48   1e-04
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    47   1e-04
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    48   1e-04
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    48   1e-04
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    47   1e-04
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    47   1e-04
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    47   2e-04
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    47   2e-04
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    47   2e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    47   2e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    47   2e-04
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    47   2e-04
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    47   2e-04
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    46   2e-04
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    47   2e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    46   2e-04
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    45   3e-04
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    46   3e-04
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    45   3e-04
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    46   3e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    46   4e-04
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    45   4e-04
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    45   5e-04
TPHA0L00810 Chr12 (157823..161944) [4122 bp, 1373 aa] {ON}             45   5e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    45   6e-04
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    45   6e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    45   6e-04
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    45   7e-04
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   7e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    45   7e-04
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    45   8e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    45   0.001
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    45   0.001
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    44   0.001
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.001
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.001
NDAI0A08370 Chr1 complement(1924865..1929079) [4215 bp, 1404 aa]...    44   0.001
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.001
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    44   0.002
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    44   0.002
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    44   0.002
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    44   0.002
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    42   0.003
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    43   0.003
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    43   0.004
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    43   0.004
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    43   0.004
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    42   0.004
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.004
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    43   0.004
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    43   0.004
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    42   0.004
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    42   0.004
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    42   0.004
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    42   0.005
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    42   0.005
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    42   0.005
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    42   0.006
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     42   0.006
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    42   0.006
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.006
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    42   0.006
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    41   0.007
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    42   0.008
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    42   0.008
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    42   0.008
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    42   0.008
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    42   0.009
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.009
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    42   0.009
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.009
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    42   0.009
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    41   0.010
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    41   0.010
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    41   0.010
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    41   0.011
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.013
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    41   0.014
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    41   0.015
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    41   0.016
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    40   0.017
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    40   0.017
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.017
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    40   0.018
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    40   0.018
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    40   0.018
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    40   0.020
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    40   0.021
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    40   0.024
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    40   0.025
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    40   0.025
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    40   0.025
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    40   0.027
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    40   0.031
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    40   0.034
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    39   0.048
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    39   0.056
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    39   0.069
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    39   0.070
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    38   0.073
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    38   0.074
Kpol_364.12 s364 (26116..27537) [1422 bp, 473 aa] {ON} (26116..2...    38   0.089
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    37   0.13 
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    37   0.17 
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          37   0.17 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.17 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    37   0.17 
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    37   0.19 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    37   0.20 
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    37   0.21 
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    37   0.22 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    37   0.23 
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    36   0.24 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    37   0.25 
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    37   0.27 
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    36   0.33 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    36   0.40 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    36   0.49 
NDAI0F03620 Chr6 complement(863262..865103) [1842 bp, 613 aa] {O...    35   0.71 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    35   0.88 
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    35   0.90 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    35   0.97 
NDAI0H03900 Chr8 complement(958233..960074) [1842 bp, 613 aa] {O...    35   1.1  
Smik_14.123 Chr14 (231361..233202) [1842 bp, 613 aa] {ON} YNL209...    35   1.1  
YDL229W Chr4 (44065..45906) [1842 bp, 613 aa] {ON}  SSB1Cytoplas...    35   1.1  
YNL209W Chr14 (252059..253900) [1842 bp, 613 aa] {ON}  SSB2Cytop...    35   1.1  
Smik_4.12 Chr4 (22024..23865) [1842 bp, 613 aa] {ON} YDL229W (REAL)    35   1.1  
KAFR0F00250 Chr6 (63745..65586) [1842 bp, 613 aa] {ON} Anc_2.41 ...    35   1.1  
NDAI0F01880 Chr6 complement(456673..458262) [1590 bp, 529 aa] {O...    34   1.1  
KAFR0A07780 Chr1 complement(1562827..1564668) [1842 bp, 613 aa] ...    34   1.2  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    34   1.6  
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...    34   1.7  
KLTH0H06380g Chr8 (559500..561026) [1527 bp, 508 aa] {ON} simila...    34   1.8  
Suva_4.15 Chr4 (31720..33561) [1842 bp, 613 aa] {ON} YDL229W (REAL)    34   1.9  
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    33   2.2  
KNAG0F01040 Chr6 (185450..187291) [1842 bp, 613 aa] {ON} Anc_2.4...    33   2.2  
Suva_41.1 Chr41 (1..1137) [1137 bp, 379 aa] {ON} YDL229W (REAL)        33   2.3  
Skud_14.127 Chr14 (240885..242726) [1842 bp, 613 aa] {ON} YNL209...    33   2.4  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    33   2.7  
Kwal_14.1761 s14 (457092..458609) [1518 bp, 505 aa] {ON} YBR227C...    33   2.9  
Skud_4.25 Chr4 (41208..43049) [1842 bp, 613 aa] {ON} YNL209W (REAL)    33   2.9  
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    33   3.1  
Suva_14.134 Chr14 (246967..248271) [1305 bp, 434 aa] {ON} YNL209...    33   3.2  
NCAS0H01380 Chr8 (263394..264977) [1584 bp, 527 aa] {ON} Anc_6.1...    33   3.3  
KLLA0D19041g Chr4 complement(1600915..1602756) [1842 bp, 613 aa]...    33   3.7  
TDEL0G03460 Chr7 (638931..640466) [1536 bp, 511 aa] {ON} Anc_6.1...    32   4.5  
CAGL0K04741g Chr11 complement(463860..465701) [1842 bp, 613 aa] ...    32   4.8  
CAGL0C05379g Chr3 complement(512277..514118) [1842 bp, 613 aa] {...    32   4.8  
NCAS0G01560 Chr7 (278345..280186) [1842 bp, 613 aa] {ON} Anc_2.41      32   4.9  
TPHA0P01620 Chr16 complement(335482..337323) [1842 bp, 613 aa] {...    32   5.1  
KLTH0B07744g Chr2 complement(628224..630065) [1842 bp, 613 aa] {...    32   5.8  
NCAS0D00240 Chr4 (27261..29102) [1842 bp, 613 aa] {ON} Anc_2.41        32   6.9  
Kpol_1054.33 s1054 complement(83386..85227) [1842 bp, 613 aa] {O...    32   7.3  
Kpol_1014.35 s1014 complement(65303..67144) [1842 bp, 613 aa] {O...    32   7.3  
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    32   7.4  
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    32   7.5  
Ecym_6457 Chr6 (886260..888101) [1842 bp, 613 aa] {ON} similar t...    32   8.1  
TPHA0O01770 Chr15 complement(356732..358573) [1842 bp, 613 aa] {...    32   8.4  

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score = 1429 bits (3698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/754 (93%), Positives = 703/754 (93%)

Query: 1   MWRAIRPFGGLGPVAVLQRLPGPRHNVAVRLQVMSRARCGWQCVRATSRLTVPVCRQSRA 60
           MWRAIRPFGGLGPVAVLQRLPGPRHNVAVRLQVMSRARCGWQCVRATSRLTVPVCRQSRA
Sbjct: 1   MWRAIRPFGGLGPVAVLQRLPGPRHNVAVRLQVMSRARCGWQCVRATSRLTVPVCRQSRA 60

Query: 61  YSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXX 120
           YSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWK  
Sbjct: 61  YSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKLL 120

Query: 121 XXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXX 180
                  TISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFT   
Sbjct: 121 LAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVD 180

Query: 181 XXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLIS 240
                          NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLIS
Sbjct: 181 VLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLIS 240

Query: 241 RLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG 300
           RLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG
Sbjct: 241 RLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG 300

Query: 301 KRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGI 360
           KRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGI
Sbjct: 301 KRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGI 360

Query: 361 TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYS 420
           TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYS
Sbjct: 361 TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYS 420

Query: 421 ELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRL 480
           ELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRL
Sbjct: 421 ELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRL 480

Query: 481 TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
           TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ
Sbjct: 481 TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540

Query: 541 EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
           EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG
Sbjct: 541 EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600

Query: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
           QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI
Sbjct: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660

Query: 661 RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHXXXXXXXXXXXXXXXXXXXXX 720
           RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH                     
Sbjct: 661 RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHASEPAKPEASPAPAQEEASAP 720

Query: 721 XXXDIPRDIEGGNLRLNEEVIKHVLEDTARAPMP 754
              DIPRDIEGGNLRLNEEVIKHVLEDTARAPMP
Sbjct: 721 QAADIPRDIEGGNLRLNEEVIKHVLEDTARAPMP 754

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  903 bits (2334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/703 (64%), Positives = 533/703 (75%), Gaps = 38/703 (5%)

Query: 11  LGPVAVLQRLPGPRHNVAVRLQVMSRARCGWQCVRATSRLTVPVCRQSRAYSAARVGGEG 70
           L P AV  + P  R+NV++ L V+ R               V + R  R YS+       
Sbjct: 28  LAPAAVSIQAP-RRYNVSL-LAVIERRE-------------VVIYRPKRGYSSL------ 66

Query: 71  TPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTIS 130
             S   K+++   +   +    ++ Q     GW EV RL  L K DWK         ++S
Sbjct: 67  --SKTKKDNDGNGRGLLKDDNDTQVQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVS 124

Query: 131 CSIGMAVPKVIGLVLDATK--------------DAVAQAEKNETGAPMSLLD-MPSIIGN 175
           C+IGMAVPKVIGLVLDATK              + V + +++    P++ LD +P I+G 
Sbjct: 125 CTIGMAVPKVIGLVLDATKNTLKSSYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGT 184

Query: 176 FTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKV 235
            +                  NFGR+ LLK++GERLV+RLR+QVIK+T+HHD EFFDRNKV
Sbjct: 185 LSITQFVGIFAGALVVGATANFGRVVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKV 244

Query: 236 GDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA 295
           GDLISR GSDAY+VSRSMT N+SDG KA +CGGVG+GMMFHISSTLTS M++FAPPLL+ 
Sbjct: 245 GDLISRFGSDAYVVSRSMTQNVSDGFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVG 304

Query: 296 ATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVA 355
           A IYGK+I AISR+LQQS+GNLTRV+EEQ NGI+TIKSFVAE KE+RRYN A+R+LF V 
Sbjct: 305 AFIYGKKISAISRQLQQSSGNLTRVAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVG 364

Query: 356 KREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415
           KRE  T+ATFFS T +LGD+SF++VL YG++LVLQG LS+G LTAFMLYTEYTGSSVFGL
Sbjct: 365 KREAFTNATFFSSTTILGDMSFVIVLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGL 424

Query: 416 SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIF 475
           S FYSELMKGAGAASRLFEL D+K SV S +     P  G+IEF+DVSFSYPTRP++QIF
Sbjct: 425 STFYSELMKGAGAASRLFELMDHKNSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIF 484

Query: 476 KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535
           K +  TI PGSNVCIVGPSG+GKSTI SLLLRFYD N G+ILID  DISK + KSLR+HL
Sbjct: 485 KHMSFTIEPGSNVCIVGPSGKGKSTITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHL 544

Query: 536 GVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595
           GVVQQEP LMSGTIRDNITYGLSYTP+MDEIR V+K+CFCH FITKFPDGYDTVIGPRGA
Sbjct: 545 GVVQQEPTLMSGTIRDNITYGLSYTPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGA 604

Query: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
            LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG LMRSKE+TI+SIAH
Sbjct: 605 SLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGTLMRSKELTIISIAH 664

Query: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           RLSTIRRSENI+V+GNDGSV+E GKF  LYR+E+SELFKLLNE
Sbjct: 665 RLSTIRRSENIIVVGNDGSVVEVGKFDKLYRNEESELFKLLNE 707

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/643 (68%), Positives = 517/643 (80%), Gaps = 16/643 (2%)

Query: 63  AARVGGEGTPSPRDKEHEQERKV-EKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXX 121
           A+ VGG G      K  E E K  +K+  +PS        G  +V RL  L + DWK   
Sbjct: 80  ASDVGGNG------KHQEGEDKTPDKKTNKPS---STVSGGLADVKRLFYLARHDWKMLV 130

Query: 122 XXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKN------ETGAPMSLLDMPSIIGN 175
                 T+SC+IGMAVPKVIGLVLDATK+A++ +  N      E    ++L D+P I+G+
Sbjct: 131 LAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNGGLEDSKSLTLDDLPPIVGD 190

Query: 176 FTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKV 235
                               NFGR+ LLK+LGERLVARLR+ VIKKT+HHD EF+DRNKV
Sbjct: 191 IQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRSNVIKKTMHHDMEFYDRNKV 250

Query: 236 GDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA 295
           GDL+SRLG+DAYIVSRSMT NISDG KA +CGGVG+GMMFHISSTL S + +FAPPLL+ 
Sbjct: 251 GDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHISSTLASVLFLFAPPLLVG 310

Query: 296 ATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVA 355
           ATIYG +IRAISRELQQ++GNLT+V+EEQ +GIKT++SFVAEGKE+ RYN AVR++FNV 
Sbjct: 311 ATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVG 370

Query: 356 KREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415
           K+E  T+ATFFS TNVLGD SFLLVLAYGSHLVLQG L++G LTAFMLYTEYTGS+VFGL
Sbjct: 371 KKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGL 430

Query: 416 SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIF 475
           S FYSELMKGAGAA+RLFEL DYK ++ ST G+ F P +G++EF+ VSFSYPTR T+QIF
Sbjct: 431 STFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVEFQHVSFSYPTRKTNQIF 490

Query: 476 KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535
           K L  TI PGSNVCIVGPSGRGKSTIASLLLR+Y+  SG IL+DGQDI+K+S+KSLR+ L
Sbjct: 491 KDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILVDGQDITKLSSKSLRRQL 550

Query: 536 GVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595
           GVVQQEP+LMSGTIR+NITYG+S  PSM+EIR+VAKKCFCH FI+KFP+GY+T+IGPRGA
Sbjct: 551 GVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAFISKFPNGYETIIGPRGA 610

Query: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
           LLSGGQ+QRIAIARAL+ KPKILILDEATSALDVESEGAINYTLGRLM+SKE+TI+SIAH
Sbjct: 611 LLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRLMKSKELTIISIAH 670

Query: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           RLSTIRRSEN++VLG DGSV+E GKF DLY + DS L KLL E
Sbjct: 671 RLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTE 713

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/598 (70%), Positives = 503/598 (84%), Gaps = 5/598 (0%)

Query: 101 AGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNET 160
           AG+ E+FRL RL + DWK         TISCSIGMAVPKVIG+VLD  K+A+   EK   
Sbjct: 122 AGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEK--- 178

Query: 161 GAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIK 220
             P  L D+P ++                      NFGR+ LL++LGE+LVARLR+ VIK
Sbjct: 179 --PKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIK 236

Query: 221 KTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISST 280
           KT+H DAEFFDRNKVGDLISRL SDAY+VSRSMT NISDG KA +CGGVG+GMMFHISST
Sbjct: 237 KTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISST 296

Query: 281 LTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKE 340
           L +A+ +FAPPLL+ ATIYG++IR+ISR+LQQSTGNLT+V+EEQ +G+KT++SFVAE KE
Sbjct: 297 LATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKE 356

Query: 341 MRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTA 400
           ++RYN A+R++F+V KRE +T+ATFFS T+VLGD SFL+VLAYGSHLVLQG LS+G LTA
Sbjct: 357 IKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTA 416

Query: 401 FMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFK 460
           FMLYTEY+GS+VFGLSNFYSELMKGAGAASRLFELTD++ S+ +T G  +VP  G I+F+
Sbjct: 417 FMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFE 476

Query: 461 DVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG 520
           +VSFSYPTR  +QIF  L  TI  GSNVC+VGPSGRGKSTIASLLL++Y+  SG I IDG
Sbjct: 477 NVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDG 536

Query: 521 QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT 580
           QDISK+SAKSLR+HLGVVQQEP+LMSG+IRDNITYG+ YTP++DEIR+V+KKCFCHNFIT
Sbjct: 537 QDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFIT 596

Query: 581 KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 640
           KF DGY+TVIGP+GALLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYTLG
Sbjct: 597 KFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLG 656

Query: 641 RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           +LM+S++ITI+SIAHRLSTIRRSEN++VLG+DGSV+E GKF +LY  ++S+L+KLLNE
Sbjct: 657 QLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE 714

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/651 (66%), Positives = 518/651 (79%), Gaps = 15/651 (2%)

Query: 49  RLTVPVCRQ-SRAYSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVF 107
           RL+VP   Q +R YS   V  +   +P DKE ++   +E         + +   G+ EV 
Sbjct: 93  RLSVPRTLQLTRLYSQKTVESQAK-TPADKESQKSGTMED--------EESPNMGYKEVI 143

Query: 108 RLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLL 167
           RL +L   DWK          IS  IGM++PKVIG+VLDA K+  + A    TG P+ L 
Sbjct: 144 RLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSA----TG-PVGLD 198

Query: 168 DMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDA 227
           D+P I+ + +                  NFGR+ LL++LGE+LVARLR+ VI+K +H DA
Sbjct: 199 DLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQDA 258

Query: 228 EFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIM 287
           EFFDRNKVGDLISRL SDAY+VSRSMT N+SDG KA +CGGVG+GMM +IS +LTSA++M
Sbjct: 259 EFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALLM 318

Query: 288 FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA 347
           FAPPLLI A IYGKRIR ISR+LQ+STGNLTRVSEEQ +G+KTI+SFVAEGKE++RYNTA
Sbjct: 319 FAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNTA 378

Query: 348 VRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEY 407
           +R++F   K+E +T+ATFFS TNVLGD+SFL+VLAYGSHLVLQG L++G LTAFMLYTEY
Sbjct: 379 IRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTEY 438

Query: 408 TGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYP 467
           TGS+VFGLSNFYSELMKGAGAASRLFE+TD+  S+  T G+ +VP  G+I FKDVSFSYP
Sbjct: 439 TGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSYP 498

Query: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527
           TRP +QIF KL  TI PGSNVCIVGPSGRGKSTI SLLLR+Y+ +SG I ID QDIS++S
Sbjct: 499 TRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRLS 558

Query: 528 AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD 587
            KSLR+HLGVVQQEP+LMSG+I+ N+TYGL    SMDEIR+VAKKCFCH F+TKFP+GYD
Sbjct: 559 CKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGYD 618

Query: 588 TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647
           T+IGPRGA LSGGQ+QRIAIARAL+KKPKILILDEATSALDVESEGAINYTLG+LM+SKE
Sbjct: 619 TIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKE 678

Query: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           +TI+SIAHRLSTIRRSEN++VLGNDGSV+E GKF DLY D+ SEL+KLLN+
Sbjct: 679 LTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/596 (69%), Positives = 494/596 (82%), Gaps = 5/596 (0%)

Query: 103 WHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGA 162
           + E+ RL+RL + DWK         TIS ++GM +PKVIG+VLDA K+A           
Sbjct: 106 YREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNA-----SGGFSG 160

Query: 163 PMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKT 222
           PM+L D+P II                      NFGR+ LL++LGE+LVARLR+ VIKK 
Sbjct: 161 PMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKI 220

Query: 223 LHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLT 282
           +H DAEFFDRNKVGDLISRL SDAY+VSRSMT N+SDG KA +CGGVG+GMM +IS++LT
Sbjct: 221 IHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISASLT 280

Query: 283 SAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMR 342
           SA+ +FAPPLL+ A IYGK+IR ISRELQ+STGNLT+VSEEQ +G+KTI++FVAEGKE+ 
Sbjct: 281 SALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELH 340

Query: 343 RYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFM 402
           RYN A+R++F+  K+E +T+ATFFS T +LGD+SFL+VLAYGSHLVLQG LS+G LTAFM
Sbjct: 341 RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFM 400

Query: 403 LYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDV 462
           LYTEYTGS+VFGLSNFYSELMKGAGAASRLFE+TD+   +  + G+ +VP  G I+F+DV
Sbjct: 401 LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDV 460

Query: 463 SFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQD 522
           SFSYPTRP +QIF KL  TI PGSNVC+VGPSGRGKSTIASLLLR+YD NSG I+IDGQ+
Sbjct: 461 SFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQN 520

Query: 523 ISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF 582
           ISK+S KSLR+HLGVVQQEP+LMSG+IR N+TYG++   +MDEIR+VAKKCFCH FITKF
Sbjct: 521 ISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF 580

Query: 583 PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 642
           P+GY+TVIGPRGA LSGGQ+QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL
Sbjct: 581 PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640

Query: 643 MRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           MRS+E+TI+SIAHRLSTIRRSEN++VLGNDGSV+E GKF +LY ++ SELFKLLN+
Sbjct: 641 MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLND 696

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/606 (64%), Positives = 477/606 (78%), Gaps = 2/606 (0%)

Query: 93  SRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAV 152
           S  +  + +G  +V RLL L KPDWK         T+SC IGM +PKVIG++LD  K  +
Sbjct: 81  SPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGL 140

Query: 153 AQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVA 212
              E  +   P+S+ D+P I   ++                  N+GR+ LL++L ER+VA
Sbjct: 141 ETNEGKD--GPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVA 198

Query: 213 RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
           RLRA VIKKT+H D+EFFDR+KVGDLISRLGSDAY+VSRSMT  +SDG KA +CGGVGVG
Sbjct: 199 RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVG 258

Query: 273 MMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIK 332
           MM  IS  L+  +++F PP+L +A+I+G++IR  S +LQ++TG LTRVSEEQ +G++T++
Sbjct: 259 MMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318

Query: 333 SFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGE 392
           SFVAE KE+ RY+ A+R +FNV KR    +A FF+ T+ LGD+SFL+VLAYGS+LVLQG 
Sbjct: 319 SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG 378

Query: 393 LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452
           L++G LTAFMLYTEYTGSSVFGL++FYSELM+G GAA+RLFELTD   S+  T G+ FVP
Sbjct: 379 LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
             G I FKDV+FSYPTRP + IF+ + + I  GSNVC+VGPSGRGKSTIA LLLRFY+ +
Sbjct: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572
           SG I IDGQDISK++ KSLR+H+G+VQQEPVLMSGT+RDNITYGL+ TPS +EIR VAK+
Sbjct: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632
           CFCHNFI KFP GYDTVIGP+GALLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618

Query: 633 GAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSEL 692
           GAINYT G+LM+SK +TIVSIAHRLSTIRRSENI+VLGNDGSV+E GKF +L+ D  SEL
Sbjct: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSEL 678

Query: 693 FKLLNE 698
            KLLNE
Sbjct: 679 SKLLNE 684

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/623 (62%), Positives = 483/623 (77%), Gaps = 16/623 (2%)

Query: 82  ERKVEKRPAEPSRAQPAKPA------GWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGM 135
           ++ +   P+  +  QPAKPA       + ++ RL  L K DWK         TISCSIGM
Sbjct: 72  QQDIPPLPSTSASKQPAKPAYQSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGM 131

Query: 136 AVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXX 195
           ++PKVIG+VLD  K + + ++  +   P+  L +   +  FT                  
Sbjct: 132 SIPKVIGIVLDTLKTS-SGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVA--------- 181

Query: 196 NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
           NFGR  LL++L ER+VARLRA VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT 
Sbjct: 182 NFGRFILLRILSERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQ 241

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
            +SDGVKA +CG VGVGMM  +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG
Sbjct: 242 KVSDGVKALICGVVGVGMMCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATG 301

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
            LTRV+EEQ +GIKT++SFVAEG E+ RYN A+R +F V K    T+A FF+ T++LGD+
Sbjct: 302 QLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDL 361

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
           SFL VLAYGS+LVLQ +LS+G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFEL
Sbjct: 362 SFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFEL 421

Query: 436 TDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
           TD K S+  TVG  + P  G IEFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSG
Sbjct: 422 TDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSG 481

Query: 496 RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
           RGKSTIA LLLR+Y+  +GTI+ID QDI+K++ KSLR+H+G+VQQEPVLMSGTIRDNITY
Sbjct: 482 RGKSTIALLLLRYYNPTTGTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITY 541

Query: 556 GLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKP 615
           GL+YTP+ +EIR+VAK+CFCHNFITKFP+ YDTVIGP G LLSGGQ+QRIAIARALIKKP
Sbjct: 542 GLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKP 601

Query: 616 KILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSV 675
            +LILDEATSALDVESEGAINYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLG+DGSV
Sbjct: 602 TVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSV 661

Query: 676 IEAGKFADLYRDEDSELFKLLNE 698
           +E GKF +LY +  S L +LLNE
Sbjct: 662 VEMGKFKELYSNPTSALSQLLNE 684

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/603 (64%), Positives = 473/603 (78%), Gaps = 10/603 (1%)

Query: 96  QPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQA 155
           + +K   + ++ RL  L K DWK         TISCSIGM++PKVIG+VLD  K + + +
Sbjct: 95  EQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTS-SGS 153

Query: 156 EKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLR 215
           +  +   P+  L +   +  FT                  NFGR  LL++L ER+VARLR
Sbjct: 154 DFFDLKIPIFSLPLYEFLSFFTVALLIGCAA---------NFGRFILLRILSERVVARLR 204

Query: 216 AQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMF 275
           A VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT  +SDGVKA +CG VGVGMM 
Sbjct: 205 ANVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMC 264

Query: 276 HISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFV 335
            +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG LTRV+EEQ +GIKT++SFV
Sbjct: 265 SLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 324

Query: 336 AEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSL 395
           AEG E+ RYN A+R +F V K    T+A FF+ T++LGD+SFL VLAYGS+LVLQ +LS+
Sbjct: 325 AEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSI 384

Query: 396 GSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG 455
           G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFELTD K S+  TVG  + P  G
Sbjct: 385 GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRG 444

Query: 456 RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515
            IEFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSGRGKSTIA LLLR+Y+  +GT
Sbjct: 445 VIEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504

Query: 516 ILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFC 575
           I ID QDISK++ KSLR+H+G+VQQEPVLMSGTIRDNITYGL+YTP+ +EIR+VAK+CFC
Sbjct: 505 ITIDNQDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564

Query: 576 HNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
           HNFITKFP+ YDTVIGP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAI
Sbjct: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624

Query: 636 NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
           NYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLG+DGSV+E GKF +LY +  S L +L
Sbjct: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQL 684

Query: 696 LNE 698
           LNE
Sbjct: 685 LNE 687

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/611 (63%), Positives = 476/611 (77%), Gaps = 12/611 (1%)

Query: 88  RPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDA 147
           +PA P   Q +K   + ++ RL  L K DWK         TISCSIGM++PKVIG+VLD 
Sbjct: 89  KPARP--PQRSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDT 146

Query: 148 TKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLG 207
            K + + ++  E   P+  L +   +  FT                  NFGR  LL++L 
Sbjct: 147 LKTS-SGSDFFELKIPIFSLPLYEFLSFFTVALLIGCAA---------NFGRFILLRILS 196

Query: 208 ERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCG 267
           ER+VARLRA VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT  +SDGVKA +CG
Sbjct: 197 ERVVARLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICG 256

Query: 268 GVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNG 327
            VGVGMM  +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG LTRV+EEQ +G
Sbjct: 257 VVGVGMMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSG 316

Query: 328 IKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHL 387
           IKT++SFVAEG E+ RYN A+R +F V K    T+A FF+ T++LGD+SFL VLAYGS+L
Sbjct: 317 IKTVQSFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYL 376

Query: 388 VLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVG 447
           VLQ +LS+G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFELTD K S+  T G
Sbjct: 377 VLQSQLSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAG 436

Query: 448 QTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
             + P  G +EFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSGRGKSTIA LLLR
Sbjct: 437 HKYKPHRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLR 496

Query: 508 FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR 567
           +Y+ ++GTI+ID QDI+K++ KSLR+H+G+VQQEPVLMSGTIRDNITYGL+YTP+ +EIR
Sbjct: 497 YYNPSTGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIR 556

Query: 568 AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627
           +VAK+CFCHNFITKFP+ YDTVIG RG LLSGGQ+QRIAIARALIKKP ILILDEATSAL
Sbjct: 557 SVAKQCFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSAL 616

Query: 628 DVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687
           DVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSEN++VLG+DGSV+E GKF  LY +
Sbjct: 617 DVESEGAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYAN 676

Query: 688 EDSELFKLLNE 698
             S L +LLNE
Sbjct: 677 PTSALSQLLNE 687

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/603 (64%), Positives = 473/603 (78%), Gaps = 10/603 (1%)

Query: 96  QPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQA 155
           + +K   + ++ RL  L K DWK         TISCSIGM++PKVIG+VLD  K + + +
Sbjct: 95  EQSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTS-SGS 153

Query: 156 EKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLR 215
           +  +   P+  L +   +  FT                  NFGR  LL++L ER+VARLR
Sbjct: 154 DFFDLKIPIFSLPLYEFLSFFTVALLIGCAA---------NFGRFILLRILSERVVARLR 204

Query: 216 AQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMF 275
           A VIKKTLH DAEFFD +KVGDLISRLGSDAY+VSRSMT  +SDGVKA +CG VGVGMM 
Sbjct: 205 AHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMC 264

Query: 276 HISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFV 335
            +S  L+  ++ F PP+L +A+++GK+IR  S++LQ++TG LTRV+EEQ +GIKT++SFV
Sbjct: 265 SLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFV 324

Query: 336 AEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSL 395
           AEG E+ RYN A+R +F V K    T+A FF+ T++LGD+SFL VLAYGS+LVLQ +LS+
Sbjct: 325 AEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSI 384

Query: 396 GSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG 455
           G LTAFMLYTEYTG++VFGLS FYSE+M+GAGAASRLFELTD K S+  TVG  + P  G
Sbjct: 385 GDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERG 444

Query: 456 RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515
            IEFKDVSFSYPTRP+ QIFK L   I PGS+VCIVGPSGRGKSTIA LLLR+Y+  +GT
Sbjct: 445 VIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGT 504

Query: 516 ILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFC 575
           I+ID QDI+K++ KSLR+ +G+VQQEPVLMSGTIRDNITYGL+YTP+ +EIR+VAK+CFC
Sbjct: 505 IMIDNQDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFC 564

Query: 576 HNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
           HNFITKFP+ YDTVIGP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAI
Sbjct: 565 HNFITKFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAI 624

Query: 636 NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
           NYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLG+DGSV+E GKF +LY +  S L +L
Sbjct: 625 NYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQL 684

Query: 696 LNE 698
           LNE
Sbjct: 685 LNE 687

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/591 (63%), Positives = 462/591 (78%), Gaps = 7/591 (1%)

Query: 108 RLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLL 167
           RL RL K DWK         ++SC IGM++PK+IG+VLD  K  ++  +        ++ 
Sbjct: 104 RLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPD-------FTVD 156

Query: 168 DMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDA 227
           D+P I                       N+GR+ LL++L ER+VARLRA VIKKT+H DA
Sbjct: 157 DVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDA 216

Query: 228 EFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIM 287
           EFFD NKVGDLISRL SDAY+VSRS+T  +SDG KA LCG VG+GMM  IS  L++ ++ 
Sbjct: 217 EFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLF 276

Query: 288 FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA 347
             PP++++A+ +G+ IR  SR+LQ++TG+LT+V+EEQF+GIKT++SFVAE KE++RYN A
Sbjct: 277 LTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHA 336

Query: 348 VRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEY 407
           +R +FNV K+    +A FFS T VLGD+SFL+VLAYGS+LVL G LS+G LTA+M+YTEY
Sbjct: 337 IRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEY 396

Query: 408 TGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYP 467
           TGSS+FGLS FYSE+M+GAGAASRLFELTD   S+  T+G+ FVP  G IEFK+VSFSYP
Sbjct: 397 TGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYP 456

Query: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527
           TR ++QIFK L   I  GSNVCIVGPSGRGKSTIASLLLR+Y+  +G I +DGQDISKVS
Sbjct: 457 TRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVS 516

Query: 528 AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD 587
           +KSLR+H+ +VQQEPVLMSGTIRDNITYGL   P+ DE+R++ KKCFCHNFITKFP+ YD
Sbjct: 517 SKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYD 576

Query: 588 TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647
           T++GP G LLSGGQ+QRIAIARALIKKP ILILDEATSALDVESEGAINYT G+LM+SK 
Sbjct: 577 TILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKS 636

Query: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           ITI+SIAHRLSTIRRSEN++VLGNDGSV E GKF +LY D  SEL KLL+E
Sbjct: 637 ITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHE 687

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/626 (59%), Positives = 483/626 (77%), Gaps = 2/626 (0%)

Query: 73  SPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCS 132
           S   +++E++RK  K+  E         + + ++ RL+ LV+ DWK         TISCS
Sbjct: 87  SATKEKNEEDRKYSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCS 146

Query: 133 IGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXX 192
           IGM +PKVIGL+LD  K+A+A    +  G P+S+  +P I+   +               
Sbjct: 147 IGMTIPKVIGLILDQLKNALAANSVD--GQPVSIDKLPPIVFGLSFYEFLGGFALALLVG 204

Query: 193 XXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRS 252
              N+GR+ LL++L ERLVARLRA VIKKT+H DAEFFD +KVGDLISRLGSDAY+VSRS
Sbjct: 205 IAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRS 264

Query: 253 MTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ 312
           MT  +SDG KA +CG VG+GMM  +S  L+  +++F PP++++A+++GK+I   SRELQ+
Sbjct: 265 MTQKVSDGFKALICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQE 324

Query: 313 STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVL 372
           +TG+LT+V+EEQ +GIKT++SFVAE +E+ RYN A+R +FN+ K+  + +A FFS T+ +
Sbjct: 325 ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384

Query: 373 GDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL 432
           GD+SFL VL +GS+LVLQ  L++G LTAFM+YTEYTG+S+FGLS FYSE+M+GAGAASRL
Sbjct: 385 GDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444

Query: 433 FELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVG 492
           FELTD   S+ +T G  + P +G IEFK+VSF+YPTRP++ IFK L   I  GSNVCIVG
Sbjct: 445 FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVG 504

Query: 493 PSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN 552
           PSGRGKST+A LL ++Y  +SG ILIDGQ+I+ +++KSLR+H+G+VQQEP+LMSGTIRDN
Sbjct: 505 PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564

Query: 553 ITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALI 612
           I YGL+  P+ DEIR VAK+CFCHNFIT+F   YDTVIGP G LLSGGQ+QRIAIARALI
Sbjct: 565 IVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALI 624

Query: 613 KKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGND 672
           KKP+ILILDEATSALDVESEGAINYT G+LM+ KE+TIVSIAHRLSTIRRSEN++VLG+D
Sbjct: 625 KKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHD 684

Query: 673 GSVIEAGKFADLYRDEDSELFKLLNE 698
           GSV+E GKF +L+ D  SEL +LLNE
Sbjct: 685 GSVVEMGKFKELWDDPTSELSQLLNE 710

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/623 (61%), Positives = 479/623 (76%), Gaps = 15/623 (2%)

Query: 82  ERKVEKRPA---EPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVP 138
           + K  K+P+    P        + + +V RL  LVK DWK         TISC IGM +P
Sbjct: 100 QSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIP 159

Query: 139 KVIGLVLDATKDAVA-QAEKNETGAPMSL--LDMPSIIGNFTXXXXXXXXXXXXXXXXXX 195
           KVIG++LD+ K   A Q+E  E   P+ +  L +   +G F+                  
Sbjct: 160 KVIGIILDSLKVQTATQSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMA--------- 210

Query: 196 NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
           NFGR+ LL++L ERLVARLR+ VIK+T+H DA+F+D +K GDLISRLG+DAYIVSRS+T 
Sbjct: 211 NFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQ 270

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
            ISDG K+ +CGGVGVGMM  +S  L++ + +   P++I+A+I+GK+IR  SRELQ +TG
Sbjct: 271 KISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIRINSRELQDATG 330

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
            LTRVSEEQ NG+KT++SFVAE +E++R+N A+R +F+V KR    +A FF+ T+++GD+
Sbjct: 331 QLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDL 390

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
           SFL VL YGS+LVL G L++G LTAFMLYTEYTG+S+FGLS FYSE+M+GAGAASRLFEL
Sbjct: 391 SFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 450

Query: 436 TDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
           TDY   +  T+G+T++P  G IEFK+VSFSYPTRP +QIFK L   I PGSNVCIVGPSG
Sbjct: 451 TDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSG 510

Query: 496 RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
           +GKSTIA LLL +Y+  SG ILIDGQDI+K+++KSLR+ LG+VQQEPVLMSG+IRDNITY
Sbjct: 511 KGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITY 570

Query: 556 GLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKP 615
           GL+YTP+ +EIR VAK+CFCHNFITKFP  YDT IGP G LLSGGQ+QRIAIARALIKKP
Sbjct: 571 GLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKP 630

Query: 616 KILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSV 675
            ILILDEATSALDVESEGAINYT G+LM++K +TIVSIAHRLSTIRRSEN++VLGNDGSV
Sbjct: 631 NILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSV 690

Query: 676 IEAGKFADLYRDEDSELFKLLNE 698
           IE GKF +L+ D  SEL KLLNE
Sbjct: 691 IEMGKFKELFSDPSSELSKLLNE 713

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/621 (61%), Positives = 478/621 (76%), Gaps = 8/621 (1%)

Query: 79  HEQERKVEKRPAEPSRAQPAK-PAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAV 137
           H +  +  K   EP+  +P +  + + +VFRL  LVK D+K         TISC+IGM +
Sbjct: 135 HTESTESTKASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMI 194

Query: 138 PKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNF 197
           PK+IGL+LDA K +VA      +  P      P+I+   T                  N+
Sbjct: 195 PKIIGLILDALK-SVATTPDGGSSPP------PTIMFGLTLYEFLGGFSVALFIGCAANY 247

Query: 198 GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
           GR+ LL++L ERLVARLR+ V+K TLH D+EFFD +KVGDLISRLG+D+YIVSRS+T  I
Sbjct: 248 GRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKI 307

Query: 258 SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNL 317
           SDGVK+ +CGGVG+GMM  +S  L+S ++ F  P++++A+I+GK+IR  SRELQ +TG L
Sbjct: 308 SDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQL 367

Query: 318 TRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSF 377
           TRVSEEQ NG++T++SFVAE +E++R+N ++R +F+V KR    +A FF+ T+++GD+SF
Sbjct: 368 TRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSF 427

Query: 378 LLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD 437
           L VL YGS+LVL G L++G LTAFMLYTEYTG+++FGLS FYSE+M+GAGAASRLFELTD
Sbjct: 428 LTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTD 487

Query: 438 YKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRG 497
              ++  T+G+T+ P  G IEFK+VSF+YPTRP++QIFK L   I PGSNVCIVGPSG+G
Sbjct: 488 RVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKG 547

Query: 498 KSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL 557
           KSTIA LLL +Y+  SG ILIDGQDI+K+++KSLR+ + VVQQEPVLMSGTIRDNITYGL
Sbjct: 548 KSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGL 607

Query: 558 SYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKI 617
           +  P+ +EIR VAK+CFCHNFI KFP  YDT IGP G LLSGGQ+QRIAIARALIKKP I
Sbjct: 608 TEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNI 667

Query: 618 LILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIE 677
           LILDEATSALDVESEGAINYT G+LM+SK +TIVSIAHRLSTIRRSENI+VLGNDGSV+E
Sbjct: 668 LILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVE 727

Query: 678 AGKFADLYRDEDSELFKLLNE 698
            GKF +L+ D  SEL KLLNE
Sbjct: 728 MGKFKELFADPTSELSKLLNE 748

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/607 (62%), Positives = 473/607 (77%), Gaps = 10/607 (1%)

Query: 94  RAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVA 153
           RA+  K  G  E+ RL+ +   DWK         TISCSIGMA+PKVIGLVLDA K+ + 
Sbjct: 137 RAEDEK-KGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVM- 194

Query: 154 QAEKNETGAPMSL--LDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLV 211
                 T +P SL   D+P I    T                  N+GR  LL++L ER+V
Sbjct: 195 ------TDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVV 248

Query: 212 ARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGV 271
           ARLR+ VIKKTLH DAEFFD+NKVGDLISRLGSDAY+VSRS+T  +SDG KA LCGG G+
Sbjct: 249 ARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGI 308

Query: 272 GMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331
           GMM  IS  L+S +++FAP ++I+A+I+GK+IR IS  LQ++TG LTRVSEEQ NG+KT+
Sbjct: 309 GMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTV 368

Query: 332 KSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQG 391
           +SFVAE KE+RRYN A+R ++N+ K   + ++ F + T+V+GD+SFL+VLAYGS+LVL G
Sbjct: 369 QSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHG 428

Query: 392 ELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFV 451
            L++G LTAFMLYT+YT +S+FGLSNFYSE+M+G GAA RLF+LTD   ++  T+G+ F+
Sbjct: 429 SLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFI 488

Query: 452 PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDA 511
           P DG IEF+++ F+YPTRP +Q+FK L   I PG++VCIVGPSGRGKSTIA LLLR+Y+ 
Sbjct: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548

Query: 512 NSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAK 571
           +SG ILID QDI K++ KSLR+++G+VQQEPVLMSG+IRDNITYGL    + DEIR V+K
Sbjct: 549 SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK 608

Query: 572 KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVES 631
           +CFCHNFITKFPD Y+T+IGP G LLSGGQ+QRIAIARALIKKPKILILDEATSALDVES
Sbjct: 609 QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668

Query: 632 EGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSE 691
           EGAINYT G+LM+SK +TIVSIAHRLSTIRRSE I+VLGNDGSV+E GKF +LY D  SE
Sbjct: 669 EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE 728

Query: 692 LFKLLNE 698
           L KLLNE
Sbjct: 729 LSKLLNE 735

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/621 (59%), Positives = 475/621 (76%), Gaps = 3/621 (0%)

Query: 82  ERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVI 141
           +R    +   P    P      +++ RLL L K DWK         T+SC+IGM++PKVI
Sbjct: 53  KRWSSSKTTAPQVRVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVI 112

Query: 142 GLVLDATKDAVAQAEKNETG-APMSL--LDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFG 198
           G+VLD  K+A++++E  E G A +S+   ++P I    +                  NFG
Sbjct: 113 GMVLDLLKNAISKSEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFG 172

Query: 199 RMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNIS 258
           R+ LL++L ER+VARLR+QVIKKT+H DAEFFD NKVGDLISRLGSDAY+VSRSMT  +S
Sbjct: 173 RVVLLRVLSERVVARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVS 232

Query: 259 DGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318
           DG KA LCGGVGVGMM  IS  L++ ++ F PP+++++  +G+ IR  SR+LQ++TG LT
Sbjct: 233 DGFKALLCGGVGVGMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLT 292

Query: 319 RVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFL 378
           RVSEEQF+G+KT+++FVAE +E++RYN  ++ ++NV K     +A  F+ T+ LGD+SFL
Sbjct: 293 RVSEEQFSGVKTVQAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFL 352

Query: 379 LVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDY 438
           LVLAYGS+LVL G LS+G LTA+M+YTE TGS+VFGLS+FYSE+M+G GAASRLFELTD 
Sbjct: 353 LVLAYGSYLVLHGGLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDR 412

Query: 439 KKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
              +  T G+ ++P  G IEFK+VSF+YPTRP SQIFK L   I PGSNVCIVGPSGRGK
Sbjct: 413 IPMISPTTGKKYIPGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGK 472

Query: 499 STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558
           STIASLLL++Y   +GTI +DGQDISK+++KSLR+H+G+VQQEP+LMSG+IRDNITYGL+
Sbjct: 473 STIASLLLKYYKPTAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLT 532

Query: 559 YTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618
           Y  + +EIR V K+CFCHNFITKFPD Y T++GP G LLSGGQ+QRIAIARAL+KKP +L
Sbjct: 533 YEATAEEIRRVTKQCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVL 592

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678
           ILDEATSALDVESE AINYT G+LM+ KE+TI+SIAHRLSTIRRSE ++VLGNDGSV+E 
Sbjct: 593 ILDEATSALDVESESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEI 652

Query: 679 GKFADLYRDEDSELFKLLNEH 699
           GKF  L+ +  SEL +LLNE 
Sbjct: 653 GKFKTLFGNPLSELSQLLNEK 673

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/645 (58%), Positives = 483/645 (74%), Gaps = 7/645 (1%)

Query: 54  VCRQSRAYSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLV 113
           + R   +  + R+G          + E   K  K+  EP +    K + + +  RL  L 
Sbjct: 31  IVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQK---KESSYKDAVRLFSLA 87

Query: 114 KPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSII 173
           K DW+         TISC IGM++PKVIGLVLD  +  +   +       +++ D+  I 
Sbjct: 88  KRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQN----VNMDDLGPIA 143

Query: 174 GNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRN 233
              T                  NF R+ +L++L ER+VARLR+ V+ KTLH D+EF+D +
Sbjct: 144 FGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTH 203

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLL 293
           KVGDLISRLGSDAY+VSRSMT  +SDG KA +CGGVG+GMM  IS  L+  ++ FAPP+L
Sbjct: 204 KVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPIL 263

Query: 294 IAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFN 353
            +A+++GK+IR  S++LQ++TG LTRV+EEQ +G+KT++SFVAE +E+ RYN A+R ++N
Sbjct: 264 WSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN 323

Query: 354 VAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVF 413
           V ++    +A FF+ T +LGD+SF++VL YGS+LVLQG L++G LTAFMLYTEYTGSSVF
Sbjct: 324 VGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVF 383

Query: 414 GLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQ 473
           GL+ FYSELM+G GAASRLF+LTD+  S+  T GQ ++P  G IEFK+VSFSYPTRP +Q
Sbjct: 384 GLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQ 443

Query: 474 IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRK 533
           IFK + + + PGSNVCIVGPSGRGKSTIA LLLR+Y+  +G IL+DGQDISKV+ K+LR+
Sbjct: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503

Query: 534 HLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
           H+G+VQQEP+LMSGTIRDNITYGL+   + +EIR+VAK+CFCHNFITKFPDGYDT+IG +
Sbjct: 504 HIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQ 563

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSI 653
           GALLSGGQRQRIAIARALIKKP IL+LDEATSALDVESEGAINYT G+LM+S  +TIVSI
Sbjct: 564 GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSI 623

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           AHRLSTI+RSEN++VLG DGSVIEAGKF +L+ + +SEL KLL E
Sbjct: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/618 (59%), Positives = 460/618 (74%), Gaps = 14/618 (2%)

Query: 83  RKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIG 142
           ++ EK+PA     +P     + +++RL  LVK DWK         T+SC IGM +PKVIG
Sbjct: 68  KEPEKQPAVVVHPKPEDEGTYKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIG 127

Query: 143 LVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFL 202
            VLD+ KD          G   S L    +I + +                  N+ R+ L
Sbjct: 128 TVLDSLKDI--------QGKEFSEL----MIWDMSLKHFFYGLSGLLLLGCGANYVRVIL 175

Query: 203 LKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVK 262
           L++L E LVA+LRA VIK  +H DA+FFD  KVGDLISR+G+DA+IVSRS+T  ISDGVK
Sbjct: 176 LRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVK 235

Query: 263 AALCGGVGVGMMFHISSTLT-SAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321
           A   G  GVGMM  IS  L+ S +I+   PLL++A ++GK+IR  S++LQ+ T NLTRVS
Sbjct: 236 AVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVS 295

Query: 322 EEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVL 381
           EEQFNGIKTI+SFVAE  EM ++N ++R++F V K     +A FF+  +++GD+SFL+VL
Sbjct: 296 EEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVL 355

Query: 382 AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
           +YGS LV Q +LS+G LTAFMLYTEYTG+++F LS F+SE+M+GAGAASR+FELTD K  
Sbjct: 356 SYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPR 415

Query: 442 VPSTVGQTFVP-RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
           +  T G  F+P + G IEFK+VSF+YPTRPT  IF+ L   I  GSNVCIVGPSG+GKST
Sbjct: 416 INPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKST 475

Query: 501 IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
           IA LLL +Y+ + G ILIDGQDIS +S KSLR+H+G+VQQEP+LMSGTIRDNITYGL+YT
Sbjct: 476 IAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYT 535

Query: 561 PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620
           P+ +EIR+VAK+CFCHNFIT+FPD YDT IGP G LLSGGQ+QRIAIARALIKKP +LIL
Sbjct: 536 PTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLIL 595

Query: 621 DEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
           DEATSALDVESEGAINYT G+LM+SK +TIVSIAHRLSTIRRSEN++VLGNDGSV+E GK
Sbjct: 596 DEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGK 655

Query: 681 FADLYRDEDSELFKLLNE 698
           F +L+ +  SEL KLL E
Sbjct: 656 FKELFANPASELSKLLRE 673

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/605 (56%), Positives = 445/605 (73%), Gaps = 17/605 (2%)

Query: 101 AGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNET 160
           + W ++ RL  L+K D K         TISCSIGMA+PK+IG +LD  ++     E   +
Sbjct: 81  SSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRN---NYENLTS 137

Query: 161 GAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIK 220
            + + +L++P  +  F                   NFGR+ +L+++ ERLV+RLR+QV+K
Sbjct: 138 LSQIKILNIP--LSTF-----LMGVGITLIFGCFANFGRVVILRIISERLVSRLRSQVVK 190

Query: 221 KTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISST 280
             +H D EFFD  KVGDL+SR+G+DA++VSRS+TH ++DGV++   G  G+G+M  +S  
Sbjct: 191 NIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRE 250

Query: 281 LTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKE 340
           LT A+    PP++   +++GK+IR  S++LQ  TG+LTRV+EEQFNGI+T++ FVAE  E
Sbjct: 251 LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNE 310

Query: 341 MRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTA 400
           ++R+N  +R +F V K     +  FF+  +++GD+ FL+VL YGS+LV+ G +S+G LTA
Sbjct: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTA 370

Query: 401 FMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQT-FVPRD----G 455
           FMLYTEYTG+++FGLS+FYSELM+G GAASR+FE+ D +  + ST G+  F P +     
Sbjct: 371 FMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGC 430

Query: 456 RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515
            IEFK+VSF YPTRPT+QIFK L   +  GSNVCIVGPSGRGKSTIASLLL  Y+A SG 
Sbjct: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490

Query: 516 ILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFC 575
           ILIDGQDI+ ++ KSLR+ +G+VQQEP+LMSGTIRDNITYGL+  PS +EIR VAK+CFC
Sbjct: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550

Query: 576 HNFITKFPDGYD--TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 633
           HNFITKFPD YD     G  G  LSGGQ+QRIAIARALIKKP ILILDEATSALDVESEG
Sbjct: 551 HNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 610

Query: 634 AINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELF 693
           AINYT G++M+SK +TIVSIAHRLSTIRR E+++VLGNDGSV+E GKF +LY +  SEL 
Sbjct: 611 AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELS 670

Query: 694 KLLNE 698
           KLLNE
Sbjct: 671 KLLNE 675

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/653 (45%), Positives = 407/653 (62%), Gaps = 18/653 (2%)

Query: 54  VCRQSRAYSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLV 113
           + +Q+R  S      E +     K  E ++K+EK  +E S        G+ +V RL  L 
Sbjct: 53  ILQQTRFNST----NESSKGINTKLTETQQKLEKLSSEESTN-----TGFKDVKRLFTLA 103

Query: 114 KPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLD----ATKDAVAQAEKNETGAPMSLLDM 169
           KP+            IS ++ M VP VIG +LD     + D    A+  E        D 
Sbjct: 104 KPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDN 163

Query: 170 PSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEF 229
            +I G FT                  N GR+ +LK+ GE+LVARLR + +K  L  DA F
Sbjct: 164 NTIYG-FTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATF 222

Query: 230 FDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFA 289
            D N+VGDLISRL SDA IV++S+T N+SDG +A L G VG  MM +IS  LTS M++  
Sbjct: 223 LDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLI 282

Query: 290 PPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVR 349
           PPL I A +YGK+IR +SR+LQ + G LT+V+EEQ N  KTI+++  E KE+RRY + VR
Sbjct: 283 PPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVR 342

Query: 350 RLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTG 409
            +F+V  +E ITS  FF  T ++G+ + L +L  G++++  G L++G L++FM+Y  YTG
Sbjct: 343 DVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTG 402

Query: 410 SSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPT 468
           SS+FGLS+FYSELMKGAGAA+R+FEL D K  +  T+G+  V   G+ I F+DVSF YPT
Sbjct: 403 SSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPT 462

Query: 469 RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA 528
           RP  ++F K+   I PG ++C VGPSG GKST++ LLLR+YDA  G ILI   +I  +S 
Sbjct: 463 RPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSL 522

Query: 529 KSLRKHLGVVQQEPVLMSGTIRDNITYGL--SYTPSMDEIRAVAKKCFCHNFITKFPDGY 586
           +  RK LGVVQQEP+L +GTI DNI Y +        +++    KK  C  F+  FPDG 
Sbjct: 523 RKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGL 582

Query: 587 DTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK 646
           +T++GPRG  LSGGQ+QRIAIAR+ +  P IL+LDEATSALD +SE  I  TL +   ++
Sbjct: 583 NTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAE 641

Query: 647 EITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            +T +SIAHRLSTI+ S  +VVL  +GSV+E GKF +L  +  SEL  LL++ 
Sbjct: 642 GLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKE 694

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/602 (47%), Positives = 389/602 (64%), Gaps = 11/602 (1%)

Query: 101 AGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNET 160
           +G+ ++ RL RL KP+            IS ++ M +P ++G +LD  KD      + + 
Sbjct: 88  SGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAKD------RKDA 141

Query: 161 GAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIK 220
                  + P I G  T                  N GR+ +LK+ GERLVARLR + +K
Sbjct: 142 DDTTEDDEGPKIFG-MTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMK 200

Query: 221 KTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISST 280
             L  DA F D N+VGDLIS L SDA IV++S+T N+SDG +A + G VG GMM +IS  
Sbjct: 201 AALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQ 260

Query: 281 LTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKE 340
           LTS MI+  PPL I A +YG++IR +SR+LQ S G LT+VSEEQ   +KTI+S+V E KE
Sbjct: 261 LTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKE 320

Query: 341 MRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTA 400
           + RY T VR +FN+  +E +TS  FF  T ++G++S L +L  G++++  G +++G L++
Sbjct: 321 IHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSS 380

Query: 401 FMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR-IEF 459
           FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  +P T+GQ  V    + I F
Sbjct: 381 FMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRF 440

Query: 460 KDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILID 519
           ++VSF+YPTR   +IF  L +T+ PG +VCIVGPSG GKST+ASLLLR+YD N G I+I 
Sbjct: 441 ENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIG 500

Query: 520 GQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL--SYTPSMDEIRAVAKKCFCHN 577
             +I+  + +  R+ LG+VQQEP L +GTI DNI Y +      + D I     +  C  
Sbjct: 501 DHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANCSK 560

Query: 578 FITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 637
           F+  FPDG  T++GPRGA LSGGQ+QRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 561 FLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQ 620

Query: 638 TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           TL R+   + +T +SIAHRLSTI+    +VVLG  G V+E+G F +L R+  SEL  LL+
Sbjct: 621 TL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSILLS 679

Query: 698 EH 699
           + 
Sbjct: 680 QQ 681

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  533 bits (1373), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 289/606 (47%), Positives = 386/606 (63%), Gaps = 13/606 (2%)

Query: 98  AKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEK 157
           +K  G+  V RL +L +P+ K          IS ++ M +P VIG +LD +K+  A  + 
Sbjct: 75  SKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDG 134

Query: 158 NETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQ 217
           +E        +  + I   T                  N GR+ +LK+ GE+LVARLR +
Sbjct: 135 DE--------EQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTK 186

Query: 218 VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            +K  L  DA F D N+VGDLISRL SDA IVS+S+T N SDG +A + G VG GMM +I
Sbjct: 187 TMKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYI 246

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           S+ LT  M++ APPL++ A +YG+RIR ++RELQ   G LT+V+EEQ N  +TI+S+  E
Sbjct: 247 SAQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGE 306

Query: 338 GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS 397
            KE+RRY   VR +F V  RE +TS  FF  T ++G+++ L +L  G+ ++  G +++G 
Sbjct: 307 RKEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGE 366

Query: 398 LTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR- 456
           L++FM+Y  YTGSS+FGLS+FYSELMKGAGAASR+FEL D    +  T G+  +    + 
Sbjct: 367 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKE 426

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           IEFK+V FSYP+R    +F +L L I PG +VC+VGPSG GKSTI+SLLLRFYD +SG I
Sbjct: 427 IEFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVI 486

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA--VAKKCF 574
            I GQ+I   + +  R+ LG+VQQEP+L +G+I+DNI Y L      D+ R     +   
Sbjct: 487 TIGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAAN 546

Query: 575 CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 634
           C  FI+ FPDG DT++GPRG  LSGGQ+QRIAIARA I  P ILILDEATSALD +SE  
Sbjct: 547 CTRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDI 606

Query: 635 INYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
           I   L     S +ITI SIAHR+STI  S  ++VL  +G V E G F DL    +S L K
Sbjct: 607 IAQALRARSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNK 665

Query: 695 LLN-EH 699
           LL+ EH
Sbjct: 666 LLSKEH 671

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  532 bits (1371), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 288/627 (45%), Positives = 394/627 (62%), Gaps = 11/627 (1%)

Query: 81  QERKVEKRPAEPSRAQPAKP--AGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVP 138
           QER++ K P +  +  P +   +G+ +V RL  L +P+            IS ++ M VP
Sbjct: 74  QEREL-KIPPKIQKLTPDESGRSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVP 132

Query: 139 KVIGLVLDATKDAVAQAEKNETGAPMSLL---DMPSIIGNFTXXXXXXXXXXXXXXXXXX 195
            VIG +LD  K   A  E+N  G    L    D    I   T                  
Sbjct: 133 SVIGKLLDIAKPPSAD-EENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALA 191

Query: 196 NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
           N GR+ +LK+ GERLVARLR + +K  L  +A F D NKVGDLISRL +DA IV++S+T 
Sbjct: 192 NTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQ 251

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
           N+SDG +A L G VG GMM +IS  LTS M++  PPL   A IYG++IR +SR+LQ S G
Sbjct: 252 NVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVG 311

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
            LT+V+EEQ N  +TI+++  E KE+ RY T VR +F++  +E +TS  FF  T ++G+ 
Sbjct: 312 GLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNT 371

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
           + L +L  G++++  G L++G L++FM+Y  YTGSS+FGLS FYSELMKGAGAA+R+FEL
Sbjct: 372 ALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFEL 431

Query: 436 TDYKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPS 494
           +D K ++  T+G+  +   G+ +EFK+VSF YPTRP  QIF+   + I PG +VC VGPS
Sbjct: 432 SDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPS 491

Query: 495 GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
           G GKST++SLLLR+YD   G+IL+ G+DI   S +  R+ LGVVQQEP+L +GTI +NI 
Sbjct: 492 GSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENIL 551

Query: 555 YGLSYTPSMD--EIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALI 612
           Y +    + +   I    +   C  F+  FPDG +T++GPRG  LSGGQ+QRIA+AR  +
Sbjct: 552 YSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFL 611

Query: 613 KKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGND 672
             P ILILDEATSALD +SE  I   L +    K  T +SIAHRLSTI+ S  +VVLG +
Sbjct: 612 LDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKN 670

Query: 673 GSVIEAGKFADLYRDEDSELFKLLNEH 699
           G V+E G F +L  +  S L  LL + 
Sbjct: 671 GCVVETGTFQELISNPSSGLNILLTQE 697

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  528 bits (1359), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 283/610 (46%), Positives = 395/610 (64%), Gaps = 13/610 (2%)

Query: 98  AKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEK 157
           +K +G+ ++ RL  L +P+ +          IS S+ M VP +IG +LDA K    Q E 
Sbjct: 89  SKSSGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKG--QKEN 146

Query: 158 NETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQ 217
            E  +   + D+ +  G  T                  N GR+ +LK+ GERLVARLR +
Sbjct: 147 EEEDSKTIVPDI-TFFG-LTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTR 204

Query: 218 VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            +K  L  DA F D N+VGDLISRL SDA IVS+++T N+SDG +A + G VG GMM ++
Sbjct: 205 TMKAALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYL 264

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           S  LT  M++  PPL I A +YG++IR +S++LQ+S G L++V+EEQ N  KTI+++V E
Sbjct: 265 SWKLTGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGE 324

Query: 338 GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS 397
             E+ RY T VR +F +  +E +TS  FF  T ++G+++ + +L  G++++  G L++G 
Sbjct: 325 RLEIHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGE 384

Query: 398 LTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR- 456
           L++FM+Y  YTGSS+FGLS+FYSELMKGAGAASR+FEL D K  + STVG       G+ 
Sbjct: 385 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKS 444

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I+F++VSF+YP+RP  +IF  L L I PG +VCIVG SG GKSTIASLLLR+YD N+G+I
Sbjct: 445 IKFENVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSI 504

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYG----LSYTPSMDEIRAVAKK 572
            I   DI   S +  R+ +G VQQEP L +G+I DNI Y     L+     + ++   K+
Sbjct: 505 RIGDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQ 564

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632
             C+ F+ KFPDG  T++GPRGA LSGGQ+QRIA+ARA +  P +LILDE+TSALD  SE
Sbjct: 565 ANCNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSE 624

Query: 633 GAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSEL 692
             +  TL +   ++ +T +SIAHRLSTI+ S  ++V+G  GSV+E+G F  L  +  SEL
Sbjct: 625 ELVAKTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSEL 683

Query: 693 FKLL---NEH 699
             LL   NEH
Sbjct: 684 NMLLSQQNEH 693

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  526 bits (1354), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 286/605 (47%), Positives = 380/605 (62%), Gaps = 16/605 (2%)

Query: 98  AKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEK 157
           +K +GW ++ RL  L KP+ +          +S ++ MAVP VIG +LD  ++   Q E 
Sbjct: 78  SKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQPET 137

Query: 158 NETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQ 217
            +           ++I   T                  N GR+ +LK+ GERLVARLR +
Sbjct: 138 EKE----------TMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTR 187

Query: 218 VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            +K  L  DA F D N+VGDLISRL SDA IVS+S+T N+SDG +A + G VG GMM  I
Sbjct: 188 TMKAALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFI 247

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           S  LT  M++ APPL + A +YGKRIR +SR+LQ S G LT+VSEEQ +  KTI+++  E
Sbjct: 248 SWKLTCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGE 307

Query: 338 GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS 397
            KE+ RY   VR++F+V  +E +TS  FF  T  +G+V+ L +L  G+ ++  G +++G 
Sbjct: 308 KKEIHRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGD 367

Query: 398 LTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR- 456
           L++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  +  T+G+  V  + + 
Sbjct: 368 LSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKS 427

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I F  V FSYPTRP   IF+ L  T+ PG +VCIVGPSG GKST+ASLLLR+YD  SG I
Sbjct: 428 IHFNHVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEI 487

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA--VAKKCF 574
            +   +I   + +  R+ LGVVQQEP+L SGTI DNITY +      DE R      +  
Sbjct: 488 KLGNDNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQAN 547

Query: 575 CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 634
           C  F+  FPDG  T +GPRG  LSGGQ+QRIA+ARA +  P ILILDEATSALD +SE  
Sbjct: 548 CTKFLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEV 607

Query: 635 INYTL-GRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELF 693
           +  +L  R  R K  T +SIAHR+STI+ S  ++VL   G+V E G F  L    DS L 
Sbjct: 608 VAQSLQQRSARGK--TTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLN 665

Query: 694 KLLNE 698
           KLL++
Sbjct: 666 KLLSK 670

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  525 bits (1352), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 289/622 (46%), Positives = 388/622 (62%), Gaps = 14/622 (2%)

Query: 81  QERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKV 140
           Q +K  K   + S A  +K +G+ ++ RL  L KP+ K          IS S+ MAVP V
Sbjct: 65  QGKKSTKPTLKLSNAN-SKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSV 123

Query: 141 IGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRM 200
           IG +LD   ++  + E+      +           FT                  N  R+
Sbjct: 124 IGKLLDLASESDGEDEEGSKSNKLY---------GFTKKQFFTALGAVFIIGAVANASRI 174

Query: 201 FLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDG 260
            +LK+ GERLVARLR + +K  L  DA F D N+VGDLISRL SDA IV++S+T N+SDG
Sbjct: 175 IILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDG 234

Query: 261 VKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRV 320
            +A + G VG GMM  +S  LT  M++ APPL   A IYG++IR +SR+LQ S G LT+V
Sbjct: 235 TRAIIQGFVGFGMMSFLSWKLTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKV 294

Query: 321 SEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLV 380
           +EEQ N  +TI+++  E  E+RRY   VR +F++  +E +TS  FF  T ++G+ + L +
Sbjct: 295 AEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSL 354

Query: 381 LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKK 440
           L  G+ ++  G +++G L++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K 
Sbjct: 355 LLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKP 414

Query: 441 SVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKS 499
            +  T+G+  V    + I FK+VSF+YPTRP  QIFK L +TI PG +VC VGPSG GKS
Sbjct: 415 LIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKS 474

Query: 500 TIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL-- 557
           TIASLLLR+YD NSG+I    +DI   + +  R+ +G VQQEP+L +GTI DNI Y +  
Sbjct: 475 TIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPP 534

Query: 558 SYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKI 617
                 D IR    K  C  F+  FPDG  T++G RGA LSGGQ+QRIA+ARA +  P +
Sbjct: 535 EIAEQDDRIRRAIGKANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAV 594

Query: 618 LILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIE 677
           LILDEATSALD +SE  +   L R +  +  T +SIAHRLSTI+ S  ++VLG  GSV+E
Sbjct: 595 LILDEATSALDSQSEEIVAKNLQRRVE-RGFTTISIAHRLSTIKHSTRVIVLGKHGSVVE 653

Query: 678 AGKFADLYRDEDSELFKLLNEH 699
            G F DL    +SEL  LL E 
Sbjct: 654 TGSFRDLIAIPNSELNALLAEQ 675

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  525 bits (1353), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 281/603 (46%), Positives = 389/603 (64%), Gaps = 7/603 (1%)

Query: 101 AGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAV-AQAEKNE 159
           +G+ ++ RLL L +P+            IS ++ M +P VIG +LD  K +  ++ EK E
Sbjct: 88  SGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEKQE 147

Query: 160 TGAPMSLLDMPS--IIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQ 217
           +G             I  FT                  N GR+ +LK+ GERLVARLR +
Sbjct: 148 SGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLRTR 207

Query: 218 VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            +K  L  D+ F DRN+VGDLISRL SD+ IV++S+T N+SDG +A + G VG GMM +I
Sbjct: 208 TMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYI 267

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           S  LT  M +  PP+   A IYGK+IR +S++LQ S G LT+V+EEQ    KTI+S+V E
Sbjct: 268 SWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGE 327

Query: 338 GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS 397
            KE+RRY   VR++F++  +E +TS  FF  T  +G++S L +L  G+ ++  G +++G 
Sbjct: 328 KKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITVGD 387

Query: 398 LTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP-RDGR 456
           L++FM+Y  YTG S+FGLSNFYSELMKGAGAA+R+FEL D K ++  T+G+     R+  
Sbjct: 388 LSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLP 447

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I FKDVSF+YPTR   +IF  L LTI PG ++CI GPSG GKSTIASLL+R+YD + G I
Sbjct: 448 ISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGI 507

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAK--KCF 574
            I   D+   + +  R+ +GVV QEPVL +GTI +NI Y +  + + DE R  A   K  
Sbjct: 508 SIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSAAIGKAN 567

Query: 575 CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 634
           C  F++ FPDG +T++GPRGA LSGGQ+QR+A+ARA +  P +L+LDEATSALD +SE  
Sbjct: 568 CSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEI 627

Query: 635 INYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
           +  TL   +R + +T +SIAHR+STI  S  +VVLG DG V+E+G F +L    +SEL  
Sbjct: 628 VARTLQERVR-RGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNY 686

Query: 695 LLN 697
           LL+
Sbjct: 687 LLS 689

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  525 bits (1352), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 294/637 (46%), Positives = 399/637 (62%), Gaps = 18/637 (2%)

Query: 71  TPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTIS 130
           T + +D++  Q  K  K     S+A     +G+ ++ RL  L KP+            IS
Sbjct: 75  TSTEQDQKTLQTLKTLKLSPHDSKA-----SGFKDIKRLFLLAKPETNSMILALVFILIS 129

Query: 131 CSIGMAVPKVIGLVLDATKD---AVAQAEKNETGAPMSLLDMPS----IIGNFTXXXXXX 183
            ++ M +P VIG +LDA K+   A   A     G+  S  +       +I   T      
Sbjct: 130 GAVSMTIPSVIGKLLDAAKEGHLAGVSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYT 189

Query: 184 XXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLG 243
                       N GR+ LLK+ GE+LVARLR + +K  L  DA F D N+VGDLISRL 
Sbjct: 190 ALGTIFVVGAFANMGRIVLLKVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLS 249

Query: 244 SDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRI 303
           SDA IVS+S+T N+SDG +A + G VG GMM  IS  LT  M + APPL + A +YGK+I
Sbjct: 250 SDASIVSKSVTQNLSDGARAVIQGAVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKI 309

Query: 304 RAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSA 363
           R +SR+LQ S G LT+V+EEQ +  +T++++  E +E+RRY   VR +FN+  +E +TS 
Sbjct: 310 RNLSRQLQTSVGGLTKVAEEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSG 369

Query: 364 TFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELM 423
            FF  T  +G+V+ L +L  G+ ++  G +++G L++FM+Y  YTGSS+FGLS+FYSELM
Sbjct: 370 VFFGVTGFVGNVALLALLLTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELM 429

Query: 424 KGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTI 482
           KGAGAA+R+FEL D K  +  T G   V   G+ IEF++V+F+YPTR  ++IF  L L I
Sbjct: 430 KGAGAAARVFELNDRKPLIHPTKGVDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDI 489

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
            PG +VCIVGPSG GKSTIASLLLR+YD ++G I I GQDI + + +  R+ LGVVQQEP
Sbjct: 490 QPGEHVCIVGPSGGGKSTIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEP 549

Query: 543 VLMSGTIRDNITYGLSYTPSMDEIRA--VAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
           +L +GTI DNITY +    + D+ R      +  C  F+  FPDG +T++GPRGA +SGG
Sbjct: 550 LLFNGTILDNITYAVPGELAGDDSRVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGG 609

Query: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAHRLST 659
           Q+QRIA+ARA +  P +LILDEATSALD +SE  +  +L  R  R K  T VSIAHRLST
Sbjct: 610 QKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAQSLRSRSRRGK--TTVSIAHRLST 667

Query: 660 IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
           I+ S  ++VL   G V E G F +L  D DS L +LL
Sbjct: 668 IQHSSRVIVLDRHGGVGETGSFRELISDPDSHLTQLL 704

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  523 bits (1347), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 272/609 (44%), Positives = 388/609 (63%), Gaps = 15/609 (2%)

Query: 98  AKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEK 157
           +K  G  ++ RL +L KP+ K          IS S+ M +P +IG +LD  K      + 
Sbjct: 88  SKSNGMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDG 147

Query: 158 NETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQ 217
           +       L+     I   T                  N  R+ +LK+ GERLVARLR +
Sbjct: 148 DNNAKKEKLM-----IFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTR 202

Query: 218 VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            +K  L+ DA F D N+VGDLISRL SDA IV++++T N+SDG +A + G VG GMM  I
Sbjct: 203 TMKAALYQDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFI 262

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           S  LT  M++  PPL + A +YG++IR +SR+LQ S G LT+V+EEQ N  +TI+++  E
Sbjct: 263 SWKLTCVMMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGE 322

Query: 338 GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS 397
             E+ RY T VR++F+V  +E +TS  FF  T ++G+++ + +L  G+ ++  G L++G 
Sbjct: 323 ALEIHRYATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGD 382

Query: 398 LTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRD--- 454
           L++FM+Y  YTGSS+FGLS FYSELMKGAGAA+R+FEL D K  +  T+G  + P+    
Sbjct: 383 LSSFMMYAVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIG--YDPKSLLG 440

Query: 455 GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSG 514
             IEF++VSF+YPTRPT  I   L ++I PG +VCIVGPSG GKST++SLLLR+YD ++G
Sbjct: 441 KSIEFQNVSFAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTG 500

Query: 515 TILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL----SYTPSMDEIRAVA 570
           +I IDGQ+I + + +  R+ LGVVQQEP+L +GTI DNI Y +    + T +  +++   
Sbjct: 501 SIKIDGQNIKEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRAL 560

Query: 571 KKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE 630
           ++  C  F+  FP+G +T++GPRG  LSGGQ+QRIA+ARA +  P +LILDEATSALD +
Sbjct: 561 EQANCTKFLKNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQ 620

Query: 631 SEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
           SE  +   L   +    +T +SIAHRLSTI+ S  ++VL   GSV+E G F +L     S
Sbjct: 621 SEEIVAKNLSERVELG-LTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRS 679

Query: 691 ELFKLLNEH 699
           EL  LL++ 
Sbjct: 680 ELNMLLSQQ 688

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  517 bits (1331), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 280/621 (45%), Positives = 388/621 (62%), Gaps = 12/621 (1%)

Query: 82  ERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVI 141
           E K   +P        +K +G+ ++ RL  L +P+ K          IS S+ MAVP VI
Sbjct: 65  EGKASTKPTLKLSDANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVI 124

Query: 142 GLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMF 201
           G +LD   ++  + ++ +           S +   T                  N  R+ 
Sbjct: 125 GKLLDVASESDDEEDEEKA--------RDSKLYGLTKKQFFTALGLVFVIGAVANASRII 176

Query: 202 LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
           +LK+ GERLVARLR + +K  L  DA F D N+VGDLISRL SDA IV++S+T N+SDG 
Sbjct: 177 ILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGT 236

Query: 262 KAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321
           +A + G VG GMM  +S  LT  M++ APPL   A +YGK+IR +SR+LQ S G LT+V+
Sbjct: 237 RAIIQGFVGFGMMSFLSWKLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVA 296

Query: 322 EEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVL 381
           EEQ N  +TI+++  E  E+ RY   VR +F++  +E +TS  FF  T ++G+ + L +L
Sbjct: 297 EEQLNATRTIQAYGGEKNEVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLL 356

Query: 382 AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
             G++++  G +++G L++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  
Sbjct: 357 LVGTNMIQSGVMTIGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPL 416

Query: 442 VPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
           +  T+G+  +    + + FK+VSF+YPTRP  QIFK L +TI PG +VC VGPSG GKST
Sbjct: 417 IHPTIGKDPISLAHKPVVFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKST 476

Query: 501 IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL--S 558
           IASLLLR+YD NSG+I  D +D+   + +  R+ +G VQQEP+L +GTI DNI Y +   
Sbjct: 477 IASLLLRYYDVNSGSIEFDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSE 536

Query: 559 YTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618
                D +    ++  C  F+  FPDG  T++G RGA LSGGQ+QRIA+ARA +  P +L
Sbjct: 537 IAEREDRVARAIEQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALL 596

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678
           ILDEATSALD +SE  +   L + +  + +T +SIAHRLSTI+ S  I+VLG  GSV+E 
Sbjct: 597 ILDEATSALDSQSEEIVAKNLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVET 655

Query: 679 GKFADLYRDEDSELFKLLNEH 699
           G F DL    DSEL  LL E 
Sbjct: 656 GSFRDLIAIPDSELNALLAEQ 676

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  514 bits (1325), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 286/630 (45%), Positives = 388/630 (61%), Gaps = 12/630 (1%)

Query: 73  SPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCS 132
           S R +    E K   +P        +K +G+ ++ RL  L KP+ K          IS S
Sbjct: 56  SIRLQSSVSEGKTFTKPTLKLSDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSS 115

Query: 133 IGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXX 192
           + MAVP VIG +LD   +   + ++ +  +        + +   T               
Sbjct: 116 VSMAVPSVIGKLLDLASETEDEEKEEKAKS--------NKLYGLTKRQFFTALGLVFIIG 167

Query: 193 XXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRS 252
              N  R+ +LK+ GERLVARLR + +K  L  DA F D N+VGDLISRL SDA IV++S
Sbjct: 168 AVANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKS 227

Query: 253 MTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ 312
           +T N+SDG +A + G VG GMM  +S  LT  M++ APPL   A IYG++IR +SR+LQ 
Sbjct: 228 VTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQT 287

Query: 313 STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVL 372
           S G LT+V+EEQ N  +TI+++  E  E+RRY   VR +F++  +E +TS  FF  T ++
Sbjct: 288 SVGGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLV 347

Query: 373 GDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL 432
           G+ + L +L  G+ ++  G +++G L++FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+
Sbjct: 348 GNTAMLSLLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARV 407

Query: 433 FELTDYKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIV 491
           FEL D K  +  T+G+  V    + I FK+VSF+YPTRP  QIFK L +TI PG +VC V
Sbjct: 408 FELNDRKPLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAV 467

Query: 492 GPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRD 551
           GPSG GKSTIASLLLR+YD NSG+I    +DI   + +  R+ +G VQQEP+L +GTI D
Sbjct: 468 GPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILD 527

Query: 552 NITYGL--SYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIAR 609
           NI Y +        D I     +  C  F+  FPDG  T +G RGA LSGGQ+QRIA+AR
Sbjct: 528 NILYCIPPEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALAR 587

Query: 610 ALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVL 669
           A +  P +LILDEATSALD +SE  +   L R +  + +T +SIAHRLSTI+ S  +VVL
Sbjct: 588 AFLLDPAVLILDEATSALDSQSEEIVAKNLQRRVE-RGLTTISIAHRLSTIKHSTRVVVL 646

Query: 670 GNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
           G  GSV+E G F DL    +SEL  LL E 
Sbjct: 647 GKHGSVVETGSFQDLIAIPNSELNALLAEQ 676

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  510 bits (1313), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 279/639 (43%), Positives = 386/639 (60%), Gaps = 20/639 (3%)

Query: 65  RVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXX 124
           R+     P    +E   + ++E   A          +G  +V RL +L +P+ K      
Sbjct: 50  RLNSTANPRASTEEKPHQERLELSTAT------GNASGAKDVRRLFQLARPELKSLVCAL 103

Query: 125 XXXTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTXXXXXXX 184
               IS ++ M +P VIG +LD  ++ V Q   +E  A         ++           
Sbjct: 104 VLIVISGAVSMTIPSVIGKLLDVAREDVEQESGDEEEA---------VLYGLPEKQFYLA 154

Query: 185 XXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGS 244
                      N GR+ +LK  GERLVARLR + +K  L  +  F D N+VGDLISRL S
Sbjct: 155 LSGIFAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSS 214

Query: 245 DAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIR 304
           DA IVS+S+T N SDG +A + G VG GMM +IS  LT+ M + APPL++ A  YG+R+R
Sbjct: 215 DASIVSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVR 274

Query: 305 AISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSAT 364
            +SRELQ   G LT+V+EEQ N  +T++++  E +E+RRY T VR +F+V  +E + S +
Sbjct: 275 NLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGS 334

Query: 365 FFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMK 424
           FF  T  +G+ + L +L  G+ ++  G +S+G L++FM+Y  YTGSS+F LS+FYSELMK
Sbjct: 335 FFGATGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMK 394

Query: 425 GAGAASRLFELTDYKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTIT 483
           GAGAA R+FEL D K  +  T+G+  V   G+ I F  V+F+YPTRP  Q+F  + L+I 
Sbjct: 395 GAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSIC 454

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
           PG +VCIVGPSG GKST+ASLLLRFYD  SG+I I G+DI   +    R+ +G+VQQEPV
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPV 514

Query: 544 LMSGTIRDNITYGLSYTPSMDEIRA--VAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
           L + +I +NITY L    + D  R     +   C  F+  FP+G  T +GPRG  LSGGQ
Sbjct: 515 LFNASILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQ 574

Query: 602 RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
           +QR+A+ARA ++ P ILILDEATSALD +SE  +  TL +  +  +ITI SIAHR STI+
Sbjct: 575 KQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITI-SIAHRKSTIQ 633

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN-EH 699
            S  ++VL   G V+E G +  L  D  S L  LL+ EH
Sbjct: 634 HSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSKEH 672

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  505 bits (1300), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 280/605 (46%), Positives = 381/605 (62%), Gaps = 12/605 (1%)

Query: 98  AKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAVAQAEK 157
           +K +G+ ++ RL  L +P+            IS S+ MAVP VIG +LD   D   + + 
Sbjct: 80  SKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDA 139

Query: 158 NETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLRAQ 217
            ET          + +   +                  N  R+ +LK+ GERLVARLR +
Sbjct: 140 KET--------KDNKLYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTR 191

Query: 218 VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            +K  L  DA F D N+VGDLISRL SDA IV++S+T N+SDG +A + G VG GMM  +
Sbjct: 192 TMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFL 251

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           S  LT  M++ APPL   A IYG++IR +SR+LQ S G LT+V+EEQ N  +TI+++  E
Sbjct: 252 SWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGE 311

Query: 338 GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS 397
             E+RRY   VR +F+V  +E +TS  FF  T ++G+ + L +L  G++++  G +++G 
Sbjct: 312 KNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGE 371

Query: 398 LTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR- 456
           LT+FM+Y  YTGSS+FGLS+FYSELMKGAGAA+R+FEL D K  +  T+G+  V    + 
Sbjct: 372 LTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKP 431

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I FKDVSF+YPTRP  QIFK L +TI PG +VC VGPSG GKSTIASLLLR+YD ++G+I
Sbjct: 432 IVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSI 491

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL--SYTPSMDEIRAVAKKCF 574
               +DI   + +  R+ +G VQQEP+L +GTI DNI Y +        D +     +  
Sbjct: 492 DFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVARAIGQAN 551

Query: 575 CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 634
           C  F+  FPDG  T++G RGA LSGGQ+QRIA+ARA +  P +LILDEATSALD +SE  
Sbjct: 552 CTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEV 611

Query: 635 INYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
           +   L R ++ + +T +SIAHRLSTI+ S  ++VLG  GSV+E G F DL     SEL  
Sbjct: 612 VAKNLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNA 670

Query: 695 LLNEH 699
           LL E 
Sbjct: 671 LLAEQ 675

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  502 bits (1293), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 284/628 (45%), Positives = 390/628 (62%), Gaps = 29/628 (4%)

Query: 87  KRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLD 146
           ++P+     +    + W ++ RL +L +P+ +          IS S+ M VP VIG ++D
Sbjct: 68  RQPSSTLTPEEHNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMD 127

Query: 147 ATKDAVAQAEK-----------NETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXX 195
           A KD   QA K           +  G  +  L MP   G                     
Sbjct: 128 AAKDD-QQASKLVENDSDAAAPDADGRQIFGLTMPQFYG---------VLFSVFVVGAAA 177

Query: 196 NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
           N GR+ +LK+ GE+LVARLR + +K +L  DA F D NKVGDLISRL SDA IVS+S+T 
Sbjct: 178 NMGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQ 237

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
           N+SDG ++ + G VG GMM +IS  LT  M++ APPL   A IYGKRIR +SR LQ S G
Sbjct: 238 NMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVG 297

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
            LT+ +EEQ +  +TI+++  E   + +Y   VR+++ V  +E +TS  FF  T ++G+V
Sbjct: 298 GLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNV 357

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
           + L +L  G+ ++  G ++LG L++FM+Y  YTGSS+FG+S+FYSELMKGAGAA+R+FEL
Sbjct: 358 AVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFEL 417

Query: 436 TDYKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPS 494
            D + ++  T G   V   G+ +EF++V F+YPTR    IF+ L   I  G +VCIVGPS
Sbjct: 418 NDRRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPS 477

Query: 495 GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
           G GKST+ASLLLRFYD ++G I I GQ I+  + +  R+ LGVVQQEP+L +GTI DNI 
Sbjct: 478 GGGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIV 537

Query: 555 YGLSYTPSMDEIRAVAK---KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARAL 611
           Y +  +   DE R VA+   +  C  F++ FPDG  T++GPRG  LSGGQ+QRIA+ARA 
Sbjct: 538 YSVPQSLLNDENR-VARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAF 596

Query: 612 IKKPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAHRLSTIRRSENIVVLG 670
           +  P +LILDEATSALD  SE  +   L  R  R K  T +SIAHR+STI+ S  ++VLG
Sbjct: 597 LLDPDLLILDEATSALDSRSEEVVARALYSRSTRGK--TTISIAHRVSTIQHSSRVIVLG 654

Query: 671 NDGSVIEAGKFADLYRDEDSELFKLLNE 698
             G V+E G F +L  D DS+L  LL +
Sbjct: 655 RSGYVVETGTFDELISDPDSQLNLLLRK 682

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  501 bits (1290), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 277/627 (44%), Positives = 394/627 (62%), Gaps = 17/627 (2%)

Query: 88  RPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDA 147
           +P+    ++    + W ++ RL +L +P+ K          +S S+ M VP VIG ++D 
Sbjct: 69  KPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDV 128

Query: 148 TK-DAVAQAEKN---------ETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNF 197
            K D  + +E +           G+  +  D   +I   T                  N 
Sbjct: 129 AKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANM 188

Query: 198 GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
           GR+ +LK+ GE+LVARLR + +K  L  DA F D NKVGDLISRL SDA IVS+S+T N+
Sbjct: 189 GRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNM 248

Query: 258 SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNL 317
           SDG ++ + G VG GMM +IS  LT  M++ APPL + A +YG++IR +SR LQ S G L
Sbjct: 249 SDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGL 308

Query: 318 TRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSF 377
           T+ +EEQ +  +TI+++  E + +R Y   VR+++ V  +E +TS  FF  T ++G+ + 
Sbjct: 309 TKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAV 368

Query: 378 LLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD 437
           L +L  G+ ++  G +++G L++FM+Y  YTGSS+FG+S+FYSELMKGAGAA+R+FEL D
Sbjct: 369 LALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELND 428

Query: 438 YKKSVPSTVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGR 496
            K ++  T G+  V    + +EFK V F+YPTR    IF+ L L I PG +VCIVGPSG 
Sbjct: 429 RKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGG 488

Query: 497 GKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYG 556
           GKST+ASLLLRFYD ++G ILI GQ+I+  + +  R+ +G+VQQEP+L +GTI +NI Y 
Sbjct: 489 GKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYT 548

Query: 557 LSYTPSMDEIRAVAK---KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIK 613
           +      +E   VA+   +  C  F++ FPDG  T++GPRG  LSGGQ+QRIA+ARA + 
Sbjct: 549 VPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLL 608

Query: 614 KPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAHRLSTIRRSENIVVLGND 672
            P +LILDEATSALD  SE  I  TL  R  R K  T +SIAHR+STI+ S  ++VLG +
Sbjct: 609 DPDLLILDEATSALDSRSEEVIARTLHSRTTRGK--TTISIAHRVSTIQHSTRVIVLGRN 666

Query: 673 GSVIEAGKFADLYRDEDSELFKLLNEH 699
           G V+E G F +L  + DS+L KLL + 
Sbjct: 667 GGVVETGTFDELASNTDSQLNKLLRKE 693

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  489 bits (1259), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 275/606 (45%), Positives = 378/606 (62%), Gaps = 36/606 (5%)

Query: 99  KPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLD--ATKDA-VAQA 155
           K   W +V +LLRL KP+ K          +S ++ M++P VIG ++D  +T DA +   
Sbjct: 27  KTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDHASTPDAPIYGL 86

Query: 156 EKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLR 215
            +N+      LL + S+                       N GR+ +LK+ GE+LVARLR
Sbjct: 87  TRNQF-----LLALGSVF----------------VVGAIANSGRIIILKITGEKLVARLR 125

Query: 216 AQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMF 275
            + +K  L  DA F D+++VGDLISRL SDA IVS+S+T N+SDG +A L G VG+GMM 
Sbjct: 126 TKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMT 185

Query: 276 HISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFV 335
           +IS  LT+ M M  PPL I A +YG +I+ ISR+LQ   G L++ SEEQ N +KT++++ 
Sbjct: 186 YISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYA 245

Query: 336 AEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSL 395
            E KE++RY+  VR +FN+  +E + SA FF  T ++G+++ + +L  G+       ++L
Sbjct: 246 GERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITL 302

Query: 396 GSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG 455
           G L++FM+Y  YTGSSVFGL+ FYSELMKG GAA R+ EL + K  +  T G +  P+  
Sbjct: 303 GELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGIS-PPKTL 361

Query: 456 R---IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
           +   I F +VSF+Y    +  +  ++   I PG +VC VG SG GKSTI+SLLLR+Y   
Sbjct: 362 KGLPITFNNVSFAYSNGKS--VLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTG 419

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572
           SG I I   DIS  + +  R+ LGVVQQEP+L +GTI DNITYGL +  S+ ++    K 
Sbjct: 420 SGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGL-HDKSLTDLNMALKA 478

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632
             C  FI +   G DT++GPRGA LSGGQRQRIA+AR  ++ P ILILDEATSALD +SE
Sbjct: 479 ANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSE 538

Query: 633 GAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSEL 692
             IN  L R  +   +T +SIAHRLSTIR S  ++V+  DG V+E+G F  L    DSEL
Sbjct: 539 DIINKELQR-RQEAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSEL 596

Query: 693 FKLLNE 698
            KLL E
Sbjct: 597 NKLLKE 602

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  488 bits (1255), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 264/616 (42%), Positives = 380/616 (61%), Gaps = 13/616 (2%)

Query: 93  SRAQPAKPAGWHEVFRLLRLVKPDWKXXXXXXXXXTISCSIGMAVPKVIGLVLDATKDAV 152
           S +   K     +++ L +L KP+            I+ ++ M VP VIG +LD +    
Sbjct: 86  SNSTNTKGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIE 145

Query: 153 AQAEKNETGAP---------MSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLL 203
             + K+E                 +  ++I  +T                  N GR+ +L
Sbjct: 146 FASNKDENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIIL 205

Query: 204 KMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKA 263
           K+ GER+VARLR + +K  L  D +F D NKVGDLISRL SD+ IVS ++T N+SDG +A
Sbjct: 206 KLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARA 265

Query: 264 ALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEE 323
            + G VGVGMM  IS  L+  M+   PP+ + A IYG++IR IS++LQ+S G+LT++SEE
Sbjct: 266 VIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEE 325

Query: 324 QFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAY 383
           Q NG +TI+S+V E  E+ +Y   VR++++V   E + S  FF  T ++G+ + L +L  
Sbjct: 326 QLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYV 385

Query: 384 GSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVP 443
           G +++  G LS+G L++FM+Y  YTGSS+FGLS+FYSE+MKG+GAASR+FE+  Y   + 
Sbjct: 386 GCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDIN 445

Query: 444 STVGQTFVP-RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIA 502
           +T G   +  +D  IEF+ + F+YPTR    IF+ L + I PG +VCI+GPSG GKSTI+
Sbjct: 446 ATKGIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTIS 505

Query: 503 SLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS 562
           SLLLR+YD  +GTI I G+DI + S +  RK +GVV QEPVL +GTI +NI Y +    +
Sbjct: 506 SLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIA 565

Query: 563 MDEIR--AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620
            D+ R     +   C+ F+   P G +T +GPRG  LSGGQ+QR+A+ARA + +P +L+L
Sbjct: 566 NDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVL 625

Query: 621 DEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
           DEATSALD  SE  +  TL +   +K  T +SIAHR+STI+ S  +VVL   G V+E G 
Sbjct: 626 DEATSALDPRSESIVAQTLKQRC-AKGFTTISIAHRVSTIKHSSRVVVLDKVGHVVETGP 684

Query: 681 FADLYRDEDSELFKLL 696
           + +L   +DS L KLL
Sbjct: 685 YEELLGIKDSALNKLL 700

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  216 bits (550), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 266/515 (51%), Gaps = 20/515 (3%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSM 253
            NF + FLL +  E  +  LR + +K+ L    ++F  ++ +  ++ + + +D   + RS+
Sbjct: 786  NFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDL-RSL 844

Query: 254  THNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFA--PPLLIAATIYGKRIRAISRELQ 311
                   +   +   +  G+++ + +    A++  A  P ++I + IYG  ++    + +
Sbjct: 845  VSEFMSAMATFIVVSL-FGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYK 903

Query: 312  QSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV 371
             S  NL  +  +  + IKTIKS   EG     Y  A  +L NVA +  I +    S TN 
Sbjct: 904  SSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNT 963

Query: 372  LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASR 431
            +      ++  YG  L++ GE ++  +        +T  +   L N   ++ +G  AAS 
Sbjct: 964  ITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASW 1023

Query: 432  LFEL---TDYKKSV--PST--VGQTFVPRDGRI-EFKDVSFSYPTRPTSQIFKKLRLTIT 483
            ++ +   +D  K V  P++  V    +  D  I + K+++F+Y + P+ ++   L L + 
Sbjct: 1024 VYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKLF 1083

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
            PG  + I G SG GK+T+ SLL++FYD +   I  +G+DI     +SLR  + +V+Q+P 
Sbjct: 1084 PGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPS 1143

Query: 544  LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQ 603
            ++SG+IRDN+        S  E+  V K     +FI   P G DT+I     LLSGGQ Q
Sbjct: 1144 VLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQ 1201

Query: 604  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRS 663
            RI IARAL++KPKILILDE TSALD  S   IN  + + +    +TI+SI H  S +   
Sbjct: 1202 RICIARALLRKPKILILDECTSALDAMSADIINNLVSKELNG--VTIISITHSESMMTSC 1259

Query: 664  ENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            +N+ VL N G ++E G +  L     S L KLL++
Sbjct: 1260 QNVAVLKN-GKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  188 bits (477), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 140/511 (27%), Positives = 252/511 (49%), Gaps = 33/511 (6%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL 265
           +GER   ++R +++   L     ++D N+      +L  D   + R +    S   +A+ 
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNE------QLQGDFTQLHRCVEELRSSSAEASA 159

Query: 266 -----CGGV--GVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318
                C  +   +   F+ S +LT  ++   P + I +  +   I+  +      T    
Sbjct: 160 VTFQNCIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSA 219

Query: 319 RVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS-GTNVLGDVSF 377
           ++  E    I+ IK    + K++ ++ T++ +      +  I    + S  T++L  ++ 
Sbjct: 220 QIFTETIQNIQLIKLNNLQLKKLMKFQTSISK----CNKFFIQMCLYVSLNTSILRTLTL 275

Query: 378 LLVLA---YGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE 434
           L+ +    +GS ++ +G L +  +          GS +    +    L KG  A  ++ +
Sbjct: 276 LMFVQGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVD 335

Query: 435 LTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPS 494
             D                +  I F+++SF+YP+RP   I  ++ L     +   IVG S
Sbjct: 336 FLDEADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKS 395

Query: 495 GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
           G GKST+++LLL+FY+   G ILID  +I  ++ K+L  ++ +V+Q+  L + TIR+NI 
Sbjct: 396 GSGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNIL 455

Query: 555 YGLS-YT-------PSMDE-IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRI 605
           +G+S +T       P+++E ++         +F+   P+G DTVIG  G  LSGGQ+QR+
Sbjct: 456 FGVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRV 515

Query: 606 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSEN 665
           A+ARA ++ P ILILDEA SALDV     +   + +L RS + TI+ + H L+ I   + 
Sbjct: 516 ALARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDF 573

Query: 666 IVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
           + V+ + G +IE GK  +L  D ++E  KL+
Sbjct: 574 LYVIKH-GRIIEHGKRKELITDPNTEFHKLV 603

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  211 bits (537), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 255/551 (46%), Gaps = 30/551 (5%)

Query: 156  EKNETGAPMSLLDMPSIIGNFTXXXXXXXXXXXXXXXXXXNFGRMFLLKMLGERLVARLR 215
            + NE G+P  L+    I+                       F + F L    E  +  LR
Sbjct: 779  QNNEIGSPKYLIKWSGIV------------LFIAVLDSTFTFLKNFFLGYCSEYWIRDLR 826

Query: 216  AQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGM 273
               I+K    D  +F  D NK  ++ + + +D   +   ++  +S      +   VG+  
Sbjct: 827  MLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVSEFLSSISTLIIVSSVGIVW 886

Query: 274  MFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKS 333
             F     L+   I   P  ++ +  YG  ++    + +     L     E F GI TI+ 
Sbjct: 887  AFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELENQLHEIFRGITTIRY 946

Query: 334  FVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGEL 393
               E + + +Y    +++   +K+  IT     + +N L      ++  YG  LV  G  
Sbjct: 947  LKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTLAVQAILFYYGIKLVTTGSY 1006

Query: 394  SLGSLT---AFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYK----KSVPSTV 446
            S   +      +L+T  T  S+ G      ++ +G  AA+ +F + D +    K     +
Sbjct: 1007 STEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRIIDNQSPAAKDEKKKI 1063

Query: 447  GQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL 506
                   D  I  K++SFSYP+ P++ I+K L+L +  G  + +VG SG GKST+  L+ 
Sbjct: 1064 ASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVVGESGSGKSTLTLLIS 1123

Query: 507  RFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEI 566
              Y+  +G+I IDG DI++     LR  + VV+Q+P    GT+ +N+ YG+S   +  ++
Sbjct: 1124 ALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQV 1183

Query: 567  RAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSA 626
            +         +F+   P+G DT I    +L+SGGQ QR++IARA+++KPKIL LDE TSA
Sbjct: 1184 KEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIARAMLRKPKILFLDECTSA 1241

Query: 627  LDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYR 686
            LD  +  AI   + +      IT + I H    +R  E I VL N G V E G F DLY 
Sbjct: 1242 LDTSNTHAIANLIKKHFCG--ITTIVITHNEQMMRACERIAVLQN-GKVAEDGSFDDLYA 1298

Query: 687  DEDSELFKLLN 697
             +  E F+++N
Sbjct: 1299 -QRGEFFRIMN 1308

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/437 (27%), Positives = 204/437 (46%), Gaps = 21/437 (4%)

Query: 275 FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSF 334
           F+ S +LT  ++   P +++ + I  K I   +R     +    ++    F+  + I+ F
Sbjct: 174 FYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLF 233

Query: 335 VAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELS 394
             +  E+ ++  +V++      R  + S+  ++         F+    +G+ ++ QG L+
Sbjct: 234 CTQQFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGVLT 293

Query: 395 LGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPS----TVGQTF 450
            G +          G+++         + KG  A  ++   T  +   P      +   F
Sbjct: 294 TGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAF 353

Query: 451 VPRD---------GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI 501
           +            G I FK+VSFSYPTRP   + K + L         IVG SG GKSTI
Sbjct: 354 ILNHINANKFRCGGEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTI 413

Query: 502 ASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL---S 558
             LLL+ Y   +G I +DG DI  +    L +++ +V+Q   L + TI++NI  G    +
Sbjct: 414 GKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKA 473

Query: 559 YTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618
           Y  S+  +R   +       I   P+G DTV+G  G  LSGGQ+QR+A+ARA ++   IL
Sbjct: 474 YGDSL--VREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPIL 531

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678
           ILDEA S +D+     +   + +    K +T V + H L+ I   E+ +    +G + E+
Sbjct: 532 ILDEAISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRES 588

Query: 679 GKFADLYRDEDSELFKL 695
           G   +L ++E+S   +L
Sbjct: 589 GFKCNLEKNENSHFNRL 605

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  211 bits (536), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 258/522 (49%), Gaps = 28/522 (5%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSM 253
            NF + FLL    E  V  LR +V++K    + ++F  + NK  ++ + + +D     R +
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDL----RDL 832

Query: 254  THNISDGVKA--ALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRE 309
               +S+ + A  +      +G+++ + S   L+   I   P ++I + IYG  ++    +
Sbjct: 833  RSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETD 892

Query: 310  LQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT 369
             + S   L     +    IKTIK   AE      Y+    ++  +A +  I +    S T
Sbjct: 893  YKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMT 952

Query: 370  NVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAA 429
            N++      ++  YG  LV+  E +   +        +T  S   L +   ++ +G  AA
Sbjct: 953  NMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAA 1012

Query: 430  SRLFELTDYKKSVPST----------VGQTFVPRDGR--IEFKDVSFSYPTRPTSQIFKK 477
            S ++ + D K +               G T+  ++ +  +  ++++F+YP+ PT+ ++K 
Sbjct: 1013 SWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKN 1072

Query: 478  LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
            +   +  G  + I+G SG GKST+  LL + Y+   G I IDG D++  +  SLRK + V
Sbjct: 1073 MNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISV 1132

Query: 538  VQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALL 597
            V+Q+P+L +GTIRDN+TYGL       E+    K    H+F+   P G DT I     LL
Sbjct: 1133 VEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLL 1190

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            SGGQ QR+ IARAL++K KILILDE TSALD  S   IN  + +      +  + I H  
Sbjct: 1191 SGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GPPALLTMVITHSE 1248

Query: 658  STIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
              +R   +I VL  DG V+E G F  LY +   ELF++++  
Sbjct: 1249 QMMRSCNSIAVL-KDGKVVERGNFDTLYNNR-GELFQIVSNQ 1288

 Score =  187 bits (475), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 248/514 (48%), Gaps = 51/514 (9%)

Query: 206 LGERLVARLRAQVIKKTLHHD-AEFFDRNK--VGDL------ISRLGSDAYIVSRSMTHN 256
           +GER   R+R+Q+++  L     E++D N+  +GD       +  L S +   S     N
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDFTQINRCVEELRSSSAEASAITFQN 158

Query: 257 ISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGN 316
           +      A+C  +G    F+ S +LT  ++  +P +   A ++ + I   S +    T  
Sbjct: 159 L-----VAICALLGTS--FYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSK 211

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRY-------NTA-VRRLFNVAKREGITSATFFSG 368
             ++     N  + ++ +  +  E +++       NT  ++  F VA   GI    F + 
Sbjct: 212 AAQLLTWSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILR--FLTL 269

Query: 369 TNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGA 428
           T       F+    +GS ++ +G+L++  +          GS++    +    L KG  A
Sbjct: 270 T------MFVQGFWFGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVA 323

Query: 429 ASRLFEL-TDYKKSVP--STVGQTFVPRD---GRIEFKDVSFSYPTRPTSQIFKKLRLTI 482
             ++  L  D  K  P   TV   F P D     + F +VSFSYP+RP+  + K + L  
Sbjct: 324 MEKIMTLLKDGSKRNPLNKTVAHQF-PLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNF 382

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
           + G    IVG SG GKST+++LLLRFYD  +G+I I+G +I  +  K L +++ VV+Q  
Sbjct: 383 SAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRC 442

Query: 543 VLMSGTIRDNITYG---------LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
            L + T+R NI  G          S   +   I+   +      FI   PDG +T+IG  
Sbjct: 443 TLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTG 502

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSI 653
           G  LSGGQ+QR+AIARA I+   IL LDEA SALD+     +   + R  R  + TI+ +
Sbjct: 503 GVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAI-RHWRKGKTTII-L 560

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687
            H LS I  S++ + L  +G V+E+G  ++L  D
Sbjct: 561 THELSQI-ESDDYLYLMKEGEVVESGTQSELLAD 593

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  210 bits (535), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 152/523 (29%), Positives = 257/523 (49%), Gaps = 34/523 (6%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISR----------LG 243
            NF + FL     E  + +LR QV+++    + ++F  +R+K  ++ +           L 
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 244  SDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRI 303
            SD  I   S     S G+  AL  G  + ++          + MF P ++I + +YG  +
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGWKLSLV---------CISMF-PLIVIFSAVYGMAL 859

Query: 304  RAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSA 363
            +    + + +  +L  +  E   GIKTI+    E   +R+Y      +  +A R  IT+ 
Sbjct: 860  QRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITTG 919

Query: 364  TFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELM 423
               +    L      ++  Y   LV+ G+ +   +   +    +T  +   L +   ++ 
Sbjct: 920  LGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNILISQVPDIS 979

Query: 424  KGAGAASRLFELTDYK-------KSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFK 476
            +G  AA+R+ ++ D K       +    T   +       I  ++V+F+YP+ P+  IF 
Sbjct: 980  RGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAPSIHIFD 1039

Query: 477  KLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLG 536
             L L +  G    +VG SG GKST+ +LL + Y   SGT+L++ +D+++ + + LR+ + 
Sbjct: 1040 SLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQMS 1099

Query: 537  VVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGAL 596
            VV+Q P + SGT+R+N+ YGL + P   E+  V +    H+FI+K P G DT I     L
Sbjct: 1100 VVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID--L 1157

Query: 597  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            LSGGQ QR+ IARA++K+PKILILDE TSALD  S   IN  + R   +     +SI H 
Sbjct: 1158 LSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRRGCPAP--LTISITHN 1215

Query: 657  LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            +  ++  + I+ L N G V   G F  L + + +    + +EH
Sbjct: 1216 VDMMKACDEIIFLKN-GRVAGTGSFDALLQSDKTFRALIADEH 1257

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 133/495 (26%), Positives = 245/495 (49%), Gaps = 19/495 (3%)

Query: 205 MLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIV--SRSMTHNISDGVK 262
           +LGER    +R +++ K L +  E++D+ +  D+          V  +R+     S  + 
Sbjct: 84  LLGERCGFGIRRRLLYKYLENPFEWYDKTE--DICGNFTQQNRCVEEARASCAEASAVIT 141

Query: 263 AALCGGVG-VGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321
            +L   +  +G  F+ S +LT   +  AP +++    + ++++  +    + T   +++ 
Sbjct: 142 RSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQTSKASQLL 201

Query: 322 EEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVL 381
           +      + I+    E +E++ +   V+   N   +    S+   +    L    F+   
Sbjct: 202 DWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLSLAMFVQAF 261

Query: 382 AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
            +GS ++ +G++++G +          GS++ G       + KG+ A + + +     K+
Sbjct: 262 WFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKT 321

Query: 442 VPSTVGQT----FVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRG 497
             + + +     F    G I F++V FSYP+RP   + + + L    G    ++G SG G
Sbjct: 322 ATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSG 381

Query: 498 KSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL 557
           KS++++LLL+FY+  +G I +DG++I  +    L K++ VV+Q   + +GT+++NI  G+
Sbjct: 382 KSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGI 441

Query: 558 SYTPS---MDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKK 614
                   + +++ V +     NFI    DG +T+IG  G  LSGGQ+Q++AIARAL+K 
Sbjct: 442 DGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQKVAIARALMKD 501

Query: 615 PKILILDEATSALDVESEGAINYTLGRLMRS--KEITIVSIAHRLSTIRRSENIVVLGND 672
           P+ILILDE+ SALDV   G I     R +R+  KE T + + H L+ I  S +   L   
Sbjct: 502 PQILILDESLSALDVLQRGLI----LRAIRTHRKEKTTIILTHELNQI-GSNDFCYLIES 556

Query: 673 GSVIEAGKFADLYRD 687
           G  IE G    L  D
Sbjct: 557 GQCIEHGLEETLVND 571

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  203 bits (516), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 145/458 (31%), Positives = 229/458 (50%), Gaps = 17/458 (3%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    + ++  G+   + +   ++   A + FA  LL   +I+  +  A
Sbjct: 233 SYVLSAMVFHIIPIAFEISVVCGI---LTYQFGTSF--AAVTFATMLLY--SIFTFKTTA 285

Query: 306 ISRELQQSTG----NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGIT 361
              E ++S          V+ +     + +K F  E     +Y+ ++    N   +   +
Sbjct: 286 WRTEFRRSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQS 345

Query: 362 SATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSE 421
            A   SG N++   +   ++  G   V+ G+LS+G L             +  L + Y E
Sbjct: 346 LAFLNSGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRE 405

Query: 422 LMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG--RIEFKDVSFSYPTRPTSQIFKKLR 479
           L +       LF+L   K ++ ++     +P+D    I+F++V+F Y   P  +I +   
Sbjct: 406 LKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILENAN 463

Query: 480 LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQ 539
            T+  G    IVGPSG GKSTI  L+ RFYD   G ILIDG+DI ++  KSLR+ +GVV 
Sbjct: 464 FTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVP 523

Query: 540 QEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSG 599
           Q+  L + TI +N+ +G   T + D+IR    K      I   P G +T++G RG ++SG
Sbjct: 524 QDTPLFNDTIWENVKFG-KITATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISG 582

Query: 600 GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLST 659
           G++QR+AIAR L+K   I+  DEATSALD  +E A+  T+         T + IAHRL T
Sbjct: 583 GEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRT 642

Query: 660 IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           I  ++ IVVL N G V E GK A+L     S   +L N
Sbjct: 643 IADADKIVVLEN-GRVKEEGKHAELLSKPTSLYSELWN 679

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  206 bits (523), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 155/524 (29%), Positives = 259/524 (49%), Gaps = 39/524 (7%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDR--NKVGDLISRLGSDAYIVSRSM 253
            NF + F+L    E  +  LR + +++      E+F R  NK  ++ + L +D   + RS+
Sbjct: 765  NFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDL-RSL 823

Query: 254  THNISDGVKAALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRELQ 311
                   +   L   + VG+++ I++   L+   I   P ++I + IYG  ++      +
Sbjct: 824  VSQFLSVISTFLTVSL-VGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 312  QSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV 371
                NL  +  E   G+KTIK    +    + Y+     +  +A++  I +    + T  
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 372  LGDVSFLLVLAYGSHLVLQGELSLGSLT---AFMLYTEYTGSSVFGLSNFYSELMKGAGA 428
            +      ++  YG  LV+ GE S  ++      +L+T  T +S   L +   ++ +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 429  ASRLFELTDYKKSVPSTVGQTFVPRDGR----------------IEFKDVSFSYPTRPTS 472
            AS ++ + +  +    T  QT    DGR                +   ++ F+YPT    
Sbjct: 1000 ASWIYRIIEESED---TKEQTIT--DGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDV 1054

Query: 473  QIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLR 532
             I+  L L +  G  V IVG SG GKST+  LL + Y      I IDG D+++   ++LR
Sbjct: 1055 NIYDNLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLR 1114

Query: 533  KHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGP 592
            + + VV+Q+PVL  GT+R+N+ YGL ++P   +I  + K    ++FI   P+G +T +  
Sbjct: 1115 RQISVVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT 1174

Query: 593  RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVS 652
              +L+SGGQ QR+ IARAL++KPKILILDE TSALD  S   IN  + +      +  +S
Sbjct: 1175 --SLISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTIS 1230

Query: 653  IAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
            I H    + RS N V +  DG + E G F  L++   +EL+K++
Sbjct: 1231 ITHN-EQMMRSCNTVAVLKDGKICETGPFNKLFK-PGNELYKVV 1272

 Score =  154 bits (388), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 129/501 (25%), Positives = 224/501 (44%), Gaps = 34/501 (6%)

Query: 214 LRAQVIKKTLHHDAEFFDR--NKVGDL------ISRLGSDAYIVSRSMTHNISDGVKAAL 265
           +R +++   L    E++D+  N  GD       +  L + +   S     NIS  +    
Sbjct: 108 VRYRMLNSYLDKSMEWYDKKENLSGDFTQLNRCVEELRASSAEASAITLQNISSMLSL-- 165

Query: 266 CGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQF 325
                +G+ F+ S +LT  ++   P L+I A I+ + I+  +      +G    +     
Sbjct: 166 -----IGVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSM 220

Query: 326 NGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGS 385
           N  + IK    + KE+  +     +  +   +  +  A   S    L    F+    +G+
Sbjct: 221 NSAQMIKLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGN 280

Query: 386 HLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE-LTDYKKSVPS 444
             + +G L++  +          GS++     +   L KG  A  ++   L D K  +  
Sbjct: 281 TEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKVEIDE 340

Query: 445 TVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASL 504
           +  +        I F+ VSFSYP+RP   +   + +    G    IVG SG GKST+++L
Sbjct: 341 SALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNL 400

Query: 505 LLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMD 564
           LL+ YD   G I I    I ++  + L K++ VV+Q   L + T+ +NI  G     S D
Sbjct: 401 LLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLG-----SQD 455

Query: 565 E----------IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKK 614
           E          ++   K     + I    +G DT++G  G  LSGGQ+QR+A+ARA ++ 
Sbjct: 456 EDKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRD 515

Query: 615 PKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGS 674
            ++LILDEA SALD+     +   + +  + +  T + + H LS I   + + V+  +G 
Sbjct: 516 TEVLILDEAVSALDIVHREQLMSNITKWRQGR--TTIILTHELSQISIQDYLYVV-EEGR 572

Query: 675 VIEAGKFADLYRDEDSELFKL 695
           +IE+G    L  D DS   ++
Sbjct: 573 IIESGFQGQLMYDPDSAFCRM 593

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  203 bits (517), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 161/525 (30%), Positives = 259/525 (49%), Gaps = 40/525 (7%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSM 253
            NF + FLL    E  +  LR +++ K    +  +F  + NK  ++ + + +D     R +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDL----RDL 833

Query: 254  THNISDGVKA--ALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRE 309
               +S+ + A  +      +G+++ + S   L+   I   P ++I + IYG  ++    +
Sbjct: 834  RSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETD 893

Query: 310  LQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT 369
             + S   L     +    IKTIK   AE      Y+   +++  +A +  I +    S T
Sbjct: 894  YKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVT 953

Query: 370  NVLGDVSFLLVLAYGSHLVLQGELS---LGSLTAFMLYTEYTGSSVFGLSNFYSELMKGA 426
            N++      ++  YG  LVL  E +   +      +L+T  + +S+ G      ++ +G 
Sbjct: 954  NMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQ 1010

Query: 427  GAASRLFELTDYKK---------------SVPSTVGQTFVPRDGRIEFKDVSFSYPTRPT 471
             AAS ++ + D ++               S     G   +P    I  +++SF+YP+ P 
Sbjct: 1011 RAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIPI---ISIRNLSFAYPSAPN 1067

Query: 472  SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSL 531
              IFK + L +     + IVG SG GKST+A LL R Y+  + +I+IDG D++  +  SL
Sbjct: 1068 VPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSL 1127

Query: 532  RKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG 591
            RK + VV+Q+P    G+IRDN+TYG        EI  V K    ++F+   P G DT + 
Sbjct: 1128 RKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVD 1187

Query: 592  PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
                LLSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  + R      +T+V
Sbjct: 1188 TN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN-DIVRKGPPGLLTLV 1244

Query: 652  SIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
             I H    +R   +I VL + G V+E G F +LY  E  ELF+++
Sbjct: 1245 -ITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLYNKE-GELFRIV 1286

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 137/505 (27%), Positives = 239/505 (47%), Gaps = 33/505 (6%)

Query: 206 LGERLVARLRAQVIKKTLH------HDAE---FFDRNKVGDLISRLGSDAYIVSRSMTHN 256
           +GER   R+RAQ+++  L       +DA      D  +V   +  L S +   S     N
Sbjct: 100 IGERQGFRVRAQLLEAYLETKPMGWYDANETLLGDFTQVNRCVEELRSSSAEASAITFQN 159

Query: 257 ISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGN 316
           +      A+C  +G    F+ S +LT  ++  +P + I A I+ + I   +++    T N
Sbjct: 160 L-----VAICALIGTS--FYYSWSLTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSN 212

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
             ++     N  + ++ +  +  E +++   +        +  +  A        L    
Sbjct: 213 AAQLFTWSMNAAQLVRLYCTQPLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTM 272

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT 436
           F+    +GS ++ +G+L++  +          GS++    +    L KG  A  ++  L 
Sbjct: 273 FVQGFWFGSTMIRKGKLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALL 332

Query: 437 DY--KKSVPSTVGQTFVPRD---GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIV 491
           +   K++  +T      P +     + F++VSF+YP+RP+  + + + L    G    IV
Sbjct: 333 ESGSKQNASNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIV 392

Query: 492 GPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRD 551
           G SG GKSTI++LLL FYD   G+ILI+G++   +  K L  ++ VV+Q   L + T++ 
Sbjct: 393 GKSGSGKSTISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKK 452

Query: 552 NITYG---------LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
           NI  G          +   + + I+   +       I   PDG +T+IG  G  LSGGQ+
Sbjct: 453 NILLGSTGSIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQ 512

Query: 603 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
           QR+AIARA I+   IL LDEA SALD+     +   + R  R  + TI+ + H LS I  
Sbjct: 513 QRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAI-RHWRKGKTTII-LTHELSQIES 570

Query: 663 SENIVVLGNDGSVIEAGKFADLYRD 687
            +++ V+  +G V+E+G  ++L  D
Sbjct: 571 DDHLYVM-QEGRVVESGIQSELLAD 594

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  203 bits (516), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 155/521 (29%), Positives = 251/521 (48%), Gaps = 30/521 (5%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSM 253
            NF + FLL    E  +  LR ++++K    +  +F  + NK  ++ + + +D     R +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDL----RDL 833

Query: 254  THNISDGVKA--ALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRE 309
               +S+ + A  +      +G+++ + S   L+   I   P ++I + IYG  ++    +
Sbjct: 834  RSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETD 893

Query: 310  LQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT 369
             + S   L     +    IKTIK   AE      Y+    ++  +A +  I +    S T
Sbjct: 894  YKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMT 953

Query: 370  NVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAA 429
            N++      ++  YG  LV+  E +   + A      +T  S   L     ++ +G  AA
Sbjct: 954  NMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDISRGQRAA 1013

Query: 430  SRLF----------ELTDYKKSVPSTVGQTFVPRDGR--IEFKDVSFSYPTRPTSQIFKK 477
            S ++          E+ D    V    G T+     +  +  ++++F+YP+ P   I+K+
Sbjct: 1014 SWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKR 1073

Query: 478  LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
            + L +  G  V IVG SG GKST+  LL   Y    G I IDG D++  +  SLR+ + V
Sbjct: 1074 MDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISV 1133

Query: 538  VQQEPVLMSGTIRDNITYG-LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGAL 596
            V+Q+P L  G+IRDN+TYG L   P   E+    K    ++F+   P   DT I     L
Sbjct: 1134 VEQKPSLFDGSIRDNLTYGCLGQMPDF-ELYDALKYVGIYDFVASLPQSLDTRIDTN--L 1190

Query: 597  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            LSGGQ QR+ IARAL++K KILILDE TSALD  S   IN  + +      +  + I H 
Sbjct: 1191 LSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVKK--GPPALLTMVITHN 1248

Query: 657  LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
               +R   ++VV   DG ++E G F  LY D   ELF++++
Sbjct: 1249 EEMMRCCSSVVVF-KDGKIVEEGSFDTLYNDH-KELFRIIS 1287

 Score =  174 bits (441), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 143/519 (27%), Positives = 252/519 (48%), Gaps = 47/519 (9%)

Query: 206 LGERLVARLRAQVIKKTLHHD-AEFFDRNK--VGDL------ISRLGSDAYIVSRSMTHN 256
           +GER   R+R+ +++  L     E++D N+  +GD       +  L S +   S     N
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDFTQINRCVEELRSSSAEASAITFQN 159

Query: 257 ISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGN 316
           +      A+C  +G    F  S +LT  ++  +P + + A  + + I   +++    TG 
Sbjct: 160 L-----VAICALIGTS--FFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGK 212

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
             ++     N  + ++ +  +  E +++   V              + F+   N  G + 
Sbjct: 213 AAQLLTWSMNAAQLVRLYCTQPLERKKFEEIVSNC-----NTFFIKSCFYLAANA-GVLR 266

Query: 377 FLLV------LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAAS 430
           FL +        +GS ++ +G L++  +          G+++    +    L KG  A  
Sbjct: 267 FLTLTMFVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALE 326

Query: 431 RLFELTDY--KKSVPSTVGQTFVP----RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITP 484
           ++  L +   K++  +T+ + + P      G + F++VSF+YP+RPT  I +   +    
Sbjct: 327 KIMTLLENGPKRNTSNTI-ELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPG 385

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
           G    IVG SG GKSTI++LLL+FYD   G+I I+G++I  +  KSL +++ VV+Q   L
Sbjct: 386 GQFTFIVGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTL 445

Query: 545 MSGTIRDNITYGLS------YTPSMDEIRAVAKKC---FCHNFITKFPDGYDTVIGPRGA 595
            + T+++NI  G +       + ++D    + + C        I   PDG +T+IG  G 
Sbjct: 446 FNNTLKNNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGI 505

Query: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
            LSGGQ+QR+AIARA I+   IL LDEA SALD+     +   + R  R  + TI+ + H
Sbjct: 506 TLSGGQQQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAI-RHWRKGKTTII-LTH 563

Query: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
           +LS I  +++ + L  DG VIE+G  ++L  D  +   K
Sbjct: 564 QLSQI-EADDYLYLMQDGKVIESGIQSELLVDSTTTFSK 601

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  202 bits (515), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 148/498 (29%), Positives = 237/498 (47%), Gaps = 12/498 (2%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
            NF ++FLL  + E+ V +LR  +++  L  D  +  +NK  ++ +   +D   +    + 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVTSI 837

Query: 256  NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
             +S      +   VG+     I   LT   +   P  +   T+YG  ++    + + +  
Sbjct: 838  LLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTAVS 897

Query: 316  NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
             L  +  E   G+KTIK    E     RY T  + L    +R  I   +  + T+ L  +
Sbjct: 898  QLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLVIL 957

Query: 376  SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
               ++  YG  LV+ GE     L        +T  S  GL +      +G  A + +F +
Sbjct: 958  LQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVFGM 1017

Query: 436  T-------DYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNV 488
                    D   +V          R+  +  + ++F+YP     QI+K   L I  G+ V
Sbjct: 1018 LEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQGTKV 1077

Query: 489  CIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGT 548
             IVG SG GKST+  L+   Y     ++ IDG DI      +LRK + VV+Q+P   +GT
Sbjct: 1078 AIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFFNGT 1137

Query: 549  IRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIA 608
            IR+N+ YGL  T + +EI  V  +    NF+   P+G +T +     L+SGGQ QR++I 
Sbjct: 1138 IRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRLSIV 1195

Query: 609  RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVV 668
            RAL+++P +LILDE TSALD  +  AI   +   +   +IT++ I H    ++  + IVV
Sbjct: 1196 RALLRRPTLLILDECTSALDAANANAIANVVRNSLH--DITVIVITHSKQMMKMCDRIVV 1253

Query: 669  LGNDGSVIEAGKFADLYR 686
            L N G+V E G F DL+R
Sbjct: 1254 LKN-GAVAEDGSFDDLFR 1270

 Score =  148 bits (374), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 137/509 (26%), Positives = 237/509 (46%), Gaps = 25/509 (4%)

Query: 205 MLGERLVARLRAQVIKKTLHHDAEFFDR----NKVGDLISRLGSDAYIVSRSMTHNISDG 260
           +LGER   R+R ++++  L    +++D+    N +  + +R   +A       +  +   
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYTITNRCVEEARASCAEASGVLFQS 156

Query: 261 VKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRV 320
              AL   V     F  S+ LT   +  AP L +   ++ K ++  +    + T + +  
Sbjct: 157 AVTALILAVTA---FKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 321 SEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLV 380
                N    +K F  +  E+R++N AV        R  I S+   +    L  + F+  
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSLMMFVQA 273

Query: 381 LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDY-- 438
             YGS L+ + E+   ++      +    SS+  + +    L KG  A  ++ E  +   
Sbjct: 274 FWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEP 333

Query: 439 -----KKSVPSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIV 491
                + + P  VG      D    I F  VSF+YP RP ++    + LT  P     IV
Sbjct: 334 EGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIV 393

Query: 492 GPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRD 551
           G SG GKST+ +LLL+FY    G I ++  ++  +    L +++ +V+Q   L +GT+ +
Sbjct: 394 GKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFE 453

Query: 552 NITYGLSYTPSMDEIRAVAKKC---FCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIA 608
           NIT  LS  P      AV + C        +   P+G  T +G  G  +SGGQ+QR+A+A
Sbjct: 454 NIT--LSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALA 511

Query: 609 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVV 668
           RA+++   +LILDEA SALD+     +   + R  R+ + TI+ + H LS +   + + +
Sbjct: 512 RAILRDAPVLILDEAISALDIIHRDLLMEVI-RSWRADKTTII-LTHELSHVLDDDYLYM 569

Query: 669 LGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           + + G VIE G  ++L  + +S  F+ LN
Sbjct: 570 MEH-GQVIEQGYKSELLSNPNSR-FRALN 596

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  202 bits (513), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 139/515 (26%), Positives = 258/515 (50%), Gaps = 23/515 (4%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFD--RNKVGDLISRLGSDAYIVSRSMT 254
            F + F++    E  +  LR +V++   ++  E+F    NK  ++ +   +D   +   +T
Sbjct: 768  FSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTLVT 827

Query: 255  HNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQST 314
              ++      +    G+         L+   I   P +++ + +YG  ++    + + + 
Sbjct: 828  EFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKSAV 887

Query: 315  GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
              L     E    +KTI+    +     RY+   +R+ ++ +R  + +    + T+ L  
Sbjct: 888  AQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTL 947

Query: 375  VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE 434
                ++  YG  LV+ G+ +   +        +T  +   L N   E+ +G  AA+ ++ 
Sbjct: 948  CIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYIYR 1007

Query: 435  LTD-----------YKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTIT 483
            +             + +++P  +  T   +D  +  KD++F+YP  P+  +++ L L + 
Sbjct: 1008 ILKEAAATREHQDMHNRTLP--ISNT-SEKDTMVLVKDLTFAYPATPSKHVYEHLNLNLK 1064

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
              ++V +VG SG GKSTI SLL + YD     I +DG D+S+    SLR  + VV+Q   
Sbjct: 1065 SDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQSAN 1124

Query: 544  LMSGTIRDNITYGLSYTPSMD-EIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            L++GTIR+N+TYGL    + + ++  + K    ++F+++ P+G DT++     LLSGGQ 
Sbjct: 1125 LLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGGQA 1182

Query: 603  QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
            QR+ IARAL+K  +ILILDE TSALD  S   I   + + + +    I++I H    +R 
Sbjct: 1183 QRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGIPNT--LIIAITHDEHMMRS 1240

Query: 663  SENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
             E++++L N G+++E G F +L + +DSE  K LN
Sbjct: 1241 CESVLLLKN-GAIVEQGSFVELMQ-QDSEFKKCLN 1273

 Score =  160 bits (405), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 129/451 (28%), Positives = 220/451 (48%), Gaps = 53/451 (11%)

Query: 271 VGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTR---VSEEQFNG 327
           +G  F+ S +LT  +I+ + P++ A  IY  ++     +L+    +          +FN 
Sbjct: 155 IGTSFYYSWSLT-LIILCSTPIITAIAIYFAKLTNKYTDLENKETSYAAELLTWSMRFND 213

Query: 328 IKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHL 387
           +  +K + A+ +E+ +++T+V R  ++  +  + SA   S    L    F+    +G+ +
Sbjct: 214 M--VKFYTAQNEEISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATM 271

Query: 388 VLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKK-SVPSTV 446
           + + +L +  +                ++ F+S LM GA  +  + ++T  +K  V +  
Sbjct: 272 IRRNKLDINDV----------------ITCFHSCLMLGATVSEAMSQVTVIQKGHVANKK 315

Query: 447 GQTFVPRDGR-----------------IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVC 489
            + F+  +G+                 I F ++SF YP R ++   + + L +  G    
Sbjct: 316 LEGFLELEGKTIMQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTF 375

Query: 490 IVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTI 549
           I+G SG GKST+A LLLRFY+  SG+I +D   I  ++ + L  ++ VV+Q   L + T+
Sbjct: 376 IIGKSGSGKSTLAKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTL 435

Query: 550 RDNITYG---LSYTPSMDEI----RAVAKKC---FCHNFITKFPDGYDTVIGPRGALLSG 599
           R+NI  G    S    M+ I    R + K C     +  +    DG DTVIG  G  LSG
Sbjct: 436 RNNILLGSENQSEPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSG 495

Query: 600 GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLST 659
           GQRQR+A+ARA ++   I+I DE+ SALDV     +   + R  R  + TIV + H LS 
Sbjct: 496 GQRQRVALARAFLRNTPIMIFDESVSALDVAHRKLLMKAI-RSWRQGKTTIV-LTHELSQ 553

Query: 660 IRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
           I  ++ I ++ + G V E G   DL + E S
Sbjct: 554 INPTDFIYIMEH-GRVCEYGYQEDLLKSETS 583

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  199 bits (506), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 151/507 (29%), Positives = 246/507 (48%), Gaps = 19/507 (3%)

Query: 201  FLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSMTHNIS 258
            F+L    E  +  LR   ++K  ++  E+   D NK  +L + L +D   +  S ++ IS
Sbjct: 770  FILGYHSEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFIS 829

Query: 259  DGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318
                  +   VG+         L+   I   P L+I + IYG  ++    E + +   L 
Sbjct: 830  FVSSFVIVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLE 889

Query: 319  RVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFL 378
             V  E   G+KTI+    E     ++N   +    + +R  I +    + +N L      
Sbjct: 890  NVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTGFGVAVSNGLTMSIQG 949

Query: 379  LVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD- 437
            ++  Y   LV+ GE +   +        +T  +   L N   ++ +G  AAS+++ + + 
Sbjct: 950  ILYYYAIKLVIHGEYTTKKMFETFTLLLFTIMTCNNLVNQIPDIRRGQRAASKIYRILEG 1009

Query: 438  -YKKSVPSTVGQTFVPRDGR-----IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIV 491
              +     T G   VP         I F D+SF+YPT PT +I K L + I  G  + IV
Sbjct: 1010 IDESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIV 1069

Query: 492  GPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRD 551
            G SG GKST+ +++ R Y+  S ++ +D  D++  +   LR+ + VV+Q+P L  GTIR+
Sbjct: 1070 GESGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRE 1129

Query: 552  NITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARAL 611
            N+ YG     +  ++  + K    ++F    P+G +T I     LLSGGQ QR+ IARAL
Sbjct: 1130 NLVYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKID--SGLLSGGQNQRLCIARAL 1187

Query: 612  IKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITI--VSIAHRLSTIRRSENIVVL 669
            +++PKILILDE TSALD  S   IN     ++R    T+  +SI H    +R    + VL
Sbjct: 1188 LQRPKILILDECTSALDTMSSHIIN----EIIREGPPTMLTISITHDEQMVRACNKVAVL 1243

Query: 670  GNDGSVIEAGKFADLYRDEDSELFKLL 696
             + G ++E G   DL R +  +L+KL+
Sbjct: 1244 -DQGHIVEMGNREDLLR-QKGQLWKLV 1268

 Score =  180 bits (457), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 141/511 (27%), Positives = 249/511 (48%), Gaps = 30/511 (5%)

Query: 205 MLGERLVARLRAQVIKKTLHHDAEFFDRNKV--GDL------ISRLGSDAYIVSRSMTHN 256
           +LGER   R+R Q+I   L    +++D N    GDL      +  L S +   S     N
Sbjct: 88  LLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDLTQTNRCVEELRSSSAEASALTWKN 147

Query: 257 ISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGN 316
           +   +   +         F+ S +LT   +  AP +++ A  + + I   S +    T  
Sbjct: 148 LVTILALTVTS-------FYYSWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAI 200

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
            +++        + ++    +  E++ +  AV++      +  + ++   +    L    
Sbjct: 201 SSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTI 260

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL- 435
           F+    +GS ++ + +L +  +          G+++ G  +    L KG      + E  
Sbjct: 261 FVQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFL 320

Query: 436 --TDYKKSVPSTVGQTFVPRDG----RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVC 489
              +Y K       + ++  DG    +IE ++V F+YP+RPT    K + LT+  G    
Sbjct: 321 KKDEYLKEDFKNNRRFYL--DGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITY 378

Query: 490 IVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTI 549
           +VG SG GKS++ +LLL+ YD  +G+I IDG DI  +  KS+ K++ +V+Q   L + T+
Sbjct: 379 VVGKSGSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTL 438

Query: 550 RDNITYGLSYTPSM---DEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIA 606
           R+NI +G   T  +   + ++A  +     NFI   P+G DT+IG  G   SGGQ+QRIA
Sbjct: 439 RNNILFGSKETDELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIA 498

Query: 607 IARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENI 666
           IARA ++   IL+LDEA SALD+   G +   + R  RS++ TI+ + H LS I   +++
Sbjct: 499 IARAYMRDTPILVLDEAVSALDIIHRGLLMNAI-RNWRSEKTTII-LTHDLSEI-GPDDM 555

Query: 667 VVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           + L  DG V+E G+  +L  ++    F +++
Sbjct: 556 IYLLEDGEVVEQGQQRNLLLNQQGRFFNMVS 586

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  194 bits (492), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 150/503 (29%), Positives = 241/503 (47%), Gaps = 23/503 (4%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSD----AYIVSRSMTHNISDGV 261
           +G+  + R+  Q  +  +  D  +    + G L   +       +Y++S  + H I   V
Sbjct: 209 VGQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPITV 268

Query: 262 K-AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTR- 319
           +  A+CG +        ++   S M+++        +I+  +  A   E ++S       
Sbjct: 269 EIGAVCGILTYQFGGSFAAMTFSTMLLY--------SIFTFKTTAWRTEFRKSANKADNK 320

Query: 320 ---VSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
              V+ +     + +K F  E     +Y+ ++ +  +   +   + A   SG N++   +
Sbjct: 321 AASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNLIFTSA 380

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT 436
              ++  G   V+ GELS+G L             +  L + Y EL +       LF+L 
Sbjct: 381 LTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQ 440

Query: 437 DYKKSVPSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPS 494
             K S+ ++     +P +    I FK+VSF Y   P   I K    TI  GS   IVGPS
Sbjct: 441 RNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPS 498

Query: 495 GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
           G GKSTI  L+ RFYD   G IL+DG+D+ ++  +SLR+ +GVV Q+  L + +I DN+ 
Sbjct: 499 GSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVK 558

Query: 555 YGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKK 614
           +G     +  EI     +      I + P G DT++G RG ++SGG++QR+AIAR L+K 
Sbjct: 559 FG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKD 617

Query: 615 PKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGS 674
             I+  DEATSALD  +E A+  T+     +   T V IAHRL TI  ++ I+VL + G 
Sbjct: 618 APIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVLEH-GR 676

Query: 675 VIEAGKFADLYRDEDSELFKLLN 697
           V E GK A+L     S   +L N
Sbjct: 677 VKEEGKHAELLATPKSLYAELWN 699

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  194 bits (494), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 147/508 (28%), Positives = 244/508 (48%), Gaps = 23/508 (4%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDR--NKVGDLISRLGSDAYIVSRSM 253
            NF ++F+L    E  +  LR ++++       E++ R  NK  ++ +   +D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 254  THNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQS 313
            T  +S          +G+         L+   I   P ++I + IYG  ++      + +
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLG 373
              +L  +  E    IKTIK        +  Y+   +++  +AK+  I +    S    + 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 374  DVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTE--YTGSSVFGLSNFYSELMKGAGAASR 431
                 ++  YG  LVL GE +  S T F  +T   +T ++   L +   ++ +G  AAS 
Sbjct: 919  TCIQSILYYYGLKLVLTGEYT--SKTMFQTFTLVLFTVTTCNSLVSQIPDVSRGQRAASW 976

Query: 432  LFELTDYKKSVPSTVGQTF--------VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTIT 483
            +  + D  +      G+             D  IE ++++F YP  P   +++ L L I 
Sbjct: 977  VLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLNLKIN 1036

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
             G  + +VG SG GKST+  LL + YD     ILI+G DI+  S   LR  + VV+Q+P 
Sbjct: 1037 SGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVEQKPN 1096

Query: 544  LMSGTIRDNITYGLSYTP--SMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
            L  GTIR+NITYG+S     S  E++ + +    H F+   P   DTV+     LLSGGQ
Sbjct: 1097 LFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDI--GLLSGGQ 1154

Query: 602  RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK---EITIVSIAHRLS 658
             QR+ I R L++KPK+LILDE TS+LD ++   I   L + + +K   +I  + I H   
Sbjct: 1155 AQRLCIVRTLLRKPKVLILDECTSSLDAQTT-QIVIALIKDLNTKLGWDILTIVITHNRQ 1213

Query: 659  TIRRSENIVVLGNDGSVIEAGKFADLYR 686
             ++    +VVL + G V+E G+F DL++
Sbjct: 1214 MMQCCSRLVVL-DVGRVVEDGQFDDLHQ 1240

 Score =  173 bits (438), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 128/507 (25%), Positives = 243/507 (47%), Gaps = 27/507 (5%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFD--RNKVGDLIS--------RLGSDAYIVSRSMTH 255
           LGER   R+R++++++ L    E++D   N  GD           R GS     + ++T+
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAE---ASAVTY 149

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
                + A +C      + F+ S  LT  ++  +P +++ A  + + I+  +    + T 
Sbjct: 150 QNCVAIIALIC------VSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETA 203

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
               +     +  +T+K    + KE++++ T V +  +   R  + +A        L   
Sbjct: 204 AAADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYFIRTSLFTAANIGILRFLTLS 263

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
            F+    +GS ++ +G+L++  +          GS +    +    + KG  A +++ + 
Sbjct: 264 MFVQGFWFGSTMIRKGKLNISDVITCFYSCLMLGSILNTTLHHVIFIQKGQVALAKIQKF 323

Query: 436 TDYKKSVPSTVGQT--FVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGP 493
            +    +PS    +   V     I   +++F+YP+RPT  + K + L I       IVG 
Sbjct: 324 INESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSARTTFIVGK 383

Query: 494 SGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNI 553
           SG GKSTI +L+++FY+   G I++  +DI  V    L +++ +V+Q   L + T+++NI
Sbjct: 384 SGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLFNDTLKNNI 443

Query: 554 TYGLSYTPSMDE---IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARA 610
             G  YT        + ++       + I+  PDG +T +G  G  LSGGQ+QR+A+ARA
Sbjct: 444 LLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQQRVALARA 503

Query: 611 LIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLG 670
            ++   ILILDEA SALD+     +   + ++ ++K  T + + H L+ I  ++ I +  
Sbjct: 504 FLRDTDILILDEAVSALDIMQREILMRNISKVRQNK--TTIILTHDLNQINDNDYIYLFE 561

Query: 671 NDGSVIEAGKFADLYRDEDSELFKLLN 697
           N+  + E G    L  DE++  + + N
Sbjct: 562 NN-EIKENGFKKTLMNDENTLFYNMYN 587

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  191 bits (484), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 137/454 (30%), Positives = 218/454 (48%), Gaps = 11/454 (2%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    + ++  G+         + +T   +M      I  T +    R 
Sbjct: 216 SYVLSAMVFHIIPISFEISVVCGILTHQFGAQFAGITFLTMMLYSIFTIRTTAWRTEFR- 274

Query: 306 ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF 365
             R   ++      ++ +     + +K F  E     +YN A+    +   +   + A  
Sbjct: 275 --RSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFL 332

Query: 366 FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            SG N++   +   ++  G   +L G L++G L             +  L + Y EL + 
Sbjct: 333 NSGQNLIFTSALTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQS 392

Query: 426 AGAASRLFELTDYKKSVPSTVGQTFVPRDGR---IEFKDVSFSYPTRPTSQIFKKLRLTI 482
                 LF+L   +  + +      +P DG+   I F++V+F Y   P   I K     I
Sbjct: 393 LIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVI 450

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
             G  + IVGPSG GKSTI  L+ RFYD   G ILI+G D+ ++   SLRK +GVV Q+ 
Sbjct: 451 AAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDT 510

Query: 543 VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            L + TI +N+ +G     + +E+ A  +K      I+K   G DT++G RG ++SGG++
Sbjct: 511 PLFNDTIWENVRFG-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEK 569

Query: 603 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
           QR+AIAR L+K   I+  DEATSALD  +E  +  T+    ++   T + IAHRL TI  
Sbjct: 570 QRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIAD 629

Query: 663 SENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
           ++ I+VL  DGSV E G   +L    D  L+K L
Sbjct: 630 ADKIIVL-EDGSVKEEGTHTELLA-RDHSLYKDL 661

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
            YKL209C
          Length = 1293

 Score =  193 bits (491), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 156/518 (30%), Positives = 248/518 (47%), Gaps = 23/518 (4%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDR--NKVGDLISRLGSDAYIVSRSM 253
            NF + ++L    E  +  LR + +   ++   ++F +  NK  +L + L +D   +   +
Sbjct: 782  NFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRSLV 841

Query: 254  THNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQS 313
            +  +S      +   VG+         L+   I   P +++ + IYG  ++      + +
Sbjct: 842  SEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTA 901

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLG 373
               L     E    IKTI+   A    ++ Y      L  +A +  I +    S TN + 
Sbjct: 902  VAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIA 961

Query: 374  DVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF 433
                 ++  YG  LV +GE S   +        +T  S   L +   ++ +G  AAS L+
Sbjct: 962  VCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLY 1021

Query: 434  ----ELTDYKKSVPSTVGQTFVPRDGR------IEFKDVSFSYPTRPTSQIFKKLRLTIT 483
                E  D K+SV S      +   G       I  K++ FSYP+  T +I+K + L +T
Sbjct: 1022 RILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVT 1081

Query: 484  PGS-NVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
                 + IVG SG GKST+  LL + Y   + +I IDG D+++     LRK + VV+Q P
Sbjct: 1082 SSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNP 1141

Query: 543  VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
             L  GT+RDN+ YG     S  EI  V K    + FI   P G D+ I  +  L+SGGQ 
Sbjct: 1142 TLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQA 1199

Query: 603  QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIA--HRLSTI 660
            QR+ IARAL++KP ILILDE TSALD  S   IN     L+++   T+++I   H    +
Sbjct: 1200 QRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQMM 1255

Query: 661  RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
                ++ V+  DG + E G FA+L ++ +SEL +++NE
Sbjct: 1256 EACNSLAVI-KDGRLAEQGNFAELMKN-NSELRRIINE 1291

 Score =  184 bits (468), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 142/511 (27%), Positives = 245/511 (47%), Gaps = 28/511 (5%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA- 264
           LGER    +R +++ + L    E++D +       +L  D   V+R +    S   +A+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCH------DKLLGDFTQVNRCVEELRSSSAEASA 153

Query: 265 ------LCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318
                 +     +G  F+ S +LT  ++  AP +++ A ++   I   +      TG   
Sbjct: 154 ITFQNFVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAA 213

Query: 319 RVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFL 378
           ++     N  + +K +  +  E+  +   V +  ++  +     +   S    L    F+
Sbjct: 214 QLLNWSMNSAQLVKLYCTQAYEIHSFKELVGQCNDLFIKSCFYVSANTSILRFLSLSMFV 273

Query: 379 LVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDY 438
               +G+ +V +G+LS+  +          GS++         L KG  A  ++ +   +
Sbjct: 274 QGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISF 333

Query: 439 KKSVPSTV--GQTFVP-RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
            +  PS     +  VP  +G I F+++SF+YPTRP   + K + +T  PG +  I+G SG
Sbjct: 334 SQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSG 393

Query: 496 RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
            GKST+A+LLL+FY+   G+I I   ++ K++   L +++ VV+Q   L + T+R+N+  
Sbjct: 394 SGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLL 453

Query: 556 GLSYTPSMDE---------IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIA 606
           G+S +    E         ++   +       I + PDG DT+IG  G  LSGGQ+QR+A
Sbjct: 454 GISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVA 513

Query: 607 IARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENI 666
           IARA IK   +LILDEA SALD+     I   +    RS + TI+ + H LS +   + +
Sbjct: 514 IARAYIKDSSVLILDEAVSALDIIHRELIMKAIKN-WRSGKTTII-LTHDLSQLDYDDFL 571

Query: 667 VVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
            V   DG V E+G    L +DE +   KL +
Sbjct: 572 YVF-EDGEVKESGYQQALLQDEKTIFSKLYD 601

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  188 bits (477), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 137/432 (31%), Positives = 214/432 (49%), Gaps = 14/432 (3%)

Query: 263 AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSE 322
           + +CG +        ++   S M++++    I  T +  + R   R+  ++      V+ 
Sbjct: 244 SVVCGILTYQFGASFAAITFSTMLLYSM-FTIKTTAWRTKFR---RDANKADNKAASVAL 299

Query: 323 EQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLA 382
           +     + +K F  E     +YN+++    +   +   + A   SG N++   +   ++ 
Sbjct: 300 DSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMY 359

Query: 383 YGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL----TDY 438
            G   V+ G L++G L             +  L + Y +L +       LF+L       
Sbjct: 360 MGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRRNEVKI 419

Query: 439 KKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
           K +    +    VP D  I F++V+F Y   P  +I K    TI  G    IVG SG GK
Sbjct: 420 KNAERPLMLPEHVPYD--ITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGK 475

Query: 499 STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558
           STI  L+ RFYD  SG ILI+G+DI +    +LRK +GVV Q+  L + TI +N+ +G  
Sbjct: 476 STILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVPQDTPLFNDTIWENVKFG-R 534

Query: 559 YTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618
              + +E+  V +K      I K P G+DT++G RG ++SGG++QR+AIAR L+K  KI+
Sbjct: 535 IDATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNAKIM 594

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678
             DEATSALD  +E A+  T+     S   T V IAHRL TI  ++ I+VL N G V E 
Sbjct: 595 FFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREE 653

Query: 679 GKFADLYRDEDS 690
           GK  +L    +S
Sbjct: 654 GKHLELLATPNS 665

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  187 bits (475), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 137/459 (29%), Positives = 225/459 (49%), Gaps = 19/459 (4%)

Query: 246 AYIVSRSMTHNISDGVK-AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIR 304
           +Y++S  + H I   V+  A+CG +        ++   + M+++        +I+  +  
Sbjct: 225 SYVLSAMVFHIIPITVEIGAVCGILTYQFGASFAAMTFTTMLLY--------SIFTFKTT 276

Query: 305 AISRELQQSTGNLTR----VSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGI 360
           A   E ++S          V+ +     + +K F  E     +Y+ ++ +  +   +   
Sbjct: 277 AWRTEFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQ 336

Query: 361 TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYS 420
           + A   +G N +   +   ++  G   V+ G LS+G L             +  L + Y 
Sbjct: 337 SLAFLNAGQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYR 396

Query: 421 ELMKGAGAASRLFELTDYKKSVPSTVGQTFVP--RDGRIEFKDVSFSYPTRPTSQIFKKL 478
           EL +       LF+L   K  + +      +   R  +I F++VSF Y   P   I K  
Sbjct: 397 ELKQSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSKIVFENVSFGYD--PDRMILKNS 454

Query: 479 RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVV 538
             T+  G    IVGPSG GKSTI  L+ RFYD   G IL+DG+D+ ++  +SLR+ +GVV
Sbjct: 455 SFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVV 514

Query: 539 QQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLS 598
            Q+  L + +I +N+ +G   + S +EIR   +K    + + + P G DT++G RG ++S
Sbjct: 515 PQDTPLFNDSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMIS 573

Query: 599 GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLS 658
           GG++QR+AIAR L+K   I+  DEATSALD  +E A+  T+     +   T V IAHRL 
Sbjct: 574 GGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLR 633

Query: 659 TIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           TI  ++ I+V+   G V E GK A+L     S   +L N
Sbjct: 634 TIADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWN 671

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 135/442 (30%), Positives = 219/442 (49%), Gaps = 11/442 (2%)

Query: 246 AYIVSRSMTHNISDGVK-AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIR 304
           +Y+++  + H I    + + +CG +        ++   S M++++    I  T +    R
Sbjct: 229 SYVLTAMVFHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSM-FTIKTTAWRTNFR 287

Query: 305 AISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSAT 364
              R+  ++      V+ +     + +K F  E     +YN ++    +   +   + A 
Sbjct: 288 ---RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAF 344

Query: 365 FFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMK 424
             SG N++   +   ++  G   V+ G+L++G L             +  L + Y EL +
Sbjct: 345 LNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 404

Query: 425 GAGAASRLFELTDYKKSVPSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTI 482
                  LF+L   +  + +      +P      I F++V+F Y   P  +I K    TI
Sbjct: 405 SLIDMEALFKLRKNEIKIKNAERPLMLPEHVPYDITFQNVTFGY--HPDRKILKNASFTI 462

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
             GS   IVG SG GKSTI  L+ RFYD  SG ILI+G+DI +    +LRK +GVV Q+ 
Sbjct: 463 PAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDT 522

Query: 543 VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            L + TI +N+ +G     + +E+  V +K      I K P G++T++G RG ++SGG++
Sbjct: 523 PLFNDTIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEK 581

Query: 603 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
           QR+AIAR L+K  +I+  DEATSALD  +E A+  T+     S   T V IAHRL TI  
Sbjct: 582 QRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIAD 641

Query: 663 SENIVVLGNDGSVIEAGKFADL 684
           ++ I+V  N G V E GK  +L
Sbjct: 642 ADKIIVFDN-GKVREEGKHLEL 662

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 130/424 (30%), Positives = 212/424 (50%), Gaps = 10/424 (2%)

Query: 263 AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSE 322
           + +CG +        ++   S M++++    I  T +    R   R+  ++      V+ 
Sbjct: 245 SVVCGILTYQFGASFAAITFSTMLLYSI-FTIKTTAWRTHFR---RDANRADNKAASVAL 300

Query: 323 EQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLA 382
           +     + +K F  E     +YN+++    +   +   + A   SG N++   +   ++ 
Sbjct: 301 DSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMY 360

Query: 383 YGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSV 442
            G   V+ G+L++G L             +  L + Y +L +       LF+L   +  +
Sbjct: 361 MGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKI 420

Query: 443 PSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
            S      +P      I F++V+F Y   P  +I K    TI  G    IVG SG GKST
Sbjct: 421 KSVERPLMLPEHVPYEITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKST 478

Query: 501 IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
           I  L+ RFYD  SG ILI+G+DI +    +LR+ +GVV Q+  L + TI +N+ +G    
Sbjct: 479 ILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLFNDTIWENVKFG-RID 537

Query: 561 PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620
            + +E++   +K      I K P G++T++G RG ++SGG++QR+AIAR L+K  +I+  
Sbjct: 538 ATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRLAIARVLLKNARIMFF 597

Query: 621 DEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
           DEATSALD  +E A+  T+     S   T V IAHRL TI  ++ I+VL N G+V E GK
Sbjct: 598 DEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKIIVLDN-GTVKEDGK 656

Query: 681 FADL 684
             +L
Sbjct: 657 HIEL 660

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  189 bits (481), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 153/518 (29%), Positives = 253/518 (48%), Gaps = 26/518 (5%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSMT 254
            F + F L  + E  +  LR + ++   + + E+F  D NK  +L + + +D   +   ++
Sbjct: 763  FLKSFSLGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLIS 822

Query: 255  HNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQST 314
              IS      +    G+         L+   I   P +++ + IYG  ++      + + 
Sbjct: 823  EFISAMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTV 882

Query: 315  GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
             +L     E   GIKTI+    E   ++RY+    R+ ++ ++  I +    + T  L  
Sbjct: 883  ADLENCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVM 942

Query: 375  VSFLLVLAYGSHLVLQGE---LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASR 431
                ++  YG  LV  GE   + +      +L+T  T +S   L N   ++ +G  AASR
Sbjct: 943  CIEAILFYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTS---LINQIPDVTRGQRAASR 999

Query: 432  LFELTDYKKSV---PSTVGQTF-VPRDGRIE----FKDVSFSYPTRPTSQIFKKLRLTIT 483
            +F + D            G+T  +P++  I+      ++ F YP+  +S +F +L L I 
Sbjct: 1000 IFRILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIA 1059

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
                V +V  SG GKST+  LL R Y  +  +I IDG DI++    SLR  + +V+Q+P 
Sbjct: 1060 DNQTVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPT 1119

Query: 544  LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQ 603
            L  G+IR N+ YG        +I  V K+    +F+T  P+G DT +    +LLSGGQ Q
Sbjct: 1120 LFEGSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQ 1177

Query: 604  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS--KEITIVSIAHRLSTIR 661
            RI IARAL++K KILILDE TSALD ES     + +  L++S    +  ++I H    +R
Sbjct: 1178 RICIARALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMR 1233

Query: 662  RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
               N++VL  DG   + G F +LY+   +EL +++  H
Sbjct: 1234 ACGNVIVL-QDGETAQQGTFDELYK-PGNELHRIVIAH 1269

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 131/515 (25%), Positives = 240/515 (46%), Gaps = 40/515 (7%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNK--VGDLIS--------RLGSDAYIVSRSMTH 255
           +GE    R+R  ++   L    E+FD N   +GD +         R GS     + ++T 
Sbjct: 96  IGETQSFRIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAE---ASAITF 152

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
                + A +C        F+ S +LT  ++  +P L++ A  + + I   ++     TG
Sbjct: 153 QNFVAIIALVCTS------FYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETG 206

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV---- 371
              +      N  + +K +  +  E++++   V R       +   +A F+   N     
Sbjct: 207 IAAQSLTWSMNAAQLVKLYCTQDFEIKKFKEIVIRC-----NDYFINAWFYVSANTSILR 261

Query: 372 -LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAAS 430
            L    F+    +GS ++ + ++S+  +          GS +         L K     +
Sbjct: 262 FLSLAMFVQGFWFGSTMIKKNKMSVDQVITCFSSCLMLGSILNTTLPQIVLLQKAHVGLN 321

Query: 431 RLFELTDYKKSVPSTVG-QTFVPRDG---RIEFKDVSFSYPTRPTSQIFKKLRLTITPGS 486
           R+ +  + K  + +    QT +  D     I F  +SF YP+RP   + K + +   P  
Sbjct: 322 RVQDFLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNK 381

Query: 487 NVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMS 546
              IVG SG GKST+++LLL+FY+  +G I ++G ++  +    + K++ +V+Q+  L +
Sbjct: 382 TTFIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFN 441

Query: 547 GTIRDNITYGLSYTPSMDEIRA-VAKKC---FCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            T+R+N+  GLS+  + +++ + + + C      N I K P G DT +G  G  LSGGQ+
Sbjct: 442 DTLRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQ 501

Query: 603 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
           QR+A+ARA ++   ++ILDEA SALD  +   +   +    RSK  T + + H L+ I  
Sbjct: 502 QRVALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSK--TAIILTHELNQILP 559

Query: 663 SENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           S+ + ++ N G + E G   +L  + +S   K  +
Sbjct: 560 SDFLYLMEN-GQIKEEGYQNELIENVESTFCKFFH 593

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  186 bits (472), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 132/424 (31%), Positives = 210/424 (49%), Gaps = 10/424 (2%)

Query: 263 AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSE 322
           + +CG +        ++   S M++++    I  T +    R   R+  ++      V+ 
Sbjct: 244 SVVCGILTYQFGASFAAITFSTMLLYSI-FTIKTTAWRTHFR---RDANKADNKAASVAL 299

Query: 323 EQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLA 382
           +     + +K F  E     +YN ++    +   +   + A   SG N++   +   ++ 
Sbjct: 300 DSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNSGQNLIFTTALTAMMY 359

Query: 383 YGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSV 442
            G   V+ G L++G L             +  L + Y +L +       LF+L   +  +
Sbjct: 360 MGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMETLFKLRKNEVKI 419

Query: 443 PSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
            +      +P +    I F++V+F Y   P  +I K    TI  G    IVG SG GKST
Sbjct: 420 KNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAGWKTAIVGSSGSGKST 477

Query: 501 IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
           I  L+ RFYD  SG ILI+G+DI +    +LRK +GVV Q+  L + TI +N+ +G    
Sbjct: 478 ILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFNDTIWENVKFG-RID 536

Query: 561 PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620
            + +E+  V +K      I K P G+DT++G RG ++SGG++QR+AIAR L+K  +I+  
Sbjct: 537 ATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFF 596

Query: 621 DEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
           DEATSALD  +E A+  T+     S   T V IAHRL TI  ++ I+VL N G V E GK
Sbjct: 597 DEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADKIIVLDN-GRVREEGK 655

Query: 681 FADL 684
             +L
Sbjct: 656 HLEL 659

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  185 bits (469), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 218/454 (48%), Gaps = 9/454 (1%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    + ++  G+         + +T   ++         T +    R 
Sbjct: 246 SYVLSAMVFHMIPITFEISVVCGILTYQFGSSFAAMTFVTMLLYSFFTFKTTAWRTEFR- 304

Query: 306 ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF 365
             R   ++      V+ +     + +K F  E     +Y+ ++ +  +   +   + A  
Sbjct: 305 --RSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFL 362

Query: 366 FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            +G N +   +   ++  G+  V++G L++G L             +  L + Y EL + 
Sbjct: 363 NAGQNFIFTSALTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQS 422

Query: 426 AGAASRLFELTDYKKSVPSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTIT 483
                 LF+L      + +T     +P      I+F++V+F Y  +P   I K    TI 
Sbjct: 423 LIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATFTIA 480

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
           PG    IVGPSG GKSTI  L+ RFYD   G IL+DG+DI ++    LR+ +GVV Q+  
Sbjct: 481 PGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTP 540

Query: 544 LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQ 603
           L + TI +N+ +G     + +EI    +K    + I K P G +T++G RG ++SGG++Q
Sbjct: 541 LFNDTIWENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQ 599

Query: 604 RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRS 663
           R+AIAR L+K   I+  DEATSALD  +E ++  T+         T V IAHRL TI  +
Sbjct: 600 RLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADA 659

Query: 664 ENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           + I+VL N G+V E G    L  + +S   +L N
Sbjct: 660 DKIIVLEN-GAVREEGTHNALLANPNSLYSELWN 692

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  184 bits (466), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 133/452 (29%), Positives = 224/452 (49%), Gaps = 19/452 (4%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA-----ATIYG 300
           +Y++S  + H I    + ++  G+   + +   ++   A I F+  LL +      T + 
Sbjct: 225 SYVLSAMVFHIIPITFEISMVCGI---LTYQFGASF--AAITFSTMLLYSIFTFRTTAWR 279

Query: 301 KRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGI 360
            R R   R+  ++      V+ +     + +K F  E     +Y+T++ +  +   +   
Sbjct: 280 TRFR---RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQ 336

Query: 361 TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYS 420
           + A   +G N++   +   ++    + V+QG L++G L             +  L + Y 
Sbjct: 337 SLAFLNTGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYR 396

Query: 421 ELMKGAGAASRLFELTDYKKSVPSTVGQTFVP--RDGRIEFKDVSFSYPTRPTSQIFKKL 478
           +L +       LF+L   + ++ ++     +P  +   I F++V+F Y   P  +I   +
Sbjct: 397 DLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNV 454

Query: 479 RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVV 538
             TI  G    IVGPSG GKSTI  L+ RFY+   G IL+ G DI  +   SLRK +GVV
Sbjct: 455 SFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVV 514

Query: 539 QQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLS 598
            Q+  L + TI +N+ +G + + S DEI    +K      +   P G  TV+G RG ++S
Sbjct: 515 PQDTPLFNDTIWENVKFG-NISSSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMIS 573

Query: 599 GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLS 658
           GG++QR+AIAR L+K   ++  DEATSALD  +E A+ +T+ +   S   T V +AHRL 
Sbjct: 574 GGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLR 633

Query: 659 TIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
           TI  ++ I+VL   GSV E G  + L   + S
Sbjct: 634 TIADADKIIVL-EQGSVREEGTHSSLLASQGS 664

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  187 bits (474), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 153/519 (29%), Positives = 255/519 (49%), Gaps = 24/519 (4%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSM 253
            NF + FLL    E  +  LR +V++K       +F  + NK  ++ + + +D   + RS+
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDLRDL-RSL 861

Query: 254  THNISDGVKAALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRELQ 311
                   + + +     +G+++ ++S   L+   I   P ++I + IYG  ++    + +
Sbjct: 862  VSEFLSAITSFITVSF-IGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETDYK 920

Query: 312  QSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV 371
             S   L     +    IKTIK   AE      Y+    ++  +A +  I +    S TN+
Sbjct: 921  TSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMTNM 980

Query: 372  LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASR 431
            +      ++  YG  LV+  E +   +        +T  S   L +   ++ +G  AAS 
Sbjct: 981  IAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASW 1040

Query: 432  LFELTDYKKSVPST----------VGQTFVPRDGR--IEFKDVSFSYPTRPTSQIFKKLR 479
            ++ + D K+               +G+T+  +     +  ++++F+YP+ P+  I+K + 
Sbjct: 1041 IYRILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQNLTFAYPSAPSVLIYKNMN 1100

Query: 480  LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQ 539
            L +  G  + IVG SG GKST+  LL R YD   G+I +DG D++  +   LR+ + VV+
Sbjct: 1101 LNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREISVVE 1160

Query: 540  QEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSG 599
            Q+P+L +GTIRDN+TYG        EI    K    ++F+   P G  T I     LLSG
Sbjct: 1161 QKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN--LLSG 1218

Query: 600  GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLST 659
            GQ QR+ IARAL++KPKILILDE TSALD  S   I   + +      +  + I H    
Sbjct: 1219 GQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK--GPPALLTLVITHDEQM 1276

Query: 660  IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            +R  ++I V   DG VIE G F  LY +   E+F++++E
Sbjct: 1277 MRCCDSIAVF-KDGKVIEEGSFDTLYNN-CGEMFRIVSE 1313

 Score =  172 bits (436), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 140/516 (27%), Positives = 240/516 (46%), Gaps = 41/516 (7%)

Query: 206 LGERLVARLRAQVIKKTLH---------HDAEFFDRNKVGDLISRLGSDAYIVSRSMTHN 256
           +GE+   R+R+Q+++  L          +D    D  ++   +  L S +   S     N
Sbjct: 125 IGEKQGLRIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEELRSSSAEASAITFQN 184

Query: 257 ISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGN 316
           +      A+C  +G    F+ S +LT  ++  +P +   A  + + +   S++  + T  
Sbjct: 185 L-----VAICALLGTS--FYYSWSLTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSK 237

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT----NVL 372
             ++     N  + ++ +  +  E +++    +R+        I S  F +        L
Sbjct: 238 AAQLFAWSMNAAQLVRLYCTQPLERKKF----QRIILSCNTFFIKSCLFVAANAGILRFL 293

Query: 373 GDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL 432
               F+    +GS ++ QG+L++  +          GS++    +    L KG  A  ++
Sbjct: 294 TLTMFVQGFWFGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKI 353

Query: 433 FELTDY--KKSVPSTVGQTFVPRD---GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSN 487
             L +   K + P+ +     P D     + F +VSFSYP+RP+  + +   L    G  
Sbjct: 354 MNLLENGPKCNPPNEIELHQYPLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQF 413

Query: 488 VCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSG 547
             IVG SG GKST++SLLL+FYD   G+I I+G++I  +  K L K++ VV+Q   L + 
Sbjct: 414 TFIVGKSGSGKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFND 473

Query: 548 TIRDNITYG---------LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLS 598
           T+R NI  G          S   + + I+   +       I   PDG +T+IG  G  LS
Sbjct: 474 TLRKNILLGSTELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLS 533

Query: 599 GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLS 658
           GGQ+QR+A+ARA I+   IL LDEA SALD+     +   + R  R  + TI+ + H L 
Sbjct: 534 GGQQQRVAMARAFIRDTPILFLDEAVSALDIIHRNLLMKAI-RHWRKGKTTII-LTHELG 591

Query: 659 TIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
            +  S++ + L  +G VIE+G  ++L  D  S   K
Sbjct: 592 QV-ESDDHLYLMQEGKVIESGTQSELLADSTSTFSK 626

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  186 bits (471), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 142/516 (27%), Positives = 245/516 (47%), Gaps = 29/516 (5%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSMT 254
            F + F+L +  E  +  LR + + +  + D  +F  D NK  ++ + + +D   +   ++
Sbjct: 808  FLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVS 867

Query: 255  HNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAAT-IYGKRIRAISRELQQS 313
              +S          +G+   F +S    S + +   PL I  T IYG  ++    + + +
Sbjct: 868  GFLSAVTTLIFVSAIGLAWAF-VSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKTA 926

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLG 373
               L     E   GIKT++    E     +Y      + + ++R  + +    + +N L 
Sbjct: 927  VAELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNALV 986

Query: 374  DVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF 433
                 ++  YG  LV+ GE +  +L        +T  +   L        +G  AA+ +F
Sbjct: 987  IGVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFSRGRRAATYVF 1046

Query: 434  ELTDYKKSVPSTVGQTFVPRDGRIE-------------FKDVSFSYPTRPTSQIFKKLRL 480
             + + +    S      +  D R E              +D++F+YP+    +++KKL L
Sbjct: 1047 RILNTRSDFLS------IDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLSL 1100

Query: 481  TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
            TI  G N+ IVG SG GKST+  +L   Y  N  T+ ID  DI K +  SLRKH+ +V+Q
Sbjct: 1101 TINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQ 1160

Query: 541  EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
            +     G+IRDN+ YGL    +  +I  V       +F+ + P G +T I     L+SGG
Sbjct: 1161 KAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGG 1218

Query: 601  QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
            Q QRI+I RAL+++PK+LILDE TS+LD ++  AI   +G  +    IT + I H  + +
Sbjct: 1219 QAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG--ITTIVITHN-TQM 1275

Query: 661  RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
             +S N ++   +G + E G F +L  D   + ++++
Sbjct: 1276 MKSCNRILFFKNGRISEEGTFQEL-SDSRRDFYRMI 1310

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 233/510 (45%), Gaps = 47/510 (9%)

Query: 205 MLGERLVARLRAQVIKKTLHHDAEFFDRNK--VGDL--ISRLGSDAYIVSRSMTHNISDG 260
           +LGER   R+R +++   L     ++D N+   GD   I R G +    S + +  ++  
Sbjct: 101 LLGERQGFRVRRRLLGAYLSKTMAWYDTNENLEGDFTQIHR-GVEELRSSAAESSAVTFL 159

Query: 261 VKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA-ATIYGKRIRAISRELQQSTGNLTR 319
               +   +   + F  S TL   +I+ + PL+IA A I+ K +   +      T +   
Sbjct: 160 NAVTVVTLLTTSLYFSWSLTL---VILASTPLIIALAIIFSKLVEKYTELENTETSHAAS 216

Query: 320 VSEEQFNGIKTIKSFVAEGKEMRRYNTAVRR----LFNVAKREGITSATFFSGTNVLGDV 375
           +        + I+ F  E  E+++++ +V++      N++K      A+       L  +
Sbjct: 217 ILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQASL----RGLSLI 272

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL 435
            F+    +G+ ++ +G+L+ G +          G+++         + KG  A  ++  +
Sbjct: 273 MFVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSM 332

Query: 436 TDYKKSV------------PSTVGQTFV----PRDGRIEFKDVSFSYPTRPTSQIFKKLR 479
            + +               PS +   FV    P+  +I F++VSFSYP+RP       + 
Sbjct: 333 VESESDALRGRRGETFEIFPSPISGMFVSPVFPK--QITFENVSFSYPSRPNEYALDNVS 390

Query: 480 LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQ 539
           LT  P     IVG SG GKST+++LLL+ Y    GTI +   DI       L +++ +V+
Sbjct: 391 LTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVE 450

Query: 540 QEPVLMSGTIRDNITYGLSYTPSMDE-----IRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
           Q   L +    D++   L  T   D      I+   +       +   PDG  TVIG  G
Sbjct: 451 QSCTLFN----DSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNG 506

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIA 654
             LSGGQ+QR+A+ARA+++   +LILDE+ SALD+     +   + R  R+ + TI+ + 
Sbjct: 507 ISLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVI-RNWRAGKTTII-LT 564

Query: 655 HRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
           H LS I   ++ + L  DG V E G   DL
Sbjct: 565 HELSHI-LDDDYLYLMEDGKVGEHGYKRDL 593

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  182 bits (463), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 225/456 (49%), Gaps = 12/456 (2%)

Query: 246 AYIVSRSMTHNISDGVK-AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIR 304
           +Y++S  + H +    + + +CG +        ++   + MI+++    I  T +  + R
Sbjct: 225 SYVLSAMVFHILPITFEISVVCGILTYQFGASFAAITFTTMILYSI-FTIRTTAWRTQFR 283

Query: 305 AISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSAT 364
              R+  ++      V+ +     + +K F  E     +Y+T++ +  +   +   + A 
Sbjct: 284 ---RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAY 340

Query: 365 FFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMK 424
             SG N++   +   ++  G   V+ G+L++G L             +  L + Y EL +
Sbjct: 341 LNSGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQ 400

Query: 425 GAGAASRLFELTDYKKSVPSTVGQTFV-PRDG--RIEFKDVSFSYPTRPTSQIFKKLRLT 481
                  LF+L   +  + +      +   DG   I F++V+F Y ++   +I      T
Sbjct: 401 SLIDMESLFQLRKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSK--RKILNNASFT 458

Query: 482 ITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           I  G    +VGPSG GKSTI  L+ RFYD   G ILI+G D+ +    SLR+ +GVV Q+
Sbjct: 459 IPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQD 518

Query: 542 PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
             L + TI +N+ +G     + +E+  V +K      I K P GY+T++G RG ++SGG+
Sbjct: 519 TPLFNDTIWENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGE 577

Query: 602 RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
           +QR+AIAR L+K  KI+  DEATSALD  +E A+  T+     S   T V IAHRL TI 
Sbjct: 578 KQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIA 637

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
            ++ I+VL  DG+V E G  + L     S    L N
Sbjct: 638 DADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWN 672

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  184 bits (468), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 140/517 (27%), Positives = 240/517 (46%), Gaps = 29/517 (5%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNK-----VGDLISRLGSDAYIVSR 251
            F + F L   GE  +  LR +  K   + +  +F+  +     V  L+     D   ++ 
Sbjct: 791  FLKCFTLSKCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVSSLVINDLRDLRALAS 850

Query: 252  SMTHNISDGVKAALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRE 309
                 ++  V  + CG     +++ ++S   L+   I   P  ++    YG  ++     
Sbjct: 851  EFLAAVTTLVVVSFCG-----LIWALASGWKLSLVCISLIPAFILFTGAYGGLLQKCEAN 905

Query: 310  LQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT 369
             + +  ++          IKTI+    E + ++ Y     +     ++  + +    + +
Sbjct: 906  YKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALS 965

Query: 370  NVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAA 429
            N L  ++  ++L YG  LV+ GE S   +   +    +T  +   L     E+ +G  AA
Sbjct: 966  NALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAA 1025

Query: 430  SRLFELTDYKKSVP-------STVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTI 482
            + LF + D +           S +       +  I  KD+ FSY       +++ L L++
Sbjct: 1026 TYLFRILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSV 1085

Query: 483  TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
              G  V +VG SG GKST+  L+ R Y   SG+I  DG D+++    +LRK + VV+Q P
Sbjct: 1086 KAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRP 1145

Query: 543  VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
             L  G+I DN+TYGLS +    EIR + +     +F+   P G  + I     +LSGGQ 
Sbjct: 1146 SLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTD--VLSGGQL 1203

Query: 603  QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMR--SKEITIVSIAHRLSTI 660
            QR+AI RAL++KP++L+LDE TSALD +      + +   +R  S+  T + + H    +
Sbjct: 1204 QRLAIVRALLRKPQLLVLDECTSALDAQH----GFIMSEFVRQGSQSTTTLVLTHSEQMM 1259

Query: 661  RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
            R    I+   N G++IE G F  LY  +  ELFK+L+
Sbjct: 1260 RACNRILTFAN-GNIIEDGSFERLY-SQKGELFKILS 1294

 Score =  158 bits (399), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 141/509 (27%), Positives = 237/509 (46%), Gaps = 31/509 (6%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNK--VGDL------ISRLGSDAYIVSRSMTHNI 257
           LGER   RLR ++++  L     ++D N+   GD       +  L S +   S  +  N+
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNV 158

Query: 258 SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA-ATIYGKRIRAISRELQQSTGN 316
                AAL   +G  + +  S TL   +IM   PL+I  A  + +++   ++     T +
Sbjct: 159 V--TVAAL---LGSALYYSWSLTL---IIMANSPLVIGFAVFFSRKVEKYAKRENSETSS 210

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
                    +  K ++    + +E+ R+   V++      +  + S+  +S    L    
Sbjct: 211 AADAMAWSLDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCM 270

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT 436
           F+    YG+  +  G+L  G +           S++    +    L KGA    ++    
Sbjct: 271 FVQGFWYGNSRINIGKLKPGDVVTCFSSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFV 330

Query: 437 ---DYKKSVPSTVGQTF--VP---RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNV 488
              D  +S  + V  +F  +P       I F++V F+YPTRP   + K + L    G   
Sbjct: 331 NSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETT 390

Query: 489 CIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGT 548
            ++G SG GKSTI +LLL FY   SGTI ++GQD+ +++   L +++ +V+Q   L + T
Sbjct: 391 FVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTET 450

Query: 549 IRDNITYGLSYTPSMDEIR--AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIA 606
           + +N+T G +     DEIR     +     N I     G +T IG  G  LSGG++QR+A
Sbjct: 451 LANNVTIGEAGVDD-DEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVA 509

Query: 607 IARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENI 666
           +ARA  +   ILILDEA SA D   +  +   + R  R+ + TI+ + H LS I  ++ +
Sbjct: 510 LARAYFRNAPILILDEALSAQDRIHKSLLMEAI-RKWRADKTTII-LTHELSDILDTDYV 567

Query: 667 VVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            V+ +DG + E G  + L  +  SE   L
Sbjct: 568 YVM-SDGQIREHGYKSGLLSNPKSEFSNL 595

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  183 bits (465), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 152/509 (29%), Positives = 253/509 (49%), Gaps = 31/509 (6%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF--DRNKVGDLISRLGSDAYIVSRSM 253
            NF + ++L    E  +  LR + ++  L+ D  +F  D NK  +L S L  +     RS+
Sbjct: 775  NFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSEL-SALLLNDLRDLRSL 833

Query: 254  THNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAP-PLLIA-ATIYGKRIRAISRELQ 311
                   +   +   + +G+++ + S    +++  +  PL+IA + +YG  ++      +
Sbjct: 834  VSEFLSAMTTFMVVSL-IGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYK 892

Query: 312  QSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV 371
             S   L     E   GIKTI+S  AE   ++ Y+     +  +A +  I +    S TN+
Sbjct: 893  TSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNM 952

Query: 372  LGDVSFLLVLAYGSHLVLQGELS---LGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGA 428
            +      ++  YG  LV +GE S   +      +L+T  T +S   L N   ++ +G  +
Sbjct: 953  ITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTS---LVNQIPDISRGQRS 1009

Query: 429  ASRLFELTDYKKSVPSTVGQT------FVPR-----DGRIEFKDVSFSYPTRPTSQIFKK 477
            A+ L+ + D   +   +  +T        P+     +  I+ ++++F+YP+     +++ 
Sbjct: 1010 ATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNPLIKIQNLTFAYPSETNVNVYED 1069

Query: 478  LRLTITPGS-NVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLG 536
            L L +      + +VG SG GKST+  LL + Y     +I +DG D++     +LR  + 
Sbjct: 1070 LNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQIS 1129

Query: 537  VVQQEPVLMSGTIRDNITYGLSYTPSMD-EIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595
            VV+Q+P L  GT+R+N++YG+S T  +D E+  + K    + F+   P G DT I  +  
Sbjct: 1130 VVEQKPTLFDGTVRENLSYGIS-TDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK-- 1186

Query: 596  LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
            LLSGGQ QRI IARAL++KPKILILDE TSALD  S   I   + +      +TIV I H
Sbjct: 1187 LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII-IDIVKNGPPALLTIV-ITH 1244

Query: 656  RLSTIRRSENIVVLGNDGSVIEAGKFADL 684
                +R    I VL N G +IE G F +L
Sbjct: 1245 SEKMMRACNTIAVLKN-GKIIEKGGFKEL 1272

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 139/513 (27%), Positives = 241/513 (46%), Gaps = 35/513 (6%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA- 264
           LGER    +R +++++ L     ++D N        L  D   ++R +    S   +A+ 
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 265 -----LCGGVG-VGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318
                L   +  +G  F+ S +LT  ++  AP ++  A  +   I   +      TG   
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAA 215

Query: 319 RVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVL----GD 374
           +++    + I+ +K +  + +E+R +    R L +      I    + S    L      
Sbjct: 216 QLANWAMDSIQLVKLYCTQFREVRNF----RELTSNCNDLFIKCCLYVSANTALLRFLSL 271

Query: 375 VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL-- 432
             F+    +G+ +V +G+L + ++          GS++         L KG  A  ++  
Sbjct: 272 SMFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILG 331

Query: 433 FELTDYKKSVPSTVGQTFVPRD-GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIV 491
           F  T         + +   P +   I F +++FSYP+RP+  + K + L   P     I+
Sbjct: 332 FLSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFII 391

Query: 492 GPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRD 551
           G SG GKST+++LLL+FYD  +GTI + G D+ +++   L  ++ VV+Q   L + T+R+
Sbjct: 392 GKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRN 451

Query: 552 NITYGLSYTPSMDEIRAVAKK----C---FCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
           NI  G+S    +++  ++ +K    C        +   P G +T+IG  G  LSGGQ+QR
Sbjct: 452 NILLGVS-KDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQR 510

Query: 605 IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE 664
           +AIARA ++   ILILDEA SALD+     +   + R  RS + TI+ + H LS I   +
Sbjct: 511 VAIARAFMRNKPILILDEAVSALDIIHRELLMKNI-RQWRSGKTTIL-LTHELSQIEPDD 568

Query: 665 NIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
              V+  +G V E G   DL + + S    +LN
Sbjct: 569 YTYVI-QEGEVKENGYQKDLKQKKTSVFNHMLN 600

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  181 bits (458), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 135/456 (29%), Positives = 222/456 (48%), Gaps = 12/456 (2%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    + ++  G+         + +T   ++      I  T +  + R 
Sbjct: 243 SYVLSAMVFHIIPITFEISVVCGILTHQFGASFAEITFMTMLLYSIFTIKTTAWRTQFR- 301

Query: 306 ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF 365
             R+  ++      ++ +     + +K F  E     +YN+A+    N   +   + A  
Sbjct: 302 --RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFL 359

Query: 366 FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            SG N++   +   ++  G   V+ G L++G L             +  L + Y EL + 
Sbjct: 360 NSGQNLIFTTALTGMMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQS 419

Query: 426 AGAASRLFELTDYKKSVPSTVG-QTFVPRDG--RIEFKDVSFSYPTRPTSQIFKKLRLTI 482
                 LF+L   +  + +    +  +  DG   I F++V+F Y      +I K    TI
Sbjct: 420 LIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTI 477

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
             G    IVGPSG GKSTI  L+ RFYD   G ILI+G D+ ++   SLRK +GVV Q+ 
Sbjct: 478 PAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDT 537

Query: 543 VLMSGTIRDNITYGLSYTPSMD-EIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
            L + +I +N+ +G     ++D EI  V +K    + I K P  Y+T++G RG ++SGG+
Sbjct: 538 PLFNDSIWENVKFG--RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGE 595

Query: 602 RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
           +QR+AIAR L+K   ++  DEATSALD  +E A+  T+    ++   T + IAHRL TI 
Sbjct: 596 KQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIA 655

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
            ++ I+VL  DG+V E G   +L     S   +L N
Sbjct: 656 DADKIIVL-EDGTVREEGTHNELLAKSTSLYKELWN 690

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  180 bits (457), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 212/454 (46%), Gaps = 9/454 (1%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    +     G+         + +T A ++      I  T +  + R 
Sbjct: 234 SYVLSAMVFHIIPITFEITFVCGILTYQFGSSFAAVTFATMLLYSIFTIRTTAWRTQFR- 292

Query: 306 ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF 365
             R+   +      V+ +     + +K F  E     +Y+ ++    +   +   + A  
Sbjct: 293 --RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFL 350

Query: 366 FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            SG N++   +   V+      V++G L++G L             +  L + Y EL + 
Sbjct: 351 NSGQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQS 410

Query: 426 AGAASRLFELTDYKKSVPSTVGQTFVPRD--GRIEFKDVSFSYPTRPTSQIFKKLRLTIT 483
                 LF L   K ++ + +    +P      I F++V+F Y   P  +I K    TI 
Sbjct: 411 LIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIP 468

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
            G    IVGPSG GKSTI  L+ RFY+   G ILIDG+DI +V   SLRK +GVV Q+  
Sbjct: 469 AGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTP 528

Query: 544 LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQ 603
           L + TI +N+ +G       D   A+ +       I   P G +T++G RG ++SGG++Q
Sbjct: 529 LFNDTIWENVKFGRIDASDKDITNAIERAQLTK-LIQNLPKGINTIVGERGLMISGGEKQ 587

Query: 604 RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRS 663
           R+AI+R L+K   ++  DEATSALD  +E ++  T+      +  T V IAHRL TI  +
Sbjct: 588 RLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADA 647

Query: 664 ENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           + I+VL N+  V E G    L +   S   +L N
Sbjct: 648 DKIIVL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  180 bits (457), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 134/456 (29%), Positives = 225/456 (49%), Gaps = 15/456 (3%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    + ++  G+         + +T   ++      I  T +  R R 
Sbjct: 254 SYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYSIFTIRTTAWRTRFR- 312

Query: 306 ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF 365
             +E  ++      V+ +     + +K F  E     +Y+ ++ +  +   +   + A  
Sbjct: 313 --KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFL 370

Query: 366 FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            SG +++   +   ++  G   V+ G+L++G L             +  L + Y EL + 
Sbjct: 371 NSGQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQS 430

Query: 426 AGAASRLFELTDYKKSV-----PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRL 480
                 LF+L   +  +     P ++ ++  P +  I+F++V+F Y  +   +I K    
Sbjct: 431 LIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFE--IKFENVTFGYDGQ--RKILKNASF 486

Query: 481 TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
           TI  G    I GPSG GKST+  L+ RFYD   G +L++G D+ +     LRK +GVV Q
Sbjct: 487 TIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQ 546

Query: 541 EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
           +  L + TI +N+ +G     S +EI  V  K    + I K P G  T++G RG ++SGG
Sbjct: 547 DTPLFNDTIWENVKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGG 605

Query: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
           ++QR+AIAR L+K   I+  DEATSALD  +E ++  T+ R   S E T V IAHRL TI
Sbjct: 606 EKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTI 665

Query: 661 RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
             ++ I+VL  +G+V E G   +L   E+S L+K L
Sbjct: 666 ADADKIIVL-EEGTVREEGTHQELLARENS-LYKEL 699

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  182 bits (463), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 144/510 (28%), Positives = 244/510 (47%), Gaps = 15/510 (2%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDR--NKVGDLISRLGSDAYIVSRSMT 254
            F ++F L   GE  +  LR +   K + +   +F +  NK   L + L +D   +   +T
Sbjct: 723  FIKLFFLGYSGEFWIFELRQETFIKIIKNPISWFSKSNNKAPILSTLLINDLRDLRNLVT 782

Query: 255  HNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQST 314
              +S      L   +G+     I   L+   I   P +++   +YG  +       + S 
Sbjct: 783  EFLSVITTLILVTSIGLVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSV 842

Query: 315  GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
             NL  +  E   G+KTI+S   +    +++N  ++ L        + +    + TN+L  
Sbjct: 843  ANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVL 902

Query: 375  VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE 434
            +   ++  YG  LVL GE +   L   +    +T  +V  L     ++ +G  + S + +
Sbjct: 903  LFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTIVTVASLVTQLPDITRGQRSISWIDQ 962

Query: 435  LT--DYKKSV--PSTVGQT---FVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSN 487
            +   D ++++  PS +  T   + P    IE  ++SF+Y      +    + + +     
Sbjct: 963  ILKGDNQQTIEPPSNLSTTKGIWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQI 1022

Query: 488  VCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSG 547
              IVG SG GKST+ +L+   Y  + G+I I   DI+K S K L K + ++QQ PVL   
Sbjct: 1023 YGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFD 1082

Query: 548  TIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAI 607
            TIR+N+ YGL+ T   + +  V +     +FI    +G D+ +    +LLSGGQ QR+ +
Sbjct: 1083 TIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDSKLDD--SLLSGGQSQRLCM 1140

Query: 608  ARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIV 667
            AR +++ PK+LILDE TSALDV S   IN  +G   RS     + ++H+  TI+  + I 
Sbjct: 1141 AREMLRNPKVLILDECTSALDVTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCDKIF 1198

Query: 668  VLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
             L  DG+V   G + +L  + + E  KLLN
Sbjct: 1199 FLV-DGTVAMMGTYEEL-MENNWEFRKLLN 1226

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 138/492 (28%), Positives = 230/492 (46%), Gaps = 37/492 (7%)

Query: 196 NFGRMFLLKMLGERLVARLRAQVIKKTLHHD-----AEFFDRNKVGDLISRLGSDAYIVS 250
           N+  ++   MLGER     ++ +I+K L H+       +FD+ +  D++         + 
Sbjct: 88  NWLAIYGWMMLGER-----QSYIIRKKLFHEYFNLPCSWFDKYR-SDIMGEFTQLHRCIE 141

Query: 251 --RSMTHNISDGVKAALCGGVG-VGMMFHISSTLTSAMIMFAPPLLIAATIYGKRI-RAI 306
             RS +   S  +  +L   +  +G  F+ S +LT  +    P ++I A I+ K I +  
Sbjct: 142 EVRSSSAEASAIMSQSLVAVIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYT 201

Query: 307 SRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFF 366
            +E  +S     R++      I+ ++    +  E+  Y   + +    A    I ++ F 
Sbjct: 202 EKENTESECAAERLAW-MLKNIEFVRLHNGDDFEISMYTHYIAQ----ANEYYIKASLFI 256

Query: 367 SGTNVLGDVS----FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSEL 422
           S    +  +     F+    +GS ++ QG+L++ S+          GS +         L
Sbjct: 257 SANISILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVL 316

Query: 423 MKGAGAASRLFELTDYK-----KSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKK 477
            KG  A  RL ++ D         + +  G   +P    I F +VSF YP R T ++F K
Sbjct: 317 QKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVFNNVSFCYPERKTDKVFDK 372

Query: 478 LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
           +   I P     ++GPSG GKST+  L+L  YD   G+I++   DI  ++   + +++ +
Sbjct: 373 MNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITL 432

Query: 538 VQQEPVLMSGTIRDNITYGLSYT--PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595
           V Q P L + TIR+NI    ++T  PS  E+  + K     N I + PDG DT IG  G 
Sbjct: 433 VSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGI 492

Query: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
            LSGGQ Q++A+ARA  +   IL+LDE  SA+D+     +   + R    K  T V I H
Sbjct: 493 KLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGK--TTVIITH 550

Query: 656 RLSTIRRSENIV 667
            L  IR ++NI+
Sbjct: 551 DLEFIRNTDNIL 562

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  179 bits (454), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 192/390 (49%), Gaps = 14/390 (3%)

Query: 308 RELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS 367
           R+  ++      ++ +     + +K F  E     +YNT+++       +   + A   S
Sbjct: 302 RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLNS 361

Query: 368 GTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAG 427
           G N++   +   ++  G   +L G LS+G L             +  L + Y +L +   
Sbjct: 362 GQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 421

Query: 428 AASRLFELTDYKKSVPSTVGQTFVP-RDG--RIEFKDVSFSYPTRPTSQIFKKLRLTITP 484
               LF+L   +  + +      +  +DG   IEFK+V+F Y   P  +I +     I  
Sbjct: 422 DMESLFKLRKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIPA 479

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
           G    +VGPSG GKSTI  L+ RFYD   G +L++G D+      SLR+ +GVV Q+  L
Sbjct: 480 GVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPL 539

Query: 545 MSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
            + TI +N+ +G   T + ++I    +K      I K P  Y+T++G RG ++SGG++QR
Sbjct: 540 FNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQR 598

Query: 605 IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE 664
           +AIAR L+K   I+  DEATSALD  +E  +  T+         T V IAHRL T+  S+
Sbjct: 599 LAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSD 658

Query: 665 NIVVLGNDGSVIEAG-------KFADLYRD 687
            I+VL  +GS+ E G       K   LY+D
Sbjct: 659 KIIVL-KEGSIFEEGTHLGLLSKPNSLYKD 687

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} similar
            to uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1271

 Score =  181 bits (460), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 148/518 (28%), Positives = 254/518 (49%), Gaps = 30/518 (5%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFD--RNKVGDLISRLGSDAYIVSRSMT 254
            F + F+L    E  + RLR   + K      ++F    N   +L S + +D     R + 
Sbjct: 763  FLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDL----RDLR 818

Query: 255  HNISDGVKA--ALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISREL 310
               S+ + A   L     +G+++ + S   L+   I   P  ++ + IYG  ++      
Sbjct: 819  GLASEFLSAITTLVFVASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAY 878

Query: 311  QQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTN 370
            +     L     E    +KTIK    +      + T + ++  V K+  +      + TN
Sbjct: 879  KTEIAELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTN 938

Query: 371  VLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAAS 430
             L  V   ++  +G  LV+QGE S+  +        ++  +   L N   E+ +G  AA+
Sbjct: 939  ALAMVVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAAT 998

Query: 431  RLFEL------TDYKKSVPSTVGQTFVPRDGR---IEFKDVSFSYPTRPTSQIFKKLRLT 481
             +F++       D  K  PS   Q+F    G    I+  ++SF++ + P ++IF  L   
Sbjct: 999  YIFKVLEDSGSVDTSKPDPSQ-NQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCE 1057

Query: 482  ITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
            I     V IVG SG GKST++ LL R Y   SG + I G DI+K    +LR+ + +V+Q+
Sbjct: 1058 ICLNETVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQK 1117

Query: 542  PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
            P    GT+R+N+ YGL    S  E+R+V K     +F+   P+  +T +     L+SGGQ
Sbjct: 1118 PKFFDGTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQ 1175

Query: 602  RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS--KEITIVSIAHRLST 659
             QR++IAR L+++PKI+ILDE TSALD     A ++ +  L+R+  K +T++ I H    
Sbjct: 1176 AQRLSIARTLLRQPKIIILDECTSALD----AANSFAIAELIRTVLKNVTVIVITHSEQL 1231

Query: 660  IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
            ++  + ++VL   G V E G +A+L+ +   EL+++++
Sbjct: 1232 MQICDRVLVL-KKGKVKEEGSYAELF-ESRGELYRIVS 1267

 Score =  171 bits (434), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 142/514 (27%), Positives = 242/514 (47%), Gaps = 37/514 (7%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA- 264
           LGER   R+R  +I      D +++D N+       L  D   ++R +    +   +A+ 
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNE------NLEGDFIQINRCIEEVRASSAEASA 144

Query: 265 --------LCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIY-GKRIRAISRELQQSTG 315
                   +   +   M +  S TL   +I+ + PLL    ++   ++   S+     + 
Sbjct: 145 IFFQNVISIIALIATSMYYSWSLTL---IILCSLPLLATLAVFLSMKVEKFSKLENLESS 201

Query: 316 NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
             + V     +  + I+ F     E +++ T V +      +  + SA   S    L   
Sbjct: 202 KASSVLAWSLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLC 261

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL--F 433
            F+    +G+  + +G++  G +          GSS+         + KG  A  R+  F
Sbjct: 262 MFVQGFWFGNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRINQF 321

Query: 434 ELTDYKKSV------------PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLT 481
            + + K +V             S++G   +  DG IEF+DVSF+YPTRP   + K + + 
Sbjct: 322 LVPNSKSAVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSIK 381

Query: 482 ITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           I  G+   IVG SG GKST+ASLLL+ Y   +G I     +I  +    L +++ +V+Q 
Sbjct: 382 IKSGATCFIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQR 441

Query: 542 PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
             L +GT++DN+T    Y  S  E++   +    +  +   P+G DT++G  G  LSGGQ
Sbjct: 442 CTLFNGTLKDNLTIVNKY-ASCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGGQ 500

Query: 602 RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
           +QR+A+ARA ++   +LILDE+ SALD+ S   I   + R  R  + TI+ + H  + I+
Sbjct: 501 QQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAI-RHWRKGKTTII-LTHEYTQIK 558

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
             E  V L ++G+V+E+G   DL  + DS   +L
Sbjct: 559 DDE-YVYLMSEGTVVESGFKYDLLENPDSYFAQL 591

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  177 bits (449), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 135/456 (29%), Positives = 225/456 (49%), Gaps = 15/456 (3%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAA-TIYGKRIR 304
           +Y++S  + H +    + ++  G+   + +   ++   A I FA  LL +  TI     R
Sbjct: 222 SYVLSAMVFHILPITFEISVVCGI---LTYQFGASF--AGITFATMLLYSIFTIKVTAWR 276

Query: 305 -AISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSA 363
            A  R+  ++      V+ +     + +K F  E     +Y+ ++ +  +   +   + A
Sbjct: 277 TAFRRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLA 336

Query: 364 TFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELM 423
              +G N +   +   ++  G   V+ G+L++G L             +  L + Y EL 
Sbjct: 337 FLNAGQNFIFTSALSAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 396

Query: 424 KGAGAASRLFELTDYKKSVPSTVGQTFVPRDG---RIEFKDVSFSYPTRPTSQIFKKLRL 480
           +       LF L + K  + +      +P +     I+F++V+F Y TR   +I +    
Sbjct: 397 QSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNASF 454

Query: 481 TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
           TI  G    IVGPSG GKSTI  L+ RFYD  SG +L++G+D+ +    S RK +GVV Q
Sbjct: 455 TIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVPQ 514

Query: 541 EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
           +  L + TI +N+ +G     + DE+    +K      I K P G  T++G RG ++SGG
Sbjct: 515 DTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISGG 573

Query: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
           ++QR+AIAR L+K  +I+  DEATSALD  +E ++  T+         T V +AHRL TI
Sbjct: 574 EKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRTI 633

Query: 661 RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
             ++ I+VL  +G V E G   +L    +S L+K L
Sbjct: 634 ADADKILVL-EEGCVREEGSHTELLSRPNS-LYKQL 667

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  176 bits (446), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 119/362 (32%), Positives = 182/362 (50%), Gaps = 8/362 (2%)

Query: 327 GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSH 386
             + +K F  E    ++Y+  + +  +   +   + A   SG N++   +  +++  G  
Sbjct: 324 NFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQSLAFLNSGQNLIFTSALTVMMYMGCT 383

Query: 387 LVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTV 446
            ++ G L++G L             +  L + Y EL +       LF+L      + +  
Sbjct: 384 GIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKNPIIIKNVE 443

Query: 447 GQTFVPRDGR----IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIA 502
               +   G     I F++V+F Y  +   +I K     I  G    IVGPSG GKSTI 
Sbjct: 444 KPLMLAEKGHMPMTIRFENVTFGYDKQ--RKILKNASFQIESGQKTAIVGPSGSGKSTIL 501

Query: 503 SLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS 562
            LL RFYD   G IL++G D  +    SLRK +GVV Q+  L + TI +N+ +G     S
Sbjct: 502 KLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENVRFG-RIGAS 560

Query: 563 MDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDE 622
            DEI  V  K      + K P G +T++G RG ++SGG++QR+AIAR L+K   I+  DE
Sbjct: 561 DDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIARVLLKDADIMFFDE 620

Query: 623 ATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFA 682
           ATSALD  +E A+  T+    +    T V IAHRL TI  ++ I+VL  +G+V E GK +
Sbjct: 621 ATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL-QEGTVREEGKHS 679

Query: 683 DL 684
           +L
Sbjct: 680 EL 681

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  174 bits (442), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 132/459 (28%), Positives = 220/459 (47%), Gaps = 18/459 (3%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I    + ++  G+   + +   ++   A I F   LL   +I+  R  A
Sbjct: 221 SYVLSAMVFHIIPITFEISVVCGI---LTYQFGASF--AGITFTTMLLY--SIFTFRTTA 273

Query: 306 ----ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGIT 361
                 RE  ++      V+ +     + +K+F  E     +Y T++ +  +   R   +
Sbjct: 274 WRTKFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQS 333

Query: 362 SATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSE 421
            A   SG N++   +   ++  G   ++ G L++G L             +  L + Y E
Sbjct: 334 LAFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRE 393

Query: 422 LMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG---RIEFKDVSFSYPTRPTSQIFKKL 478
           L +       LF L +    + +      +P +     I F++V+F Y   P  +I +  
Sbjct: 394 LKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNA 451

Query: 479 RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVV 538
              I  G    +VGPSG GKST+  L+ RFYD   G IL++G DI +    SLR+ +GVV
Sbjct: 452 SFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVV 511

Query: 539 QQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLS 598
            Q+  L + TI +N+ +G       +  R++ +K      + + P G +T++G RG ++S
Sbjct: 512 PQDTPLFNDTIWENVKFGRIDADDQEVTRSI-EKAHLAPLVYRLPGGLNTIVGERGLMIS 570

Query: 599 GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLS 658
           GG++QR+AIAR L+K   I+  DEATSALD  +E A+  T+         T V IAHRL 
Sbjct: 571 GGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLR 630

Query: 659 TIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           TI  ++ I+VL  +G   E G   +L + EDS   +L N
Sbjct: 631 TIADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  174 bits (441), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 121/372 (32%), Positives = 186/372 (50%), Gaps = 7/372 (1%)

Query: 329 KTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLV 388
           + +K F  E     +Y +++    N   +   + A   SG N++   +   ++  G   V
Sbjct: 319 EAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSALTAIMYLGCTGV 378

Query: 389 LQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQ 448
           + G L++G L             +  L + Y EL +       LF+L   +  + +    
Sbjct: 379 IGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNEIKIQNVHRP 438

Query: 449 TFVPRD---GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLL 505
             +P +     I+F++V+F Y      +I K    TI  G    +VGPSG GKSTI  L+
Sbjct: 439 LMLPNELTPFEIKFENVTFGYDKE--RKILKNASFTIPAGWKTAVVGPSGSGKSTILKLV 496

Query: 506 LRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE 565
            RFYD   G IL++G DI ++   SLRK +GVV Q+  L + TI +N+ +G     + +E
Sbjct: 497 FRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWENVKFG-RIEATDNE 555

Query: 566 IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATS 625
           I    +K      I K P G +T++G RG ++SGG++QR+AIAR L+K   I+  DEATS
Sbjct: 556 ILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVLLKNSGIMFFDEATS 615

Query: 626 ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
           ALD  +E ++  T+         T V IAHRL TI  ++ I+VL  DG V E G    L 
Sbjct: 616 ALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-KDGQVEEEGTHRQLI 674

Query: 686 RDEDSELFKLLN 697
             ++S   +L N
Sbjct: 675 AKKESLYSELWN 686

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  173 bits (439), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 133/460 (28%), Positives = 220/460 (47%), Gaps = 17/460 (3%)

Query: 246 AYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRA 305
           +Y++S  + H I  G + ++  G+         + +T   ++      I  T +  + R 
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGILTYQFGASFAGITFTTMLLYSIFTIRTTAWRTQFR- 315

Query: 306 ISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF 365
             R+  ++      V+ +     + +K F  E     +Y+ ++ +  +   +   + A  
Sbjct: 316 --RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFL 373

Query: 366 FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            SG N++   +  +++  G   V++G L++G L             +  L + Y EL + 
Sbjct: 374 NSGQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQS 433

Query: 426 AGAASRLFEL------TDYKKSVPSTVGQTFVPRDG--RIEFKDVSFSYPTRPTSQIFKK 477
                 LF+L          K+ P+ +       DG   I+F++V+F Y T    +I K 
Sbjct: 434 LIDMESLFQLRKNPIKIQNAKTGPAPI--MLKSSDGPFEIKFENVTFGYDT--NRKILKN 489

Query: 478 LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
               I  G    +VGPSG GKSTI  L+ RFYD   G +LI+G ++ +    SLR+ +GV
Sbjct: 490 ASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMGV 549

Query: 538 VQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALL 597
           V Q+  L + TI +N+ +G     + +EI+ V +K      I K P    T++G RG ++
Sbjct: 550 VPQDTPLFNDTIWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLMI 608

Query: 598 SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
           SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T+     S   T + IAHRL
Sbjct: 609 SGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHRL 668

Query: 658 STIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
            TI  ++ I+VL  DG V E G   +L   + S    L N
Sbjct: 669 RTIADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  175 bits (444), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 139/516 (26%), Positives = 241/516 (46%), Gaps = 29/516 (5%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFF-DRNK----VGDLISRLGSDAYIVSR 251
            F + ++L   GE  +  LR    +  +  D  +F D N     +  LI     D   ++ 
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDLRDLRALAS 849

Query: 252  SMTHNISDGVKAALCGGVGVGMMFHISS--TLTSAMIMFAPPLLIAATIYGKRIRAISRE 309
                 +S     +LCG     +++ + +   L+   I   P  ++ + IYG  ++     
Sbjct: 850  EFLAALSTLAVVSLCG-----LLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEAR 904

Query: 310  LQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT 369
             +     L     +    +KTIK    E K  R Y          A++  + +    + +
Sbjct: 905  YKTCIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASS 964

Query: 370  NVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAA 429
            N L  ++  ++L +G  LV+ GE + G +   +    +T  +   L +   E+ +G  AA
Sbjct: 965  NALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAA 1024

Query: 430  SRLFELT-DYKKSVPSTVGQTFVP------RDGRIEFKDVSFSYPTRPTSQIFKKLRLTI 482
            + LF+L  +  +   S + +   P      +   I  K + FSY       ++K L L +
Sbjct: 1025 TYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLKV 1084

Query: 483  TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
              G  V ++G SG GKST+ SLL R Y   +G+I IDG DI++   K+LR  + VV+Q+P
Sbjct: 1085 DRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKP 1144

Query: 543  VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            +  SG+I +N+TYGL    S +E+  +        F+   P    +VI  +  LLSGGQ 
Sbjct: 1145 LFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQV 1202

Query: 603  QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK--EITIVSIAHRLSTI 660
            QR+AI RAL++KP++L+LDE TSALD       ++ +   ++      T + + H    +
Sbjct: 1203 QRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMM 1258

Query: 661  RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
            R    I+   N G ++E G   +L+ ++  EL+++L
Sbjct: 1259 RSCHRILTF-NKGEIVEEGSIDNLF-NQKGELYRIL 1292

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 135/506 (26%), Positives = 226/506 (44%), Gaps = 26/506 (5%)

Query: 206 LGERLVARLRAQVIKKTLHHDAEFFDRN--------KVGDLISRLGSDAYIVSRSMTHNI 257
           LGER   RLR ++++        ++D N        ++   +  L S +   S  +  N+
Sbjct: 103 LGERQGFRLRRKLLRSYFEKSMAWYDINEQISGEYTQLNRCVEELRSSSAEASAIIFQNL 162

Query: 258 SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKR-IRAISRELQQSTGN 316
                  +   +G  + +  S TL   +IM   PL+I   IY  R +    +     T  
Sbjct: 163 -----VTVIALLGTALYYSWSLTL---VIMANSPLVIGFAIYCSRNVEKYGKIENSETSV 214

Query: 317 LTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
              +     N  K ++    +  E+ ++  +V +      +  + S+  +S    L    
Sbjct: 215 AADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCRMNFNKMSLFSSLNYSILRFLTLCM 274

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL- 435
           F+    YG+  +  G L  G +           S++    +    L KGA    ++ E  
Sbjct: 275 FVQGFWYGNVRIKSGNLKPGDVMTCFSSCILLASTLNSTLHQVVTLQKGAVGLKKIQEFL 334

Query: 436 -TDYKKSVPSTVGQTFVP---RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIV 491
            +D  +     V    +P      +I F++VSF+YP+R    + K L L +  G    IV
Sbjct: 335 TSDVVQGKECVVNSMHLPLLWEQAQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIV 394

Query: 492 GPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRD 551
           G SG GKSTI++LLL+ Y   SG I ++  DI +++ + L + + +V+Q   L   +I++
Sbjct: 395 GKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKN 454

Query: 552 NITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARAL 611
           NI            +    +       I     G DT+IG  G  LSGG++QR+A+ARA 
Sbjct: 455 NIQLTSDEHRDDGRLSQACQAAMLEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAF 514

Query: 612 IKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGN 671
           ++   ILILDEA SA D   +  +   + R  R    TI+ + H L+ I   ++ V+L  
Sbjct: 515 VRDSPILILDEALSAQDRMHKDLLMEAI-RFWRKGRTTII-LTHELNDILE-DDFVLLME 571

Query: 672 DGSVIEAGKFADLYRDEDSELFKLLN 697
           DG+VIE G+ +DL  D  S+ F LL+
Sbjct: 572 DGNVIERGQKSDLLSDSTSK-FSLLH 596

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 144/499 (28%), Positives = 232/499 (46%), Gaps = 25/499 (5%)

Query: 212  ARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGV 271
            ARL   + K  L     FF+   VG +++R  +D Y V   +  + S            V
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQ----FFIHVTKV 1070

Query: 272  GMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFN 326
                 +  ++T   I F  PL +    Y +     SREL++   ++T+       +E   
Sbjct: 1071 VFTMIVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRR-LASVTKSPVYAHFQETLT 1129

Query: 327  GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSG-TNVLGDVSFLLVLAYGS 385
            G+ T++SF  + + +   N +    +  A    I +  + +     +G +  L       
Sbjct: 1130 GVTTVRSFKKQDRFIH-INQSRINTYMCAYYLSINANRWLAFRLEFMGSIVILAAAVLSV 1188

Query: 386  HLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPST 445
              + QG+L+ G L   + Y      S+  +     E+     +  R+ E TD K   P  
Sbjct: 1189 FRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLKPEAPMI 1248

Query: 446  VGQTFVPRD----GRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKST 500
            +  +  P++    G I+F+  S  Y  RP    I + + L I P   V IVG +G GKS+
Sbjct: 1249 IPTSRPPKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRTGAGKSS 1306

Query: 501  IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
            +   L R  +A +G ILID   I  +    LR  L ++ Q+  +  GT R+NI     +T
Sbjct: 1307 LTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENIDPCNKFT 1366

Query: 561  PSMDEI-RAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI 619
               DEI  A+       + +T   +G +T +   G+ LS GQRQ + +ARAL+   KIL+
Sbjct: 1367 D--DEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLVPSKILV 1424

Query: 620  LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
            LDEAT+A+DVE++  I  T+    + +  TI++IAHRL+TI  S+ IVVL + G + E  
Sbjct: 1425 LDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVL-DKGRIAEFD 1481

Query: 680  KFADLYRDEDSELFKLLNE 698
               +L +DE S  + L NE
Sbjct: 1482 TPCNLLKDETSIFYSLCNE 1500

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 113/435 (25%), Positives = 193/435 (44%), Gaps = 54/435 (12%)

Query: 287 MFAPPLLIAATI-YGKRIRAISRELQ----QSTGNLTRVSEEQFNGIKTIKSFVAEG--K 339
           M+A   ++  TI     I  I ++LQ    ++    TR+  E  N IK++K +  E   K
Sbjct: 435 MWAGVFIMVITIPLNSLIMGIQKKLQGVQMKNKDKRTRIISEILNNIKSLKLYAWEQPYK 494

Query: 340 EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLA-YGSHLVLQGELSLGSL 398
               Y    + L N+ K  GIT+       +V   V F++  A +G+ ++ Q + +L + 
Sbjct: 495 AKLDYVRNEKELKNLVKI-GITNTISVFQFSV---VPFMVSCATFGTFVLTQKDKALSTD 550

Query: 399 TAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRD---- 454
             F         ++F L +F   L     AA+   E +   K + S +    + RD    
Sbjct: 551 LIF------PALALFNLLSF--PLGFIPMAATSFIEASVSIKRLHSFLTSGEIQRDAIQH 602

Query: 455 -------GRIEFK---DVSFSYPTRPTSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIAS 503
                  G I      D ++ +  +P  ++  K +      G   CIVG  G GKS +  
Sbjct: 603 LPKVEEIGDISVNISGDATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQ 662

Query: 504 LLLRFYDANSGTILIDGQDISKVS-AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS 562
            +L               D+ +V  + +L   +  V Q   +M+GTI+DNI +G  Y   
Sbjct: 663 AML--------------GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDAE 708

Query: 563 MDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDE 622
             E     K C     +   PDG  T +G RG  LSGGQ+ R+A+ARA+  K  +  LD+
Sbjct: 709 FYE--KTIKACALSLDLNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDD 766

Query: 623 ATSALDVE-SEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKF 681
             +A+D   S+  + Y +G     K  T +   +++  +  +++I +L N G +++ G +
Sbjct: 767 PLAAVDEHVSKHLVKYVIGPTGLLKTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSY 825

Query: 682 ADLYRDEDSELFKLL 696
             +  ++DS LFKL+
Sbjct: 826 DQVNSNKDSPLFKLI 840

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  154 bits (389), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 150/530 (28%), Positives = 242/530 (45%), Gaps = 48/530 (9%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
            N   + LL     R  A+L   + K  L     FF+   VG +I+R  SD   V  ++  
Sbjct: 1012 NLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQW 1071

Query: 256  NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ--- 312
              +   ++ L   V V +   IS  +   +I+ A  LLI    Y      +SREL++   
Sbjct: 1072 VFAFFFRSILNYAVTVIL---ISYNMPWFLIVNAV-LLIIYIYYQAFYITLSRELKRLTS 1127

Query: 313  -STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATF-FSGTN 370
             ST  +  +  E   G   I +F    K   R++       N    +   + +F F  TN
Sbjct: 1128 VSTSPIMSLFSETLGGHAVINAF----KHFDRFD-----FINFNNVQFNINCSFNFRSTN 1178

Query: 371  V-----LGDVSFLLVLAYG----SHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSE 421
                  L  +   +VLA      S +  +  LS G +   M Y     SS+  +     +
Sbjct: 1179 RWLSVRLQTIGAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSSLMWIVRMSVQ 1238

Query: 422  LMKGAGAASRLFELTDYKKSVPSTV-----GQTFVPRDGRIEFKDVSFSYPTRPTSQIFK 476
            +     +  R++E  +     P  +      +T+ P +G I FK+ S  Y T+    + K
Sbjct: 1239 IETNIVSVERIYEYCNLTPEAPEVIESCRPKKTW-PSEGEIIFKNYSTKYKTKGDLAL-K 1296

Query: 477  KLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLG 536
             + L+I P   + +VG +G GKST++  L R  +A  GTI IDG DISK+  K LR HLG
Sbjct: 1297 GINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMGLKDLRSHLG 1356

Query: 537  VVQQEPVLMSGTIRDNI-------TYGLSYTPSMDEIRAVAKKCFCHNFITKFPDG---- 585
            ++ Q+     GT+R N+       T  L  +  +  ++    + F     ++ P      
Sbjct: 1357 IIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPHIVEMFRKEDNSELPASKEKM 1416

Query: 586  YDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS 645
             D  I   G  LS GQRQ + ++RAL+   K+L+LDEAT+A+D+E++  I  T+   ++ 
Sbjct: 1417 LDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKIIQETIRSELKE 1476

Query: 646  KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            K  TI++IAHR+ T+  S+ I+VL + G V E     +L  ++ S  + L
Sbjct: 1477 K--TILTIAHRIDTVLDSDKIIVL-DAGQVKEFDTPENLLSNKQSIFYAL 1523

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 104/429 (24%), Positives = 195/429 (45%), Gaps = 46/429 (10%)

Query: 300 GKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRL-FNVAKRE 358
            KR+  + +   +      + + E  N +K+IK +  E   ++R +     L     KR 
Sbjct: 445 SKRVEKLYKIQMKYKDARIKTTTEILNSMKSIKLYAWEEAMLKRLDHVRNGLELENYKRI 504

Query: 359 GITSATFFSGTN---VLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415
           G+ S   +   N   ++   S   + ++ +   L  E+   SL+ F +  +    +++ L
Sbjct: 505 GVVSNLIYFAWNCVPLMVTCSTFAIFSFFNKTPLSPEVVFPSLSLFNILND----AIYSL 560

Query: 416 SNFYSELMKGAGAASRLFEL-----------------TDYKKSVPSTVGQTFVPRDGRIE 458
            N  + +++   + +R+ E                  +D    V   +  TF+ +  +I 
Sbjct: 561 PNTINSIIETKVSINRIKEFLLSEELDDSFIEIDKTPSDKVSPVVEIINATFLWKSPKIL 620

Query: 459 FKDVSFSYPTRPTSQI-FKKLR-LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           F + S       +SQ+  + +       G   CIVG  G GKST+   +L       G +
Sbjct: 621 FSEGSDEESRIESSQVALENINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQL 673

Query: 517 LIDGQDISKVSAKSLRKH--LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCF 574
                 +  +  K L +   +    QEP +M+ +I+DNIT+G  Y  +     A  K C 
Sbjct: 674 PCVNASVGGLEPKVLIRASTVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQ 731

Query: 575 CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEG 633
               +   P+  +T++G +G  LSGGQ+ RI++ARA+  +  + +LD+  SA+D E S+ 
Sbjct: 732 LLPDLDILPERDNTLVGEKGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKN 791

Query: 634 AINYTLGR---LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD-ED 689
            +   L +   L+R+K  T+V   + +S + RS+ I +L   GS++E G F ++    E 
Sbjct: 792 IVEMVLDKKMGLLRNK--TVVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEP 848

Query: 690 SELFKLLNE 698
           S+L K+++E
Sbjct: 849 SKLKKMIDE 857

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 232/496 (46%), Gaps = 53/496 (10%)

Query: 229  FFDRNKVGDLISRLGSDAY----IVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSA 284
            FF+   +G +++R  +D Y    ++ R+ +    + VK +   GV       I  T T  
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGV-------ICVT-TWQ 1094

Query: 285  MIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGK 339
             I    PL +    Y +     SREL++   ++TR       +E   GI TI+ +   G+
Sbjct: 1095 FIFVIVPLGVFYIYYQQYYLRTSRELRR-LDSITRSPVYSHFQETLGGIVTIRGY---GQ 1150

Query: 340  EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL---------- 389
            + R       R+ N         + F+   N    +++ L L  GS ++L          
Sbjct: 1151 QKRFSQINQCRVDN-------NMSAFYPSVNANRWLAYRLELI-GSIIILGAATLSVMRL 1202

Query: 390  -QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVG- 447
             QG L+ G +   + Y      S+  +     E+     +  R+ E  D K   P  +  
Sbjct: 1203 KQGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSEAPEIIED 1262

Query: 448  ---QTFVPRDGRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIAS 503
               Q   P +G I+F+  S  Y  RP    + K +   I P   + IVG +G GKS++  
Sbjct: 1263 HRPQETWPEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTL 1320

Query: 504  LLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSM 563
             L R  +A+ G I+ID  DIS +    LR  L ++ Q+  +  GTIR+NI     YT   
Sbjct: 1321 ALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENIDPTNQYTD-- 1378

Query: 564  DEIRAVAKKCFCHNFI-TKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDE 622
            ++I  V +     + I T   DG DT +   G+ LS GQRQ + +ARAL+   KIL+LDE
Sbjct: 1379 EQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDE 1438

Query: 623  ATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFA 682
            AT+A+DVE++  +  T+    + +  TI++IAHR++TI  ++ I+VL N GS+ E  +  
Sbjct: 1439 ATAAVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN-GSIKEFDEPK 1495

Query: 683  DLYRDEDSELFKLLNE 698
             L  ++ S  + L  E
Sbjct: 1496 KLLENKSSLFYSLCEE 1511

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 103/410 (25%), Positives = 183/410 (44%), Gaps = 42/410 (10%)

Query: 308 RELQQSTGNL----TRVSEEQFNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAKRE 358
           ++LQ+S        TRV  E  N IK++K +  E       E  R N  ++ L  +    
Sbjct: 469 KKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYM 528

Query: 359 GITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNF 418
            + S  F +    L   S   V  Y     L  +L   +LT F L        +  + N 
Sbjct: 529 ALMSFQF-NVVPFLVSCSTFAVFVYTEDRPLTTDLVFPALTLFNL----LHFPLMVIPNV 583

Query: 419 YSELMKGAGAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI 474
            + L++ + +  RLF  LT+ +    S      V   G +      D +F +  +P  ++
Sbjct: 584 LTALIECSVSVGRLFSFLTNEELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEYKV 643

Query: 475 -FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLR 532
             K +      G   CIVG  G GKS +   +L               D+ +V    ++ 
Sbjct: 644 ALKNVNFQAKKGELTCIVGRVGSGKSALIQSIL--------------GDLFRVKGFATIH 689

Query: 533 KHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGP 592
            ++  V Q   +M+GT++DNI +G  Y     E     K C     ++   DG  T++G 
Sbjct: 690 GNVAYVSQVAWIMNGTVKDNILFGHKYDAEFYE--KTIKACALTIDLSVLVDGDQTLVGE 747

Query: 593 RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEIT 649
           +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   +   I + LG   L+ +K  T
Sbjct: 748 KGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--T 805

Query: 650 IVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            V   +++S +  ++++ +L N G +++ G + ++ +D  S+L KL+ E+
Sbjct: 806 KVLATNKVSVLSVADSVSLLEN-GEIVQQGSYDEIMKDGASQLNKLIMEY 854

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  152 bits (384), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 150/546 (27%), Positives = 243/546 (44%), Gaps = 81/546 (14%)

Query: 199  RMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNIS 258
            + FL  + G     ++ A ++ K +H    FFD   +G +++R   D   V + +T  ++
Sbjct: 1179 KTFLTYIFGINASRKIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLT 1238

Query: 259  DGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----ST 314
                 A    V       + S +T    + A  + I   + G    A SREL++    + 
Sbjct: 1239 ----GAFYSFVECFSTIILISWITPQFFVVAILISIMYYLVGYFYMAGSRELKRLDSITK 1294

Query: 315  GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRL---------FNVAKR------EG 359
              + +   E   G+ TI++F   G EMR     + ++           VA R      + 
Sbjct: 1295 SPIYQHFSETLVGVTTIRAF---GDEMRFLKENLFKIDENNKPFFYLWVANRWLSFRIDM 1351

Query: 360  ITSATFF-SGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNF 418
            I S   F +G  +L D+             +   ++  SLT  + +TE        L  F
Sbjct: 1352 IGSFVVFGAGVFILADIK-----------NIDSGMAGISLTYAISFTE----GALWLVRF 1396

Query: 419  YSELMKGAGAASRL----------FELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPT 468
            YSE+     +  R+          +++ D     P TV     P +G+IE  D+S  Y  
Sbjct: 1397 YSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAA 1452

Query: 469  RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA 528
                ++ K +  T+ P S V +VG +G GKSTI + L RF D  SG I ID  DI+ +  
Sbjct: 1453 N-LPRVIKNVSFTVEPNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPL 1511

Query: 529  KSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS-----------------MDEIRAVAK 571
              LR+ + ++ Q+P L +GT++ N+     Y                      E  AV+ 
Sbjct: 1512 TRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSD 1571

Query: 572  KCFCH-NFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE 630
            +   H N   +F D     I   G  LS GQRQ I +AR+L++ PKIL+LDEAT+++D E
Sbjct: 1572 QGSMHSNNENRFLD-LSNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYE 1630

Query: 631  SEGAINYTL-GRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDED 689
            S+  +  T+ G    S   TI++IAHRL ++   + I+V+ + G VIE      L  + +
Sbjct: 1631 SDARLQATIRGEFGNS---TILTIAHRLRSVIDYDKILVM-DAGEVIEYDHPYSLLLNRN 1686

Query: 690  SELFKL 695
            SE +K+
Sbjct: 1687 SEFYKM 1692

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 116/490 (23%), Positives = 210/490 (42%), Gaps = 50/490 (10%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSR--SMTHNISDGVKAALCGGVGVGMMFHI 277
           +++++ D E     K+G +I+ +  DAY +S   +  H  ++ +   +   V +  +   
Sbjct: 525 EESINADEESGSNAKLGTIINLMAIDAYKISEICAYLHFFAEAIVMTVIALVLLYRLIGN 584

Query: 278 SSTLTSAMIMFAPPL-LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVA 336
           ++ L + +I+   P+    AT+ G   +    E  +    L     E    I+ IK F  
Sbjct: 585 AAILGTVIILVLLPVNFKLATLLGDYQKLTLGETDKRIHKLN----EALQSIRIIKFFSW 640

Query: 337 EGKEMRRYNTAVRRLFNVAKRE-----GITSATFFSGTNVLGDVSFLLVLAYGSHLVLQG 391
           E       N   R +  + +RE       T A    G       S +   ++  ++ +QG
Sbjct: 641 E-------NNFERDIMEIRERELQMLIKRTLAWVMGGFVWFVTPSIVTTASFAWYIYVQG 693

Query: 392 ELSLGSLTAFMLYTEYTGSSVFGL--------SNFYSELMKGAGAASRLFELTDYKKSVP 443
           E+ L +  AF      T  S+F L        S+  S  ++   +  R+       ++  
Sbjct: 694 EV-LTTPVAF------TALSLFTLLRDPLDRVSDMLSFAIQSKVSLERVGAFLSEAET-- 744

Query: 444 STVGQTFVPRDGR-IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIA 502
               Q  V  +G+ + F + + S+ T  +    + L +    G    ++G +G GK+++ 
Sbjct: 745 EKYEQLTVDNEGKKLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLL 804

Query: 503 SLLLRFYDANSGTILIDG-QDISKVSAKS--LRKHLGVVQQEPVLMSGTIRDNITYGLSY 559
             LL       G I++   +  S ++A S      +    Q   L++ T+R+NI +  S+
Sbjct: 805 MALLGEMHICQGRIIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFNSSF 864

Query: 560 TPSMDEIR--AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKI 617
               DE R   V + C           G  T IG +G  LSGGQ+QRI++ARAL    K 
Sbjct: 865 ----DENRYHKVVEACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKH 920

Query: 618 LILDEATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSV 675
           L+LD+  SA+D  +   I  N   G LM  +  T + ++H ++   R+  +VV+  DG V
Sbjct: 921 LLLDDCLSAVDSHTASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRV 978

Query: 676 IEAGKFADLY 685
            + G   +L+
Sbjct: 979 KDQGDPLNLF 988

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  152 bits (384), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 156/530 (29%), Positives = 238/530 (44%), Gaps = 68/530 (12%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
            LL  +G R    L  + + + LH    + D   +G +++R   D    + S+ + +++ +
Sbjct: 972  LLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESI 1027

Query: 262  KAAL---CGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT 318
            +  L      VGV +M  I     +  I   P L I  T+     ++  RE+++      
Sbjct: 1028 RLMLFQTANIVGVCVMCIIYLPWFAIAI---PFLFIGFTLITDHYQSTGREVKRLEAIQR 1084

Query: 319  RVSEEQFN----GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
                  FN    G+ TIKS+ +E     R+      L N     G  S        +  D
Sbjct: 1085 SFVYNNFNEILGGMDTIKSYGSE----ERFLAKSDYLINKMNEAGYLSVALQRWVAIFLD 1140

Query: 375  ---VSF-----LLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVF-GLSNFYSELMKG 425
               V F     LL +    H+     +S+G L  ++L      + V   L+   +++   
Sbjct: 1141 LVAVCFALIITLLCVTRAFHI---SAVSVGVLLTYVLQLPGLLNGVLRALTQTENDMNSA 1197

Query: 426  AGAASRLFEL---TDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLT 481
                S   EL     Y++  P        P +G+IEFK V FSY P  P   + K L L 
Sbjct: 1198 ERLVSYATELPLEAAYRR--PEVSPPENWPSEGKIEFKHVDFSYRPGLPI--VLKDLDLD 1253

Query: 482  ITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
            I  G  + I G +G GKSTI S L R  + + G ILID  DISK+    LR+ L ++ Q+
Sbjct: 1254 IKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNVDISKLGLYDLRRKLAIIPQD 1313

Query: 542  PVLMSGTIRDNITYGLSYTPSMDEI------------RAVAKKCF--------CHNFITK 581
            PVL  GTIR N+     +    D++            RA   K           H  + K
Sbjct: 1314 PVLFRGTIRKNLD---PFNEHDDDLLWDSLVRGGAIERAALNKIKNQKVDKDGTHADMFK 1370

Query: 582  FPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGR 641
            F    D ++   GA  S G+RQ +A+ RAL+++ K+LILDEATS++D E++G I     R
Sbjct: 1371 F--HLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILDEATSSVDYETDGKIQ---AR 1425

Query: 642  LMRS-KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
            +++   + TI+ IAHRL+TI   + I+VL   G V E  K   L+  EDS
Sbjct: 1426 IVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEFEKPKVLFDQEDS 1474

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 111/246 (45%), Gaps = 36/246 (14%)

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
            DG+I+F               F  + L I  G  + +VGP G GK++  + L  F +  
Sbjct: 618 EDGKIQFSG-------------FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKT 664

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572
            G I ++G D+             ++   P + + T+RDNI +G  Y     E   V + 
Sbjct: 665 EGRIQVNG-DL-------------LLCGYPWIQNATVRDNILFGSPYDKKKYE--EVLRC 708

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632
           C     +   P G  T IG RG  LSGGQ+ RI +AR + KK  I + D+  SA+D    
Sbjct: 709 CSLEADLDILPAGDSTEIGERGITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVG 768

Query: 633 GAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
             I     LG L   K  T +   H+LS + R+  ++VLG DGS  E G   D+ +  + 
Sbjct: 769 KHIMDECFLGLL---KNETRILATHQLSLLERASRVIVLGTDGS-FEIGP-VDVLKRTNQ 823

Query: 691 ELFKLL 696
            L  LL
Sbjct: 824 TLINLL 829

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 239/534 (44%), Gaps = 76/534 (14%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
            +L M+G      L  + +K+ LH    + D   +G +++R   D   +   +T NI   +
Sbjct: 956  MLCMMGIMASKWLNLKAVKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTENIR-LM 1014

Query: 262  KAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ--------S 313
             +     +GV ++  +     +  I   P LL+   +     ++  RE+++         
Sbjct: 1015 MSQFANIIGVCVLCIVYLPWFAIAI---PFLLLVFVLIADHYQSAGREIKRLEAIQRSFV 1071

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLG 373
              NL  V      G+ TIK++    K   RY T +  L N          +      +  
Sbjct: 1072 YNNLIEV----LGGMDTIKAY----KSQDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFL 1123

Query: 374  D---VSFLLVL--------------AYGSHL--VLQGELSLGSLTAFMLYTEYTGSSVFG 414
            D   V+F L++              A G  L  VLQ    L ++   +  TE   +S   
Sbjct: 1124 DMIAVAFALIISLLCVTRQFHISPSAVGVLLTYVLQLPGLLNTVLRALTQTENDMNSAER 1183

Query: 415  LSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQ 473
            L  + +EL + A      +  +DY  S P        P +G + F+DVSF+Y P  PT  
Sbjct: 1184 LVTYATELPQEAA-----YRKSDY--SPPDNW-----PTNGEVIFEDVSFAYRPGLPT-- 1229

Query: 474  IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRK 533
            + K + L+I  G  + I G +G GKSTI + L R  +  SG I IDG D  K+    LR+
Sbjct: 1230 VLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDLRR 1289

Query: 534  HLGVVQQEPVLMSGTIRDN----------------ITYGLSYTPSMDEIR-AVAKKCFCH 576
             L ++ Q+PVL  GTIR N                I  G      +++I+     K   +
Sbjct: 1290 KLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDIKHQKPDKNGSY 1349

Query: 577  NFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 636
            N + KF    D ++   GA  S G+RQ +A+ RAL+++ KILILDEATS++D E++G I 
Sbjct: 1350 NNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQ 1407

Query: 637  YTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
              +      ++ TI+ IAHRL TI   + I+VL   G V E  K   L+ +E S
Sbjct: 1408 TRIA--TEFQDCTILCIAHRLKTILNYDRILVL-EKGEVAEFDKPEILFNNEKS 1458

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 101/202 (50%), Gaps = 19/202 (9%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L   I  G  + I GP G GKS++ + +  F    +G + I+G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
           + ++   P + + T+RDNI +G  Y    ++ + V + C     I   P G  T IG RG
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFGSPY--DREKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVSI 653
             LSGGQ+ RI +AR++ K   I + D+  SA+D    +  ++    + ++SK  T +  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 654 AHRLSTIRRSENIVVLGNDGSV 675
            H+LS I +++ ++VL  +GSV
Sbjct: 779 THQLSLIEKADRVIVLSTNGSV 800

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 143/491 (29%), Positives = 227/491 (46%), Gaps = 43/491 (8%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S      L   V V     +    T   I  
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQ----FLVNAVKVVFTMIVICWTTWQFIFI 1100

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL +    Y +     SREL++   ++TR       +E   G+ TI+ +     + RR
Sbjct: 1101 IGPLGVLYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGMSTIRGY----NQQRR 1155

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLL-----VLAYGSHLVLQGELSLGSL 398
            ++       N  + +   SA F+   N    ++F L     V+  G+  +    L  G+L
Sbjct: 1156 FDH-----INHCRIDNNMSA-FYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTL 1209

Query: 399  TAFML-----YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQ----T 449
            TA M+     Y      ++  +     E+     +  R+ E ++ K   P  + +     
Sbjct: 1210 TAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAA 1269

Query: 450  FVPRDGRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRF 508
              P  G I F   S  Y  RP    + + + L I P   + IVG +G GKS++   L R 
Sbjct: 1270 HWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRI 1327

Query: 509  YDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA 568
             +A+SG I+IDG  I ++    LR +L ++ Q+  +  GTIR+N+    +YT   DEI  
Sbjct: 1328 VEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETYTD--DEIWR 1385

Query: 569  VAKKCFCHNFITKF-PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627
            V +    +  +    P G    +   G+ LS GQRQ + +ARAL+   KILILDEAT+A+
Sbjct: 1386 VLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAV 1445

Query: 628  DVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687
            DVE++  I  T+    R +  TI++IAHR++TI  S+ IVVL + G V E     +L R+
Sbjct: 1446 DVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTNLLRN 1502

Query: 688  EDSELFKLLNE 698
            E S+   L  E
Sbjct: 1503 EGSQFHSLCQE 1513

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 111/449 (24%), Positives = 197/449 (43%), Gaps = 48/449 (10%)

Query: 275 FHISSTLTSAMIMFAPPLLIAATIY------GKRIRAISRELQQSTGNL----TRVSEEQ 324
           F +   L S   +  P + I   I          +  I + LQ+S        T V  E 
Sbjct: 430 FQVVICLVSLYKLLGPSMWIGVVILLVMTPLNTFLAKIQKRLQKSQMGFKDERTSVISEI 489

Query: 325 FNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLL 379
            N IK++K +  E       E  R +  ++ L  +     ITS  F     ++   +F  
Sbjct: 490 LNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCTFA- 548

Query: 380 VLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE-LTDY 438
           V  Y     L  +L   +LT F L +      +F + N  +  ++ + + +RLF  LT+ 
Sbjct: 549 VFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFLTNE 604

Query: 439 KKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRLTITPGSNVCIVGPS 494
           +    S      V   G +  K   D +F +  +P  ++  K +      G   C+VG  
Sbjct: 605 ELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVVGRV 664

Query: 495 GRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQQEPVLMSGTIRDNI 553
           G GKS +   L       SG       D+ +V    ++   +  V Q   +M+GT+++NI
Sbjct: 665 GSGKSALIQSL-------SG-------DLFRVKGFATVHGSVAYVSQVAWIMNGTVKENI 710

Query: 554 TYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIK 613
            +G  Y P   +     K C     +    DG +T++G +G  LSGGQ+ R+++ARA+  
Sbjct: 711 LFGHRYDPEFYD--KTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARAVYA 768

Query: 614 KPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRLSTIRRSENIVVLG 670
           +    +LD+  +A+D    +  + + LG   L+R+K  T +   +++S +  ++ I +L 
Sbjct: 769 RADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTK--TKILATNKISVLSIADRIALLE 826

Query: 671 NDGSVIEAGKFADLYRDEDSELFKLLNEH 699
           N G ++E G + ++  D DS L KL+ ++
Sbjct: 827 N-GEIVEQGSYDEVTADGDSALSKLIRDY 854

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  149 bits (375), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 143/524 (27%), Positives = 251/524 (47%), Gaps = 69/524 (13%)

Query: 207  GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL- 265
            G R   ++   ++   LH    FFD   VG +++R   D   V + +   +   +   + 
Sbjct: 1067 GMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQ 1126

Query: 266  CGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVS 321
            C  +   +       LT A+I+F     +     GK     SREL++    +   + +  
Sbjct: 1127 CASIIFLITVITPRFLTVAVIVFVLYFFV-----GKWYLTASRELKRLDSITKSPIFQHF 1181

Query: 322  EEQFNGIKTIKSFVAEGK----EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSF 377
             E   G+ TI++F  E +     M + +   R  F ++    +T   F    +++G    
Sbjct: 1182 SETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLS----VTVKWFSFRVDMIGA--- 1234

Query: 378  LLVLAYGSHLVLQ-----GELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL 432
             +VLA GS ++L        L+  SLT  +L+T+        L   YS       +  RL
Sbjct: 1235 FIVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERL 1290

Query: 433  FELTDYKKS--VPSTVGQTFV------PRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTIT 483
             E +  ++   +    G+  +      P+DG IE +++S  Y P  P   + + +   + 
Sbjct: 1291 KEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLP--PVIRNVSFKVD 1348

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
            P S + IVG +G GKSTI + L R  +  +G I IDGQDISK+   +LR+ + ++ Q+P+
Sbjct: 1349 PQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPI 1408

Query: 544  LMSGTIRDNITYGLSYTP-----SMDEIRAVAKKCF------------CHNFITKFPDGY 586
            L +GTI+ N+     Y       ++ ++  ++   F             HN   KF + +
Sbjct: 1409 LFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHN---KFLNLH 1465

Query: 587  DTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK 646
             T I   G  LS G+RQ + IAR+L+++PKI++LDEATS++D +S+  I      ++RS+
Sbjct: 1466 -TEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQ----GIIRSE 1520

Query: 647  --EITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
              + TI++IAHRL ++   + I+V+ + G V E  + ++L +DE
Sbjct: 1521 FNKSTILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKDE 1563

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 115/473 (24%), Positives = 209/473 (44%), Gaps = 43/473 (9%)

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFH---ISSTLTSAMIMFAP 290
            +G +I+ +  D++ VS  + + +   V+A +   V VG++F+   +S+    ++I+   
Sbjct: 444 NLGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMF 502

Query: 291 PL-LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSF------VAEGKEMRR 343
           PL  + A + GK  +   +   Q    L     E    I+ +K F      + E K +R+
Sbjct: 503 PLNFLLANLLGKFQKQTLKCTDQRISKL----NECLQNIRIVKYFAWERNIINEIKSIRQ 558

Query: 344 YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFML 403
               +R L   +    +TS  +F    ++  V+F  +  +  H  L   L+  +L+ F L
Sbjct: 559 --KELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFA-ICTFVQHEDLNAPLAFTTLSLFTL 615

Query: 404 YTEYTGSSVFGLSNFYSELMKGAGAASRL---FELTDYKKSVPSTVGQTFVPRDGRIEFK 460
                 + +  LSN  S + +   +  R+     + D +K    T+     P   +IEFK
Sbjct: 616 LK----TPLDQLSNMLSFINQSKVSLKRISDFLRMDDTEKYNQLTIS----PDKNKIEFK 667

Query: 461 DVSFSYPTRPTS-QIFK--KLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTIL 517
           + + ++    +    FK   L +    G    I+G +G GKS +   LL   +  SG+I+
Sbjct: 668 NATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSII 727

Query: 518 IDG----QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKC 573
           +       D+     + L        Q   L++ T+++NI +   Y    D    V   C
Sbjct: 728 VPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNE--DRYNKVIDAC 784

Query: 574 FCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 633
                +   P G  T IG +G  LSGGQ+QRI++ARA+    K ++LD+  SA+D  +  
Sbjct: 785 GLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAV 844

Query: 634 AI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            I  N   G LM+++  T + + H +S   R+ +  ++  +G V   G   +L
Sbjct: 845 WIYENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITEL 895

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 137/511 (26%), Positives = 235/511 (45%), Gaps = 55/511 (10%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMM--- 274
            +++K LH    FFD   +G +++R   D   V + +T    +G   +L   +   ++   
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTP-FFEGAFYSLVTCLSTVVLITF 1240

Query: 275  ----FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKT 330
                F I + + + +  F     +A +   KR+ +ISR        + +   E   G+ T
Sbjct: 1241 ITPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISR------SPIYQHFSETLVGVTT 1294

Query: 331  IKSFVAEGK----EMRRYNTAVRRLFN--VAKREGITSATFFSGTNVLGDVSFLLVLAYG 384
            I++F  E +     + + +   R  F   VA R             V G   F+L+    
Sbjct: 1295 IRAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMRIDLIGSLVVFGAGVFILLNI-- 1352

Query: 385  SHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKK---S 441
             H+     ++  SLT  + +TE        L   YS +     +  RL E    ++   +
Sbjct: 1353 DHI--DAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYN 1406

Query: 442  VPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
             P     +  P+ GR+E  DVS  Y P  P  ++ K +  T+ P S V +VG +G GKST
Sbjct: 1407 QPIMTPPSDWPQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKST 1464

Query: 501  IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
            I + L RF D  +G I ID  DIS +  + LR+ + ++ Q+P L +GTI+ N+     Y+
Sbjct: 1465 IITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYS 1524

Query: 561  ----------------PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
                              +D     A      N + KF D  ++ I   G  LS GQRQ 
Sbjct: 1525 DEDIFAALKRVNLVSQEELDRSNIDAASVGSEN-VNKFLD-LNSEINEGGGNLSQGQRQL 1582

Query: 605  IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE 664
            + +AR+L++ PKI++LDEAT+++D +S+  I  T+ +  +    TI++IAHRL ++   +
Sbjct: 1583 VCLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYD 1640

Query: 665  NIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
             I+V+ + G V E      L  +++S+ + +
Sbjct: 1641 KILVM-DQGEVKEYDHPYSLLLNKNSQFYSM 1670

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/462 (22%), Positives = 204/462 (44%), Gaps = 34/462 (7%)

Query: 234 KVGDLISRLGSDAYIVSR--SMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPP 291
            +G +I+ +  DA+ VS   +  H   + V  +    V +  +  +S+ + + +I+   P
Sbjct: 526 NLGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLYKLLGLSAIIGALLIVVLMP 585

Query: 292 LLIAATIYGKRIRAISRELQQSTGNLT--RVSE--EQFNGIKTIKSFVAE-----GKEMR 342
           +         R+     +LQ+ + + T  R+    E F  I+ IK F  E     G +  
Sbjct: 586 V-------NFRLVTWLGQLQKKSLSYTDKRIQNLNEAFQAIRIIKFFSWEDNFEKGIQAI 638

Query: 343 RYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFM 402
           R +  ++ L   +    + S  +++   ++   +F   + Y     L   ++  +L+ F 
Sbjct: 639 R-DVELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYI-YVQKQTLTTPVAFTALSLFS 696

Query: 403 LYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDV 462
           L      + +  LS+  S +++   +  R+ E  + +         +  P   ++ F++ 
Sbjct: 697 LLR----TPLDQLSDMLSFVIQSKVSLDRIQEFLE-EPDTDKYNQLSVAPGGQKLGFENA 751

Query: 463 SFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILI---D 519
           + S+ +       + L +    G    ++GP+G GK++I   LL      +G I++   D
Sbjct: 752 TISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLD 811

Query: 520 GQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFI 579
            + +  + A  +   +    Q   L++ T+R+NI +   Y+ +      V + C      
Sbjct: 812 PRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEA--RYNDVIEACGLKRDF 869

Query: 580 TKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NY 637
                G  T IG RG  LSGGQ+QRI++AR+L    + L+LD+  SA+D  +   I  N 
Sbjct: 870 EILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNC 929

Query: 638 TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
             G LM+ +  T + I+H ++   R+  +VVL  +G V E G
Sbjct: 930 ITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 229/493 (46%), Gaps = 47/493 (9%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +    T   I  
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQ----FFVNAVKVTFTITVICVTTWQFIFI 1096

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL +    Y +     SREL++   ++TR       +E   G+ T++ +     + +R
Sbjct: 1097 IVPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY----SQQKR 1151

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL-----------QGE 392
            ++       N  + +   SA F+   N    +++ L L  GS ++L           QG 
Sbjct: 1152 FSH-----INQCRIDNNMSA-FYPSVNANRWLAYRLELI-GSVIILGAATLSVFRLKQGT 1204

Query: 393  LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452
            L+ G +   + Y      ++  +     E+     +  R+ E  D K   P  +     P
Sbjct: 1205 LTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPP 1264

Query: 453  RD----GRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
            ++    G I+F   S  Y  RP    + K++ + I P   + IVG +G GKS++   L R
Sbjct: 1265 KEWPGQGDIKFNQYSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFR 1322

Query: 508  FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-- 565
              +A++G I+IDG  I+++    LR  L ++ Q+  +  GT+R+NI     YT   DE  
Sbjct: 1323 IIEASAGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYT---DEAM 1379

Query: 566  IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATS 625
             RA+       + ++   DG D+ +   G+ LS GQRQ + +ARA++ + KIL+LDEAT+
Sbjct: 1380 WRALELSHLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATA 1439

Query: 626  ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
            A+DVE++  I  T+    + +  TI++IAHRL+TI  S+ I+VL N G V E    A L 
Sbjct: 1440 AVDVETDKVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPAQLL 1496

Query: 686  RDEDSELFKLLNE 698
             +  S  + L  E
Sbjct: 1497 TNTKSLFYSLCAE 1509

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 105/412 (25%), Positives = 186/412 (45%), Gaps = 42/412 (10%)

Query: 306 ISRELQQSTGNL----TRVSEEQFNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAK 356
           I ++LQ+S        TRV  E  N IK++K +  E       E  R N  +  L  +  
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGC 528

Query: 357 REGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLS 416
              +TS  F     ++   +F  V  Y     L  +L   +LT F L +         L+
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTFA-VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 587

Query: 417 NFYSELMKGAGAASRLFELTDYKKSVPSTVGQT-FVPRDGRIEFK---DVSFSYPTRPTS 472
           +F    ++ + +  RLF     ++  P +V +   V   G I      D +F +  +P  
Sbjct: 588 SF----IEASVSIGRLFSFFTNEELQPDSVQRLPKVENVGDIAINIGDDATFLWQRKPEY 643

Query: 473 QI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KS 530
           ++  K +      G   C+VG  G GK+ + S  L               D+ +V    S
Sbjct: 644 KVALKNINFQAKKGELTCVVGKVGSGKTALLSSTL--------------GDLFRVKGFAS 689

Query: 531 LRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVI 590
           +   +  V Q P +M+GT+++NI +G  Y     E     K C     +    DG  T++
Sbjct: 690 VHGSVAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDQTLV 747

Query: 591 GPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKE 647
           G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   +   + + LG   L+ +K 
Sbjct: 748 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTK- 806

Query: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            T +   +++S +  +++I +L N G +I+ G + D+ +D DS L+KL+ ++
Sbjct: 807 -TKLLATNKVSALSVADSIALLDN-GEIIQQGTYDDITKDADSPLWKLIKDY 856

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 145/513 (28%), Positives = 235/513 (45%), Gaps = 58/513 (11%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCG-----G 268
            L  + +K+ LH    + D   +G +++R   D    + S+ + +++ V+  L       G
Sbjct: 999  LNLRAVKRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRMLLYQFANIVG 1054

Query: 269  VGVGMMFHISSTLTSAMIMFAPPLLIAATIYG-----KRIRAISRELQQSTGNLTRVSEE 323
            V +  + ++     +   +F   +LIA          KR+ AI R    +  N      E
Sbjct: 1055 VCIMCIIYLPWFAIAIPFLFVGFVLIADHYQSSGREIKRLEAIQRSFVYNNFN------E 1108

Query: 324  QFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAY 383
               G+ TIKS+ +E + + + +  + ++ N A    +    + +    +  V F L++  
Sbjct: 1109 VLGGMDTIKSYRSENRFIAKSDFLIDKM-NEAGYLVVAVQRWVAIFLDVIAVCFALIITL 1167

Query: 384  GSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF----EL---T 436
               +     +S  S+   + Y       + G+    ++      +A RL     EL    
Sbjct: 1168 LC-VTRAFPISAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSAERLVTYATELPLEA 1226

Query: 437  DYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
            DY+K  P        P  G I F++V FSY P  PT  + K L L I  G  + I G +G
Sbjct: 1227 DYRK--PEVSPPEEWPTKGEIHFENVDFSYRPGLPT--VLKNLSLDIKSGEKIGICGRTG 1282

Query: 496  RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
             GKSTI S L R  + +SG ++ID  DIS +    LR+ L ++ Q+PVL  GTIR N+  
Sbjct: 1283 AGKSTIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDP 1342

Query: 556  ----------------GLSYTPSMDEIRAVA-KKCFCHNFITKFPDGYDTVIGPRGALLS 598
                            G      ++EI+A    +   H+ + KF    D ++   GA  S
Sbjct: 1343 FNEHQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFS 1400

Query: 599  GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS-KEITIVSIAHRL 657
             G+RQ +A+ RAL+++ +ILILDEATS++D E++G I     R++      TI+ IAHRL
Sbjct: 1401 LGERQLLALTRALVRQARILILDEATSSVDYETDGKIQ---ARIVEEFGHCTILCIAHRL 1457

Query: 658  STIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
             TI   + I+VL   G V E      L+  EDS
Sbjct: 1458 KTILTYDRILVL-EKGEVAEFDTPKTLFAQEDS 1489

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 102/203 (50%), Gaps = 23/203 (11%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L   I  G  + +VGP G GK+++ +    F +  SG I I+G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPS-MDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
             ++   P + + +++DNI +G  Y  +  DE   V + C   + +   P G  T IG R
Sbjct: 697 --LLCGYPWIQNASVKDNIIFGSPYNKAKYDE---VIRVCSLKSDLDILPAGDLTEIGER 751

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIV 651
           G  LSGGQ+ RI +AR++ K+  I + D+  SA+D      I     LG L   K+ T +
Sbjct: 752 GITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLL---KDKTRI 808

Query: 652 SIAHRLSTIRRSENIVVLGNDGS 674
              H+LS + R+  ++VLGNDGS
Sbjct: 809 LATHQLSLLERASRVIVLGNDGS 831

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 148/532 (27%), Positives = 239/532 (44%), Gaps = 86/532 (16%)

Query: 205  MLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA 264
             +G     +L    +++ LH    F D   +G +++R   D   +   +T N+   + A 
Sbjct: 943  FIGVNASKKLNLSAVRRILHTPMAFLDTTPLGRILNRFTKDTDSLDNELTENVR-LMLAQ 1001

Query: 265  LCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG-------KRIRAISRELQQSTGNL 317
                +GV +M  I     +  I F   + +  + +        KR+ AI R    +  N 
Sbjct: 1002 FANIIGVCVMCIIYLPWFAIAIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLN- 1060

Query: 318  TRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD--- 374
                 E   G+ TI+ + +E + M + +  + ++       G           VL D   
Sbjct: 1061 -----EVLGGMDTIRFYNSEERFMAKSDYLIDKM----NEAGYLVVCVQRWVAVLLDMIA 1111

Query: 375  VSFLLVLAYGSHLVLQGELSLGSLTAFMLY-----------------TEYTGSSVFGLSN 417
            V F L++A    +  Q  +S  S+   + Y                 TE   +SV  L +
Sbjct: 1112 VCFALIIALLC-VTRQFHISASSVGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVS 1170

Query: 418  FYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFK 476
            + +EL   A           Y+K  P +      P++G+I+F++VSF+Y P  P   + K
Sbjct: 1171 YATELPTEAA----------YRK--PESSPDPSWPQEGKIDFEEVSFAYRPGLPA--VLK 1216

Query: 477  KLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLG 536
             L ++I  G  + I G +G GKSTI S L R  +  SG I+IDG +IS +    LR+ L 
Sbjct: 1217 NLSMSINGGEKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLS 1276

Query: 537  VVQQEPVLMSGTIRDNIT-YG----------LSYTPSMD-----EIRAV-----AKKCFC 575
            ++ Q+PVL  GTIR N+  +G          LS   S+D     E++       +K    
Sbjct: 1277 IIPQDPVLFRGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQEL 1336

Query: 576  HNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
            H F        D  +   G+  S G+RQ +A+ARAL++  K+LILDEATS++D E++  I
Sbjct: 1337 HKF------HLDQEVEEEGSNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKI 1390

Query: 636  NYTLGRLMRS-KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYR 686
                 R++ +  E TI+ IAHRL TI   + I+VL   G + E     +LY+
Sbjct: 1391 Q---NRIIEAFSECTILCIAHRLKTILNYDRILVL-EKGEIAEFDSPYNLYK 1438

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 109/226 (48%), Gaps = 22/226 (9%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           FK + L I  G  + I GP G GK+++ + +    +   G++ I+G+ +           
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELL----------- 652

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
              +   P + + T+RDNI +G  +  S  +   V K C     +   P G  T IG RG
Sbjct: 653 ---MGGYPWIQNATVRDNIIFGSPFDKS--KYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI-NYTLGRLMRSKEITIVSI 653
             LSGGQ+ RI +AR + K   I + D+  SA+D      I +  L  L+  K  T V  
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK--TRVLA 765

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            H+LS +  +  ++VLGNDGSV + G   +L +   ++ F  L EH
Sbjct: 766 THQLSLVENASRVIVLGNDGSV-DIGTVEELKK--RNQTFITLMEH 808

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  145 bits (366), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 136/493 (27%), Positives = 227/493 (46%), Gaps = 47/493 (9%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +    T   I  
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQ----FFVNAVKVIFTITVICATTWQFIFI 1096

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL +    Y +     SREL++   ++TR       +E   G+ T++ +     + +R
Sbjct: 1097 IIPLGVCYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY----SQQKR 1151

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL-----------QGE 392
            ++       N  + +   SA F+   N    +++ L L  GS ++L           QG 
Sbjct: 1152 FSH-----INQCRIDNNMSA-FYPSINANRWLAYRLELI-GSIIILGAATLSVFRLKQGT 1204

Query: 393  LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452
            L+ G     + Y      ++  +     E+     +  R+ E  D K   P T+     P
Sbjct: 1205 LTAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPP 1264

Query: 453  RD----GRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
            ++    G I+F + S  Y  RP    + K + + I P   + IVG +G GKS++   L R
Sbjct: 1265 KEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFR 1322

Query: 508  FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-- 565
              +A++G I+IDG  I+++    LR  L ++ Q+  +  G++R+NI     YT   DE  
Sbjct: 1323 MIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENIDPTNQYT---DEAI 1379

Query: 566  IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATS 625
             RA+       + ++   DG D  +   G  LS GQRQ + +ARA++   KILILDEAT+
Sbjct: 1380 WRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATA 1439

Query: 626  ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
            A+DVE++  +  T+    + +  TI++IAHRL+TI  S+ I+VL N G+V E    + L 
Sbjct: 1440 AVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLL 1496

Query: 686  RDEDSELFKLLNE 698
             + +S    L  E
Sbjct: 1497 SNSESLFHSLCAE 1509

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 188/421 (44%), Gaps = 60/421 (14%)

Query: 306 ISRELQQSTGNL----TRVSEEQFNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAK 356
           I ++LQ+S        TRV  E  N IK++K +  E       E  R N  ++ L  +  
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGC 528

Query: 357 REGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLS 416
              +TS  F     ++   +F  V  Y     L  +L   +LT F L +         L+
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTFA-VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 587

Query: 417 NFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPR-----DGRIEF-KDVSFSYPTRP 470
           +F    ++ + +  RLF     ++  P +V +  +P+     D  I    D +F +  +P
Sbjct: 588 SF----IEASVSIGRLFTFFTNEELQPDSVQR--LPKVENFGDVAINVGDDATFLWQRKP 641

Query: 471 TSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA- 528
             ++  K +      G   C+VG  G GK+ + S +L               D+ +V   
Sbjct: 642 EYKVALKNINFQAKKGELTCVVGKVGSGKTALLSCML--------------GDLFRVKGF 687

Query: 529 KSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDT 588
            ++   +  V Q P +M+GT+ +NI +G  Y     E     K C     +    DG  T
Sbjct: 688 ATVHGSVAYVSQVPWIMNGTVMENILFGHKYDVEFYE--KTIKACALTIDLAILMDGDKT 745

Query: 589 VIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLG------- 640
           ++G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   +   I + LG       
Sbjct: 746 LVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHT 805

Query: 641 --RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
             RL+ + +++ +SIA          + V L ++G +I+ G + ++ +D DS L+KLLN+
Sbjct: 806 KTRLLATNKVSALSIA----------DSVALLDNGEIIQKGTYDEITKDADSPLWKLLND 855

Query: 699 H 699
           +
Sbjct: 856 Y 856

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 140/504 (27%), Positives = 226/504 (44%), Gaps = 43/504 (8%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGM 273
            L   ++   L     FF+   +G +++R  +D Y V   +    S            V  
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQ----FFANTTRVSF 1058

Query: 274  MFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIK 329
               +    T     F  PL +    Y +     SREL++    +   +    +E  NG+ 
Sbjct: 1059 TIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVS 1118

Query: 330  TIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL 389
            +I+ +     ++ R+        N A+    TSA ++   NV   +++ L       +  
Sbjct: 1119 SIRGY----GQLDRFIH-----INQARINNNTSA-YYPSMNVNRWLAYRLEFIGSCIIFF 1168

Query: 390  QGELSL-----GSLTAFML-----YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYK 439
               LS+     GSLT+ M+     Y      S+  +     E+     +  R+ E  + +
Sbjct: 1169 AATLSVFRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELE 1228

Query: 440  KSVPSTVGQTF----VPRDGRIEFKDVSFSYPTRP-TSQIFKKLRLTITPGSNVCIVGPS 494
               P  +  +      P+DG I+F++ S  Y  RP    I + + L I P   V IVG +
Sbjct: 1229 PEAPQFIANSVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRT 1286

Query: 495  GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
            G GKS++A  L R  +A  G I IDG  I  +    LRK L ++ Q+  +  GT+RDNI 
Sbjct: 1287 GAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNID 1346

Query: 555  YGLSYTPSMDE--IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALI 612
                YT   DE   +A+       +      DG DT +   G  LS GQRQ + +ARAL+
Sbjct: 1347 PTKQYT---DEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALL 1403

Query: 613  KKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGND 672
               +IL+LDEAT+A+DVE++  I  T+      +  TI++IAHR++TI  S+ IVVL + 
Sbjct: 1404 IPFRILVLDEATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DK 1460

Query: 673  GSVIEAGKFADLYRDEDSELFKLL 696
            G+V E     +L + ++  +F  L
Sbjct: 1461 GTVAEFDTPENLLKKKEESIFYTL 1484

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 116/518 (22%), Positives = 224/518 (43%), Gaps = 60/518 (11%)

Query: 207 GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALC 266
           G  L + + + + KK LH   E    +  GD+++ +  DA  + R +T            
Sbjct: 355 GTDLRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQ----------W 403

Query: 267 GGVGVGMMFHISSTLTSAMIMFAPPLLIAATI---------YGKRI-RAISRELQQSTGN 316
           G V     F +   L S   +  P + +   +         Y  R+ + + +E  ++   
Sbjct: 404 GNVIWSGPFQLCLCLYSLHRLLGPCIWVGVVLLLFTLPLNSYISRVLKRLQKEQMKNKDE 463

Query: 317 LTRVSEEQFNGIKTIKSFVAE--GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
            TR+  E  N IK++K +  E   KE   Y    + L    ++ G+T+A      N+   
Sbjct: 464 RTRLISEILNNIKSLKLYAWEIPYKEKLDYVRNQKEL-KTLRKMGLTTAFANFQYNI--- 519

Query: 375 VSFLLVLAYGSHLVLQ-------GELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAG 427
           + FL+  +  +  VL         +L   +LT F L +         +++F  E     G
Sbjct: 520 IPFLVSCSTFAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSFI-EASVAIG 578

Query: 428 AASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKD-VSFSYPTRPTSQI-FKKLRLTITPG 485
             +      + ++   +       P    +   D  +F +  +P  ++  K +       
Sbjct: 579 RLTNFLTAEELQRDAITREPAVKAPGGVAVALADNATFLWQRKPEYKVALKNINFRAKKS 638

Query: 486 SNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSL-RKHLGVVQQEPVL 544
              CI+G  G GKS +   +L               D+ +V+  ++ R ++  V Q   +
Sbjct: 639 ELTCIIGKVGSGKSALIQAML--------------GDLFRVNGSAVVRGNVAYVSQVAWI 684

Query: 545 MSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
           M+GT+RDNI +G  Y       +   K C     ++  PDG +T +G +G  LSGGQ+ R
Sbjct: 685 MNGTVRDNILFGHKYDAKF--YQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKAR 742

Query: 605 IAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRLSTIR 661
           +++ARA+  +    +LD+  +A+D   ++  +    G   L++SK   + +  ++++ + 
Sbjct: 743 LSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALE 800

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            +++IV+L N G +++ G F+++  DEDS + KL+  H
Sbjct: 801 IADHIVLLEN-GEIVQQGTFSEVISDEDSAISKLVLHH 837

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  145 bits (365), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 136/492 (27%), Positives = 233/492 (47%), Gaps = 58/492 (11%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            ++ + ++ K LH +  FFD   +G +++R   D   V + +   +    +AAL   + + 
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYL----EAALYCIIDIS 1194

Query: 273  MMFHISSTLTSAMIMFAPPLLIAATIY--GKRIRAISRELQQ----STGNLTRVSEEQFN 326
                + + +T   ++ A  +L+A   Y  G    A SREL++    +   + +   E   
Sbjct: 1195 STILLITYITPEFLIIA--ILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLV 1252

Query: 327  GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSH 386
            G+ T++++  E + MR     +           +++       +V+G    L++   G  
Sbjct: 1253 GVTTVRAYGDEARFMRENLKMIDENNKPFFYLWVSNRWLAFRIDVVGA---LVIFGSGVF 1309

Query: 387  LVLQGE-----LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD---- 437
            ++L  +     L+  SL+  + +TE    S   L   YS L     +  RL E  +    
Sbjct: 1310 VLLNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYMEVEQE 1365

Query: 438  -YKKS---VPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVG 492
             YK S   VPS+      P +G+IE  DVS  Y P  P  ++ K    T+ P   V IVG
Sbjct: 1366 PYKSSSLDVPSSW-----PEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVG 1418

Query: 493  PSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN 552
             +G GKSTI + L RF D  +G+I ID  DIS +  K LR+ + ++ Q+P L SGTI+ N
Sbjct: 1419 RTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSN 1478

Query: 553  ITYGLSYT-----PSMDEIRAVAKK----------CFCHNFITKFPDGYDTVIGPRGALL 597
            +     Y+      ++  +  V +K                  KF +  +  I   G+ L
Sbjct: 1479 LDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLN-VNNEISEGGSNL 1537

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            S GQRQ + +AR+L++ PK+++LDEAT+++D  S+  I  T+       + TI++IAHRL
Sbjct: 1538 SQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIAHRL 1595

Query: 658  STIRRSENIVVL 669
             T+   + I+V+
Sbjct: 1596 RTVIDYDKILVM 1607

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 109/473 (23%), Positives = 211/473 (44%), Gaps = 52/473 (10%)

Query: 233 NKVGDLISRLGSDAYIVSR--SMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAP 290
           + +G +I+ +  D + V+   +  H+  + V   +   + +  +  +++ + +++I+   
Sbjct: 482 SNLGSIINLMAVDTFKVADICAYLHHFVEAVVMTIVALILLFKLLGVAAIVGASLIIALL 541

Query: 291 PL-LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGK------EMRR 343
           PL    A++ GK  +   + L+ +   + +++E  F  I+ IK F  E        E+R 
Sbjct: 542 PLNFKLASLLGKYQK---KSLEVTDKRIQKLNE-AFQAIRIIKFFSWEDNFEKDILEVRE 597

Query: 344 YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFML 403
               +R +   +    I+S  +F    ++   SF        ++ +QGE+         +
Sbjct: 598 --RELRMILIRSIVWAISSFVWFVTPTIVTGASF------TYYVYVQGEV-------LTI 642

Query: 404 YTEYTGSSVFGL--------SNFYSELMKGAGAASRL---FELTDYKKSVPSTVGQTFVP 452
              +T  S+F L        S+  S +++   +  R+    E  D KK    TV +    
Sbjct: 643 PVAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLDRIQEFLEEEDTKKYEQLTVDK---- 698

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
              +I FK+ + ++         + + +    G    I+GP+G GK+++   LL   D  
Sbjct: 699 YQNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLI 758

Query: 513 SGTILI---DGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAV 569
            G I++   D ++  K+ A  L   +    Q   L++ T+R+NI +   Y    +   AV
Sbjct: 759 DGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFNSPYCE--ERYNAV 816

Query: 570 AKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDV 629
            +             G  T IG RG  LSGGQ+QR+++ARAL    K L+LD+  SA+D 
Sbjct: 817 VEASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDS 876

Query: 630 ESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
            +   I  N   G LM ++  T + ++H ++   R+ + VV   +G ++E G+
Sbjct: 877 HTATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 142/503 (28%), Positives = 228/503 (45%), Gaps = 59/503 (11%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +I+R  SD   V R++ +N +   K  L   V + ++ +         ++F
Sbjct: 1077 FFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYN----MPWFLVF 1132

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAV 348
               LL+    Y      +SREL+       R+S   F+ I ++ S    G  +    TA 
Sbjct: 1133 NAGLLVVYVYYQVFYVTLSRELK-------RLSSTAFSPIMSLFSETLGGHMVI---TAF 1182

Query: 349  RR-----LFNVAKREGITSATF-FSGTNVLGDVSFLLVLAYGSHLVLQGELSLGS----- 397
            R        N  K +    A F    TN    +S  L +  G+ +++   L+L +     
Sbjct: 1183 RHSERFHFLNFNKTQFQIDAQFNLRSTNRW--LSIRLQIIGGAMVLITALLTLATIGTKK 1240

Query: 398  -LTA-----FMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVG---- 447
             +TA      M Y     +S+  +    + +     +  R++E        P+ +     
Sbjct: 1241 QMTAGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRP 1300

Query: 448  QTFVPRDGRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL 506
            +   P  G I FKD S  Y  RP    + KK+ L+I P   + +VG +G GKS+++  L 
Sbjct: 1301 EKSWPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALF 1358

Query: 507  RFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEI 566
            R  ++  G+I IDG DISK+    LR HL ++ Q+     GT+R N+     Y  S+ EI
Sbjct: 1359 RLLESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQY--SVQEI 1416

Query: 567  RAVAKKCFCHNFITKF-----PD---------GYDTVIGPRGALLSGGQRQRIAIARALI 612
                +       I K      PD           D  I   G  +S GQRQ + ++RAL+
Sbjct: 1417 WKAVELAHLKPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALL 1476

Query: 613  KKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGND 672
             K K+L+LDEAT+A+D+E++  I  T+    + K  TI++IAHR+ T+  S+ I+VL + 
Sbjct: 1477 SKSKVLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DK 1533

Query: 673  GSVIEAGKFADLYRDEDSELFKL 695
            G V E      L +DE S  + L
Sbjct: 1534 GEVKEFESPDTLLKDEKSLFYGL 1556

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 113/219 (51%), Gaps = 15/219 (6%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
           G+  C+VG  G GKST+   +L      SG       +I  V A+S+        Q P +
Sbjct: 667 GALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEI-LVRARSV----AYCPQAPWV 721

Query: 545 MSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
           M+ +I+DNI +G  Y  +   +    K C     +    +G +T++G +G  LSGGQ+ R
Sbjct: 722 MNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLSGGQKAR 779

Query: 605 IAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSKEITIVSIAHRLSTI 660
           +++ARA+  +  + ++D+  SA+D E S+  I+  LG    L++ K  TI+   + +S +
Sbjct: 780 LSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTTNAVSVL 837

Query: 661 RRSENIVVLGNDGSVIEAGKFAD-LYRDEDSELFKLLNE 698
           + S  I  L   G ++E G +   + R +DS L KL+ E
Sbjct: 838 KHSNMIYAL-QGGRIVEEGTYEQAVSRGDDSVLQKLIKE 875

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 144/528 (27%), Positives = 243/528 (46%), Gaps = 64/528 (12%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
            LL  LG R    L  + +++ LH    + D   +G +++R   D    + S+ + +++ +
Sbjct: 921  LLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESI 976

Query: 262  KAALCGGVGVGMMFHISSTLTSAMIMFA---PPLLIAATIYGKRIRAISRELQQSTGNLT 318
            +  L     VG +  +       +  FA   P LLI   +     ++  RE+++      
Sbjct: 977  RLMLSQ---VGNLIGVIVMCIVYLPWFAIAVPFLLIIFVLICDHYQSTGREIKRLEAVQR 1033

Query: 319  RVSEEQFN----GIKTIKSFVAEGKEMRRYNTAVRRL-----FNVAKREGI-----TSAT 364
                  FN    G+ TIK++ ++ + + + +  + ++       VA +  +     + A 
Sbjct: 1034 SFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAILLDSVAV 1093

Query: 365  FFSGTNVLGDVSFLLVLAYGS-----HLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFY 419
             F+    L  V+    ++ GS       VLQ    L ++   +  TE   +S   L  + 
Sbjct: 1094 VFALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVTYA 1153

Query: 420  SELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKL 478
            +EL   A           Y+K  P        P  G I+F DV+F+Y P  P   + K +
Sbjct: 1154 TELPLEAA----------YRK--PEVSPPESWPEKGDIDFIDVNFAYRPGLPV--VLKNM 1199

Query: 479  RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVV 538
             L I  G  + I G +G GKSTI S L R  + + G I+IDG DI K+    LRK L ++
Sbjct: 1200 NLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTII 1259

Query: 539  QQEPVLMSGTIRDN----------------ITYGLSYTPSMDEIRAVAKKCFCHNFITKF 582
             Q+PVL  GTIR N                I  G+    ++++I+ + K    +++    
Sbjct: 1260 PQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLNDIK-LEKPDENNSYSNMH 1318

Query: 583  PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 642
                D ++   G+  S G+RQ +A+ RAL++  KILILDEATS++D E++G I   +  +
Sbjct: 1319 KFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRI--V 1376

Query: 643  MRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
                + TI+ IAHRL TI   + I+VL   G + E  K  +L+ D++S
Sbjct: 1377 SEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFNDKNS 1423

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 100/201 (49%), Gaps = 19/201 (9%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L L I  G  + + GP G GK+++ + +  F    SG + ++G+ +           
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGELL----------- 629

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
              +   P +++ T+RDNI +G  Y  +      + + C     +   P G  T IG RG
Sbjct: 630 ---LCGYPWILNATVRDNILFGSPYEEA--RYNEIVEVCSLDADLKILPAGDRTEIGERG 684

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVSI 653
             LSGGQ+ RI +ARA+ K   I + D+  SA+D    +  ++  L  +++ K  T +  
Sbjct: 685 ITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRILA 742

Query: 654 AHRLSTIRRSENIVVLGNDGS 674
            H+LS I R++ I+V+G +GS
Sbjct: 743 THQLSVIERADRIIVVGPNGS 763

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 141/513 (27%), Positives = 233/513 (45%), Gaps = 58/513 (11%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV-KAALCGGVGVG 272
            L  + +K+ LH    F D   +G +++R   D   +   +T ++   V + A   GV + 
Sbjct: 928  LNLKAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIM 987

Query: 273  MMFHISSTLTSAMIMFAPPLLIAATIYG------KRIRAISRELQQSTGNLTRVSEEQFN 326
             + ++      A+       +I A  Y       KR+ A+ R    +  N      E  +
Sbjct: 988  CIIYLP-WFAIAVPFLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFN------EVLS 1040

Query: 327  GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSH 386
            G+ TIK++ +E + + + +  + R+ + A    +    + S +  +  V+F L++     
Sbjct: 1041 GMDTIKAYKSENRFLMKSDFLINRM-SEAGYLVVAVQRWVSISLDMIAVAFALIITLLC- 1098

Query: 387  LVLQGELSLGSLTAFMLYTEYTGSSVFGL-------SNFYSELMKGAGAASRLFELTDYK 439
            +  Q ++S  S+   + Y       + GL        N  + + +    A+ L +   Y+
Sbjct: 1099 VTRQFDISAASVGVLLTYVLQLPGLLNGLLRAMTQAENDMNSVERIVNYATELPQEAAYR 1158

Query: 440  KSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
            K  P    Q   P +G + F +VS SY P  P   + K + L I  G  + I G +G GK
Sbjct: 1159 K--PEMTPQEPWPSNGEVVFDNVSLSYRPGLPL--VLKGVSLNIKGGEKIGICGRTGAGK 1214

Query: 499  STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT-YG- 556
            STI S L R  + N G +LIDG D SK+    LR+ L ++ Q+PVL  G+IR N+  +G 
Sbjct: 1215 STIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGE 1274

Query: 557  -----------LSYTPSMDEIRAVAKK--------CFCHNFITKFPDGYDTVIGPRGALL 597
                        S T   +E+  V  +           H F        D  +   G   
Sbjct: 1275 REDEELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKF------HLDQEVEDDGTNF 1328

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            S G+RQ +A+ RAL+++ KILILDEATS++D E++  I   + +       TI+ IAHRL
Sbjct: 1329 SLGERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNRCTILCIAHRL 1386

Query: 658  STIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
             TI   + +VVL N G+V E      L+R +D+
Sbjct: 1387 KTILNYDRLVVLDN-GTVKEFDTPRSLFRIKDT 1418

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 78/269 (28%), Positives = 127/269 (47%), Gaps = 32/269 (11%)

Query: 433 FELTDYKKSVPSTVGQTFV--PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCI 490
           FE+ D K++     G+ F   P+   ++    +F+   + +   FK L   I  G  V I
Sbjct: 532 FEVEDAKETAKEK-GEAFEEKPKGANVD----AFASSEKASFSGFKNLNFQIQKGELVII 586

Query: 491 VGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIR 550
            G  G GKS++ + L  F     G I  +G         SL     ++   P + + T+R
Sbjct: 587 TGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL-----LLCGYPWIQNTTVR 632

Query: 551 DNITYGLSYTPSMDEIR--AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIA 608
           DNI +G S+    D++R   V + C     +   P G  T IG RG  LSGGQ+ RI +A
Sbjct: 633 DNILFGSSF----DDVRYKEVIRVCALQADLDILPAGDFTEIGERGITLSGGQKARINLA 688

Query: 609 RALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIV 667
           R++ K   I + D+  SA+D    +  ++  L  ++  K  T +   H+LS I R+  ++
Sbjct: 689 RSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGK--TRILATHQLSLIERASRVI 746

Query: 668 VLGNDGSVIEAGKFADLYRDEDSELFKLL 696
            LG  GS  + G   +L ++ +S   KL+
Sbjct: 747 FLGAGGS-FDIGTVEEL-KERNSGFVKLM 773

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 136/491 (27%), Positives = 222/491 (45%), Gaps = 43/491 (8%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +    T   I  
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQ----FFVNAVKVSFTIIVICFTTWQFIFI 1093

Query: 289  APPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRY 344
              PL +    Y +     SREL++    +   +    +E   GI TI+ +    ++  R+
Sbjct: 1094 IIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGY----QQQHRF 1149

Query: 345  NTAVRRLFNVAKREGITSATFFSGTNV-------LGDVSFLLVLAYGSHLVL---QGELS 394
                    N  + +   SA F+   N        L  +  L++L   +  V    QG L+
Sbjct: 1150 TH-----INQCRVDNNMSA-FYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLT 1203

Query: 395  LGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTV-----GQT 449
             G +   + Y      S+  +     E+     +  R+ E +D K   P+ +      +T
Sbjct: 1204 AGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAET 1263

Query: 450  FVPRDGRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRF 508
            + P +G I+F+  S  Y  RP    I K + + I P   V IVG +G GKS++   L R 
Sbjct: 1264 W-PDEGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRI 1320

Query: 509  YDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA 568
             +A+SG I+ID   I+++    LR  L ++ Q+  +  GT+R+NI     YT   ++I  
Sbjct: 1321 IEASSGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPTNEYTD--EQIWN 1378

Query: 569  VAKKCFCHNFITKFPD-GYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627
            V       + I    D G +  +   G  LS GQRQ + +ARAL+   KIL+LDEAT+A+
Sbjct: 1379 VLALSHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAV 1438

Query: 628  DVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687
            DVE++  I  T+    + +  TI++IAHR++TI  S+ I+VL N G++ E      L  +
Sbjct: 1439 DVETDKVIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLEN 1495

Query: 688  EDSELFKLLNE 698
              S  + L  E
Sbjct: 1496 PSSLFYSLCQE 1506

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 97/412 (23%), Positives = 185/412 (44%), Gaps = 42/412 (10%)

Query: 306 ISRELQQSTGNL----TRVSEEQFNGIKTIKSFVAE-----GKEMRRYNTAVRRLFNVAK 356
           + ++LQ+S        TRV  E  N IK++K +  E       E  R N  ++ L  +  
Sbjct: 465 VQKKLQKSQMTYKDERTRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGC 524

Query: 357 REGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLS 416
              + S  F     ++   +F     Y  +  L  +L   +LT F L        +  + 
Sbjct: 525 YMALMSFQFNVVPFLVSCCTFA-AFIYTENRPLTTDLVFPALTLFNL----LHFPLMVIP 579

Query: 417 NFYSELMKGAGAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTS 472
           N  + +++ + +  RLF  LT+ +    +      V   G +      D +F +  +P  
Sbjct: 580 NVLTMIIETSVSIGRLFSFLTNEELQKDAVQRLPKVTNIGDVAINVGDDATFLWQRKPEY 639

Query: 473 QI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KS 530
           ++  K +      G   CIVG  G GKS +   +L               D+ +V    +
Sbjct: 640 KVALKNINFQAKKGELTCIVGKVGSGKSAMIQSIL--------------GDLFRVKGFAT 685

Query: 531 LRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVI 590
           +  ++  V Q   +M+GT+++NI +G  Y    D  +   K C     +    DG  T++
Sbjct: 686 IHGNVAYVSQVAWIMNGTVKENILFGHKYDE--DFYQKTIKACALTIDLAVLMDGDQTLV 743

Query: 591 GPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKE 647
           G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   +   + + LG   L+ +K 
Sbjct: 744 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTK- 802

Query: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            T V   +++S +  ++++ +L N G +++ G + ++ +D+ S L KL+ E+
Sbjct: 803 -TKVLATNKVSVLSIADSVSLLEN-GEIVQQGTYDEIMKDDSSPLSKLITEY 852

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 135/520 (25%), Positives = 238/520 (45%), Gaps = 57/520 (10%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            R+  +++ K LH    F D   +G +++R   D   V + +T  +     A  C    + 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLE---AAFFCLVQCIS 1197

Query: 273  MMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGI 328
             +  I+  +T   +  A  + +   + G      SREL++    +   + +   E   G+
Sbjct: 1198 TIILIT-FITPQFLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGV 1256

Query: 329  KTIKSFVAEGKEMRRYNTAVRRL---------FNVAKREGITSATFFSGTNVLGDVSFLL 379
             TI++F   G E+R     + ++           VA R             + G   F+L
Sbjct: 1257 ATIRAF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGALIIFGSGVFIL 1313

Query: 380  VLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD-- 437
            +     + +  G   + SLT  + +TE        L  FYS +     +  RL E  D  
Sbjct: 1314 L---NLNRIDSGMAGI-SLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKEYMDVP 1365

Query: 438  ---YKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPS 494
               Y +   +T   T  P +G+IE KD+S  Y      ++ K++   I P + V IVG +
Sbjct: 1366 QEPYNEGTITT--STNWPTEGKIEVKDLSLRYAEN-LPRVIKEVSFDIEPHNMVGIVGRT 1422

Query: 495  GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
            G GKSTI + L RF +  +G+I IDG DI+ +  ++LR+ + ++ Q+P L +GTIR N+ 
Sbjct: 1423 GAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLD 1482

Query: 555  YGLSYTPSMDEIRAVAKKCFCHN----------------FITKFPDGYDTVIGPRGALLS 598
                Y P  +  R + +     +                 + KF +  +  I   G  LS
Sbjct: 1483 PFGKY-PDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-LENEITEGGNNLS 1540

Query: 599  GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLS 658
             GQ+Q + +ARAL++ PK+++LDEAT+++D  S+  I  T+  +      T+++IAHRL 
Sbjct: 1541 QGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLR 1598

Query: 659  TIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            ++   + I+V+ + G VIE  +   L  D++S  + +  +
Sbjct: 1599 SVIDYDKILVM-DAGEVIEYDQPYTLLLDKNSHFYSMCEQ 1637

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 109/438 (24%), Positives = 188/438 (42%), Gaps = 45/438 (10%)

Query: 263 AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSE 322
           AA+ G + V  M  ++  L S M  +      A  I  KRI+ ++  LQ           
Sbjct: 539 AAIVGILIVIGMIPVNFKLVSLMGKYQKK---ALGITDKRIQKLNEALQ----------- 584

Query: 323 EQFNGIKTIK------SFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
                I+ IK      +F +E  E+R     ++   N A     ++  +F    ++   S
Sbjct: 585 ----AIRIIKFFSWEDNFFSEIDEIRE--AEIQMYINKAYAWAFSAFIWFLTPTIVTGAS 638

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT 436
           F  V  Y    VL   ++  +L  F L  +        LSN  S +++   +  R+    
Sbjct: 639 FT-VYIYVQKQVLTAPVAFTALALFQLLKQPLDQ----LSNMLSYVIQSKVSLDRVQNFL 693

Query: 437 DYKKSVPSTVGQTFVPRDG-RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
           D + +      Q  V  DG ++ F++ + ++         K L +    G    ++GP+G
Sbjct: 694 DEEDT--QKYNQLKVAPDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTG 751

Query: 496 RGKSTIASLLLRFYDANSGTILI---DGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN 552
            GK+++   LL      SG I++   D +    + +  +   +    Q   L++ T+R+N
Sbjct: 752 SGKTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNN 811

Query: 553 ITYGLSYTP-SMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARAL 611
           I   L Y+P + D  + V   C        F  G  T IG +G  LSGGQ+QRI++ARAL
Sbjct: 812 I---LFYSPYNEDRYKEVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARAL 868

Query: 612 IKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVL 669
               + L+LD+  SA+D  +   I  N   G LM  +  T V ++H ++   ++  +VV+
Sbjct: 869 YSNCRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGR--TCVLVSHNIALTLKNAELVVM 926

Query: 670 GNDGSVIEAGKFADLYRD 687
             +G +   G    L +D
Sbjct: 927 LENGRITNRGDPISLLKD 944

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 223/493 (45%), Gaps = 47/493 (9%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +    T   I  
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQ----FFVNAVKVTFTITVICATTWQFIFI 1095

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL +    Y +     SREL++   ++TR       +E   G+ T++ +     + +R
Sbjct: 1096 IIPLSVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY----SQQKR 1150

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL-----------QGE 392
            ++       N  + +   SA F+   N    +++ L L  GS ++L           QG 
Sbjct: 1151 FSH-----INQCRIDNNMSA-FYPSINANRWLAYRLELI-GSIIILGAATLSVFRLKQGT 1203

Query: 393  LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452
            L+ G +   + Y      ++  +     E+     +  R+ E  D K   P  V     P
Sbjct: 1204 LTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPP 1263

Query: 453  RD----GRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
            ++    G I+F + S  Y  RP    + K + + I P   V IVG +G GKS++   L R
Sbjct: 1264 KEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFR 1321

Query: 508  FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-- 565
              +A+ G I+ID   I+++    LR  L ++ Q+  +  GT+R+NI     YT   DE  
Sbjct: 1322 MIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYT---DEAI 1378

Query: 566  IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATS 625
             RA+       + ++   DG D  +   G  LS GQRQ + +ARA++   KIL+LDEAT+
Sbjct: 1379 WRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATA 1438

Query: 626  ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
            A+DVE++  +  T+    + +  TI++IAHRL+TI  S+ I+VL N G V E      L 
Sbjct: 1439 AVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAEFDSPGQLL 1495

Query: 686  RDEDSELFKLLNE 698
             D  S  + L  E
Sbjct: 1496 SDNKSLFYSLCME 1508

 Score =  103 bits (257), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 107/414 (25%), Positives = 190/414 (45%), Gaps = 46/414 (11%)

Query: 306 ISRELQQSTGNL----TRVSEEQFNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAK 356
           I ++LQ+S        TRV  E  N IK++K +  E       E  R N  ++ L  +  
Sbjct: 468 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC 527

Query: 357 REGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLS 416
              +TS  F     ++   +F  V  Y     L  +L   +LT F L +         L+
Sbjct: 528 YMAVTSFQFNIVPFLVSCCTFA-VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 586

Query: 417 NFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPR-----DGRIEF-KDVSFSYPTRP 470
           +F    ++ + +  RLF     ++  P +V +  +P+     D  I    D +F +  +P
Sbjct: 587 SF----IEASVSIGRLFTFFTNEELQPDSVQR--LPKVKNIGDVAINIGDDATFLWQRKP 640

Query: 471 TSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA- 528
             ++  K +      G+  CIVG  G GK+ + S +L               D+ +V   
Sbjct: 641 EYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCML--------------GDLFRVKGF 686

Query: 529 KSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDT 588
            ++   +  V Q P +M+GT+++NI +G  Y     E     K C     +    DG  T
Sbjct: 687 ATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYE--KTIKACALTIDLAILMDGDKT 744

Query: 589 VIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRS 645
           ++G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   +   I + LG   L+ +
Sbjct: 745 LVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHT 804

Query: 646 KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
           K  T V   +++S +  +++I +L N G + + G + ++ +D DS L+KLLN +
Sbjct: 805 K--TKVLATNKVSALSIADSIALLDN-GEITQQGTYDEITKDADSPLWKLLNNY 855

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 129/509 (25%), Positives = 237/509 (46%), Gaps = 61/509 (11%)

Query: 199  RMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNIS 258
            + F+  + G R    +   ++ + LH    FFD   +G +++R   D      S+   I 
Sbjct: 1110 KTFVNSLFGIRASKLIFDSLLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIP 1165

Query: 259  DGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----ST 314
              +++     + V     + S +T A    A  +++  +I G      SREL++    S 
Sbjct: 1166 PNIQSVFYSAIEVFATLLLISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISK 1225

Query: 315  GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
              + +   E   G+ TI++F  E + ++   + + +           S  FF    V   
Sbjct: 1226 SPIFQHFSETLVGVTTIRAFGDEQRFIKENLSMIDQ----------NSMPFFYLWVVNRW 1275

Query: 375  VSF-------LLVLAYGSHLVLQ-GELSLG----SLTAFMLYTEYTGSSVFGLSNFYSEL 422
            +SF       L++ + G  ++L    +  G    SLT  + +TE    +   L   YSEL
Sbjct: 1276 LSFRIDLIGALVIFSSGVFILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSEL 1331

Query: 423  MKGAGAASRLFELTDYKKS------VPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIF 475
                 +  R+ E  + ++         +       P  G++E  ++S  Y P  P   + 
Sbjct: 1332 EMNMNSVERVLEYMNIEQEPLIADPANAVTPPPQWPDSGKVEVNNLSLKYAPHLP--YVI 1389

Query: 476  KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535
            K +  TI P   V IVG +G GKSTI + L RF +A++G+I +DG +I+ +  K LR+ +
Sbjct: 1390 KDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSI 1449

Query: 536  GVVQQEPVLMSGTIRDNITYGLSYTP-------------SMDEIRAVAKKCFCHNF--IT 580
             ++ Q+P L +G+IR N+     Y+              S +E+ A   +   ++   + 
Sbjct: 1450 TIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVN 1509

Query: 581  KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 640
            KF +  ++ I   G+  S GQRQ + +AR+L++ PK+++LDEAT+++D  S+  I  T+ 
Sbjct: 1510 KFLN-LESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIR 1568

Query: 641  RLMRSKEITIVSIAHRLSTIRRSENIVVL 669
            +   +   T+++IAHRL +I   + I+V+
Sbjct: 1569 QEFNNS--TVLTIAHRLRSIVDYDKILVM 1595

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 114/240 (47%), Gaps = 14/240 (5%)

Query: 448 QTFVPRDG-RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL 506
           Q  V ++G R+ F++V+  + +   S + + L +    G    IVG +G GK++I   LL
Sbjct: 696 QLTVDKNGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLL 755

Query: 507 RFYDANSGTILIDG---QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSM 563
                + G I++     +   +  A  +   +    Q   L++ T+R+NI +   +    
Sbjct: 756 GEMQLSEGKIIVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFNAPF---- 811

Query: 564 DEIR--AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILD 621
           D+ R  AV + C           G  T IG +G  LSGGQ+QR+++ARAL      L+LD
Sbjct: 812 DQARYDAVVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLD 871

Query: 622 EATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
           +  SA+D  +   I      G LM  +  T + + H ++   ++ + VV+  DG V E G
Sbjct: 872 DCLSAVDSHTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADFVVMIEDGKVKEKG 929

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 122/492 (24%), Positives = 219/492 (44%), Gaps = 44/492 (8%)

Query: 205  MLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA 264
             LG +   ++   ++KK +H    FFD   +G +++R   D   + + +   +     + 
Sbjct: 1132 FLGVKASRKIFIDLLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSL 1191

Query: 265  LCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQ 324
            +     + ++  I+    S  I+      +    Y    R   R    +   + +   E 
Sbjct: 1192 VSCVTTILLITFITPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSET 1251

Query: 325  FNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV------LGDVSFL 378
              G+ TI++F  EG+ M+          N++K +      F+           +  V  L
Sbjct: 1252 LVGVTTIRAFGDEGRFMQE---------NLSKIDENNRPFFYLWVANRWLSFRIDMVGAL 1302

Query: 379  LVLAYGSHLV-----LQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF 433
            +V   GS ++     +   ++  SLT  + +TE        L   YS +     +  RL 
Sbjct: 1303 VVFGSGSFIIWNIKNIDAGMAGISLTYAISFTE----GALWLVRLYSNVEMNMNSVERLK 1358

Query: 434  ELTDYKKSVPSTVGQT---FVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCI 490
            E    ++        T     P++G+IE  D+S  Y      ++ K +  T+ P + + I
Sbjct: 1359 EYMKIEQEPYEDATCTPPPEWPQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAKIGI 1417

Query: 491  VGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIR 550
            VG +G GKSTI + L RF D  +G I ID  DI+ ++   LR+ + ++ Q+P L +GTI+
Sbjct: 1418 VGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIK 1477

Query: 551  DNIT-YGLSYTPSM------------DEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALL 597
             N+  YG      M            D    +  +      + KF +  +  I   G+ L
Sbjct: 1478 SNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLN-LNNEISEGGSNL 1536

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            S GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +   S   TI++IAHRL
Sbjct: 1537 SQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEFNSS--TILTIAHRL 1594

Query: 658  STIRRSENIVVL 669
             ++   + I+V+
Sbjct: 1595 RSVIDYDKILVM 1606

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 104/462 (22%), Positives = 203/462 (43%), Gaps = 34/462 (7%)

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI--SSTLTSAMIMF--A 289
            +G +I+ +  DA+ VS    +  +  V+A +   + + +++ +  SS +   +++   A
Sbjct: 489 NLGGIINLMAVDAFKVSEVCAYLFA-FVEATVMAIISLTLLYRLIGSSAIIGTIVILIAA 547

Query: 290 PPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVR 349
           P     AT+ GK    I +     T    +   E    I+ IK F  E    +  N    
Sbjct: 548 PANYYFATLLGK----IQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDNFEKSINDVRE 603

Query: 350 RLFNVAKREGI----TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYT 405
           +   +  +  +    +S  +F   +++   +F   + Y    VL   ++  +L+ F L  
Sbjct: 604 QELQLLLKRSMAWVCSSFVWFVTPSLVTAAAFAFYI-YVQKEVLTTPIAFTALSLFTLLR 662

Query: 406 EYTGSSVFGLSNFYSELMKGAGAASRLFEL---TDYKKSVPSTVGQTFVPRDGRIEFKDV 462
               + +  LS+  S +++   +  R+ +    TD  K    TV     P+  ++EFK+ 
Sbjct: 663 ----NPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKYDQLTVA----PQGDQLEFKNT 714

Query: 463 SFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILI---D 519
           + S+ +       K L +    G    ++GP+G GK+++   LL       G I++   D
Sbjct: 715 TVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEGEIIVPSLD 774

Query: 520 GQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFI 579
            ++   V        +    Q   L++ T+R+NI +   Y  +     +V + C      
Sbjct: 775 PREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNEA--RYTSVIEACGLKRDF 832

Query: 580 TKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NY 637
                G  T IG +G  LSGGQ+QR+++ARA+    + ++LD+  SA+D  +   I  N 
Sbjct: 833 EILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDSHTALWIYDNC 892

Query: 638 TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
             G LM  +  T + ++H ++   ++ ++VV+  DG V + G
Sbjct: 893 ITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQG 932

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 139/496 (28%), Positives = 233/496 (46%), Gaps = 53/496 (10%)

Query: 229  FFDRNKVGDLISRLGSDAY----IVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSA 284
            FF+   +G +++R  +D Y    I+ R+ +    + VK      V       I +T T  
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAV-------ICAT-TWQ 1090

Query: 285  MIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGK 339
             I    PL +    Y +     SREL++   ++TR       +E   GI TI+ +  E  
Sbjct: 1091 FIFVIIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPVYSHFQETLGGITTIRGYNQE-- 1147

Query: 340  EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL---------- 389
              +R+        N  + +   SA F+   N    ++F L L  GS ++L          
Sbjct: 1148 --KRFGH-----INQCRVDNNMSA-FYPSINANRWLAFRLELI-GSIIILGAATLSIFRL 1198

Query: 390  -QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQ 448
             +G L+ G +   + Y      ++  +     E+     +  R+ E    +   P  V +
Sbjct: 1199 KEGTLTPGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEE 1258

Query: 449  T----FVPRDGRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIAS 503
                   P +G I+F++ S  Y  RP    + K + + I P   V IVG +G GKS++  
Sbjct: 1259 KRPDEMWPTEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTL 1316

Query: 504  LLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSM 563
             L R  +A +G I+IDG  I+++    LR  L ++ Q+  +  GT+R+NI     +T   
Sbjct: 1317 ALFRIIEATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENIDPTNLFTD-- 1374

Query: 564  DEI-RAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDE 622
            +EI R +       + ++   DG D  +   G+ LS GQRQ + +ARAL+   KIL+LDE
Sbjct: 1375 EEIWRVLELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDE 1434

Query: 623  ATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFA 682
            AT+A+DVE++  +  T+    + +  TI++IAHRL+TI  S+ I+VL + G ++E     
Sbjct: 1435 ATAAVDVETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVL-DKGEIVEFDTPD 1491

Query: 683  DLYRDEDSELFKLLNE 698
            +L    +S  + L NE
Sbjct: 1492 ELLAKPESLFYSLCNE 1507

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 108/422 (25%), Positives = 190/422 (45%), Gaps = 37/422 (8%)

Query: 292 LLIAATIYGKRI-RAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA--V 348
            +I    Y  RI R + ++  Q     T V  E  N IK++K +  E     + N     
Sbjct: 454 FMIFLNSYLVRIQRKLQKQQMQFKDERTGVISEILNNIKSLKLYAWEVPYQTKLNHVRND 513

Query: 349 RRLFNVAKREGITSATFFSGTNV--LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTE 406
           + L N+ K     + T F    V  L   +   V  Y  +  L  +L   +LT F L + 
Sbjct: 514 KELHNLTKLGCYMAVTSFQFNIVPFLVSCATFAVFVYTENKPLTTDLVFPALTLFNLLS- 572

Query: 407 YTGSSVFGLSNFYSELMKGAGAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DV 462
                +  + N  +  ++ + + +RLF  LT+ +    S      V   G +      + 
Sbjct: 573 ---FPLMVVPNVITSFVEASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGDNA 629

Query: 463 SFSYPTRPTSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQ 521
           +F +  +P  ++  K +      G   CIVG  G GKS +   +L               
Sbjct: 630 TFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSIL--------------G 675

Query: 522 DISKVSA-KSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT 580
           D+ +V    ++  ++  V Q P +M+GT+++NI +G  Y     E     K C     + 
Sbjct: 676 DLFRVKGFATVHGNVAYVSQVPWIMNGTVKENILFGHKYDQEFYE--KTIKACALTIDLG 733

Query: 581 KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL 639
              DG  T++G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   S+  + + L
Sbjct: 734 ILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVL 793

Query: 640 GR--LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           G   L+ SK  T V   +++S +  +++I +L N G +++ G + ++  DEDS LFKL+ 
Sbjct: 794 GPTGLLHSK--TKVLCTNKISVLSIADSITLLEN-GEIVQQGSYEEVNSDEDSPLFKLIK 850

Query: 698 EH 699
           E+
Sbjct: 851 EY 852

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 146/515 (28%), Positives = 226/515 (43%), Gaps = 62/515 (12%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCG-----G 268
            L    + + LH    + D   +G +++R   D    + S+ + +++ V+  L        
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLMLFQVGNIVA 1002

Query: 269  VGVGMMFHISSTLTSAMIMFAPPLLIAATIYG-----KRIRAISRELQQSTGNLTRVSEE 323
            V V  + ++     +   +F   +LIA          KR+ AI R    +  N      E
Sbjct: 1003 VIVMCIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLN------E 1056

Query: 324  QFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAY 383
               G+ TIKS+    K  +R+      L N     G    +     ++  D+  ++    
Sbjct: 1057 VLGGMDTIKSY----KGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAIIFALI 1112

Query: 384  GSHLVLQGELSL-----GSLTAFMLYTEYTGSSVFGLSNFYSELMKGA----GAASRLFE 434
             + L + G  SL     G L  ++L      +SV          M  A      A++L  
Sbjct: 1113 IALLSVTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALTQTENDMNSAERLVNYATKLPL 1172

Query: 435  LTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPT-RPTSQIFKKLRLTITPGSNVCIVGP 493
               YKK  P        P  G I F DV F+Y +  P   + K L L I  G  + I G 
Sbjct: 1173 EAAYKK--PELSPPESWPSKGEIRFLDVDFAYRSGLPV--VLKGLNLDIKSGEKIGICGR 1228

Query: 494  SGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNI 553
            +G GKSTI S L R  +  SG ILID  DIS +    LR+ L ++ Q+PVL  GTIR N+
Sbjct: 1229 TGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNL 1288

Query: 554  TYGLSYTPSM-------------DEIRAVAKKCF----CHNFITKFPDGYDTVIGPRGAL 596
                +Y  S+             + +  V  +       H  + KF    D ++   G+ 
Sbjct: 1289 DPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSN 1346

Query: 597  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS-KEITIVSIAH 655
             S G+RQ +A+ RAL+++ KILILDEATS++D E++G I     R++      TI+ IAH
Sbjct: 1347 FSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQ---KRIVEEFDNCTILCIAH 1403

Query: 656  RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
            RL TI + + I+VL   G + E  +   L+ D+DS
Sbjct: 1404 RLKTILQYDRILVL-EKGVIAEFDQPFKLFSDKDS 1437

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (48%), Gaps = 21/202 (10%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L   I  G  + I GP G GKS++ +    F +   G I ++G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-IRAVAKKCFCHNFITKFPDGYDTVIGPR 593
             +    P + + T++DNI +G   +P + E    V + C     +   P G  T IG R
Sbjct: 636 --LFCGYPWIQNATVKDNILFG---SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGER 690

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVS 652
           G  LSGGQ+ RI +ARA+ K   I + D+  SA+D    +  ++  L  L+  K  T + 
Sbjct: 691 GINLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRIL 748

Query: 653 IAHRLSTIRRSENIVVLGNDGS 674
             H+LS I +++ ++VLG DGS
Sbjct: 749 ATHQLSLIEKADRVIVLGTDGS 770

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 139/528 (26%), Positives = 232/528 (43%), Gaps = 75/528 (14%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            +L  ++ K  +     FF+    G +I+R  SD             D V   L     + 
Sbjct: 1027 KLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDM------------DSVDTTLQNVFSLF 1074

Query: 273  MMFHISSTLTSAMIMFAPPL--------LIAATIYGKRIRAISRELQQ----STGNLTRV 320
                +   +T  ++ F  PL        L+    Y      +SREL++    S   +  +
Sbjct: 1075 FRSILDYIITVILVTFNMPLFFLLNAGLLVIYLYYQSFYIVLSRELKRLTSISYSPIMSL 1134

Query: 321  SEEQFNGIKTIKSFVAEGKEMRRYNT--------AVRRLFNVAKREGITSATFFSGTNVL 372
              E  +G  TI ++    +++RR++         ++   FN        S         L
Sbjct: 1135 MGESLSGHFTISAY----EQIRRFSHLNYERIQFSINCFFNYRSSNRWLSVR-------L 1183

Query: 373  GDVSFLLVLAYG----SHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGA 428
              +  L+VL+ G    S L    +LS G +   M Y     SS+  +      +     +
Sbjct: 1184 QSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIETNIVS 1243

Query: 429  ASRLFELTDYKKSVPSTVGQTFV----PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITP 484
              R+ E  D     P    +  +    P  G+IEFK+ S SY       + K + L I+P
Sbjct: 1244 VERIVEYCDISPEAPEVKEEHRLDDNWPNQGQIEFKNYSTSY-RENLDPVLKHINLVISP 1302

Query: 485  GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
            G  + +VG +G GKST++  L R  +  +GTI ID  DI+ +  + LR H+ ++ Q+   
Sbjct: 1303 GEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQA 1362

Query: 545  MSGTIR-----------DNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPD------GYD 587
              GTIR           D++ + +  +     +  +AK+    N  +++ D        D
Sbjct: 1363 FEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEI---NDDSEYSDRSRLESPLD 1419

Query: 588  TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647
              +   G+ LS GQ+Q + +ARAL+ K KIL+LDEAT+++DVE++  I  T+ +    + 
Sbjct: 1420 IPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR- 1478

Query: 648  ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
             TI++IAHRL T+  S+ I+VL + G V E  K   L   +DS  +KL
Sbjct: 1479 -TILTIAHRLDTVFDSDRIIVL-DGGEVKEFDKPETLLEQKDSIFYKL 1524

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 118/222 (53%), Gaps = 21/222 (9%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDIS---KVSAKSLRKHLGVVQQE 541
            S +C+VG  G GKSTI   +L      SG    +   +S   +++A ++        QE
Sbjct: 645 SSLICVVGRVGAGKSTILKCILGQLPCISG----NNDHLSPQFQINATTV----AYCPQE 696

Query: 542 PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
             +M+ +++DNI +G  Y  +    +A  K C     I   PDG +T++G +G +LSGGQ
Sbjct: 697 AWIMNASVKDNILFGHKYDEAF--YKATIKACQLLPDIKVLPDGDETMVGEKGIVLSGGQ 754

Query: 602 RQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSKEITIVSIAHRL 657
           + R+++ARA+  +  + +LD+  SA+D E  +  I   L     L++ K I + +  + +
Sbjct: 755 KTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKSIVLAT--NTI 812

Query: 658 STIRRSENIVVLGNDGSVIEAGKFADLYRD-EDSELFKLLNE 698
           S ++ S  I +L N  S+ + G + D+  + +DS+L  +L+E
Sbjct: 813 SVLKHSTKIYLLEN-KSIAQEGNYDDIMNNQQDSKLKNILHE 853

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  142 bits (358), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 141/516 (27%), Positives = 231/516 (44%), Gaps = 53/516 (10%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            ++ K LH    FFD    G +++R   D   + + +T  I     + +     V ++  I
Sbjct: 1141 ILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 278  SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
            +    S  I+ +         Y    R + R    S   + +   E   G+ TI++F  E
Sbjct: 1201 TPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 338  GKEMRRY------NTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQG 391
            G+ M+        N        VA R             + G  + L +L+   HL    
Sbjct: 1261 GRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFG--AGLFILSNIDHL--DS 1316

Query: 392  ELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYK-------KSVPS 444
             ++  SLT  + +TE        L   YSE+     +  R+ E  + +       K VP 
Sbjct: 1317 GMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNQHKEVPP 1372

Query: 445  TVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIAS 503
                   P+DG+IE  D+S  Y P  P  ++ K +  ++   S V IVG +G GKSTI +
Sbjct: 1373 PQW----PQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKVGIVGRTGAGKSTIIT 1426

Query: 504  LLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN----------- 552
             L RF + ++G I ID  DIS V  + LR+ + ++ Q+P L SGTI+ N           
Sbjct: 1427 ALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYNEFSNQK 1486

Query: 553  ITYGLSYTPSMDE-------IRAVAKKCFCHNF--ITKFPDGYDTVIGPRGALLSGGQRQ 603
            I   L     + E       +R VA      +   + KF D  ++ +   G+ LS GQRQ
Sbjct: 1487 IFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFLD-LESEVSEGGSNLSQGQRQ 1545

Query: 604  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRS 663
             + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  +    TI++IAHRL ++   
Sbjct: 1546 LMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDY 1603

Query: 664  ENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            + I+V+ + G V E      L  ++ S +F  + EH
Sbjct: 1604 DKILVM-DAGEVKEYDHPYSLLLNKQS-IFYSMCEH 1637

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 114/480 (23%), Positives = 210/480 (43%), Gaps = 32/480 (6%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSR--SMTHNISDGVKAALCGGVGVGMMFHI 277
           +K+++ D E      +G +I+ +  DA+ VS      H+  +     +   V +  +  +
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALVLLYRLLGL 519

Query: 278 SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAE 337
           ++ L   +I+   PL        K I  + ++    T N  +   E F  I+ IK F  E
Sbjct: 520 AAILGVLIIVAMLPLNYKL---AKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWE 576

Query: 338 G------KEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQG 391
                  K +R    A+  + ++     I+S  +F    ++   SF    AY  ++ +QG
Sbjct: 577 ENFENDIKAIRESELALLLMRSII--WSISSFVWFVTPTIVTAASF----AY--YIYVQG 628

Query: 392 EL--SLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQT 449
           E+  +  + TA  L+T      +  LS+  S +++   +  R+ +  + +K        T
Sbjct: 629 EVLTTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLN-EKDTEKYDQLT 686

Query: 450 FVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK-STIASLLLRF 508
             P   R  F++ + S+         K L +    G    ++GP+G GK S + +LL   
Sbjct: 687 IDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEM 746

Query: 509 YDANSGTIL--IDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEI 566
           Y  N   ++  +D +    V A      +    Q   L++ T+++NI +   +  +    
Sbjct: 747 YLLNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNET--RY 804

Query: 567 RAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSA 626
           +AV + C           G  T IG +G  LSGGQ+QR+++ARAL    + ++LD+  SA
Sbjct: 805 KAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 627 LDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
           +D  +   I  N   G LM  +  T + ++H ++   R+  +VVL  DG V + G   D+
Sbjct: 865 VDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  142 bits (357), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 149/513 (29%), Positives = 224/513 (43%), Gaps = 62/513 (12%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGM 273
            L  Q +K+ +H    F D   +G +++R   D   +   +  N+   V +     VGV +
Sbjct: 968  LNIQALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTV-SQFANIVGVCV 1026

Query: 274  M-------FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFN 326
            M       F I+      + +F      +A    KR+ AI R    +  N      E   
Sbjct: 1027 MCIVYLPWFAIAVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFN------EILG 1080

Query: 327  GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD---VSFLLVLAY 383
            G+ TIK + +E     RY      L +     G  +        +L D   V+F L++  
Sbjct: 1081 GMDTIKFYKSE----ERYIAKSDYLIDKMNEAGYLTVCVQRWVAILVDMIAVAFALIITL 1136

Query: 384  GSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL-TD----- 437
               +  Q  +S  S+   + Y          L    S++     +  RL    TD     
Sbjct: 1137 LC-VTRQFHISASSVGVLLTYVLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPLEA 1195

Query: 438  -YKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
             Y K  P T      P +G I+F++V F+Y P  P   + K + L I     + I G +G
Sbjct: 1196 QYHK--PETAPPESWPEEGTIKFENVDFAYRPGLPI--VLKNINLQINGTEKIGICGRTG 1251

Query: 496  RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
             GKSTI + L R  +  SG+ILID  DI+K+    LRK L ++ Q+PVL  G IR N+  
Sbjct: 1252 AGKSTIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLD- 1310

Query: 556  GLSYTPSMDE------IR--AVAKKCFCH---NFITKFPDG---------YDTVIGPRGA 595
               +    DE      +R  A+A +         IT+  DG          D V+   GA
Sbjct: 1311 --PFHERTDEELWDVLVRGGAIAPEDLAETKAQHITE--DGTSADLHKFHLDKVVEEDGA 1366

Query: 596  LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
              S G+RQ +A+ RAL++  KILILDEATS++D E++  I   +         TI+ IAH
Sbjct: 1367 NFSLGERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAH 1424

Query: 656  RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
            RL TI   + I+VL + G V E     +L++DE
Sbjct: 1425 RLKTILNYDRILVLEH-GEVAEFDTPMNLFKDE 1456

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 115/226 (50%), Gaps = 22/226 (9%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L   I  G  V I GP G GK+++ +    F +  SGTI I+G              
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQINGD------------- 658

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
             ++   P + + T+RDNI +G  Y    D+ + V + C   + +   P G  T IG RG
Sbjct: 659 -LLMGGYPWIQNATVRDNIIFGSPYEE--DKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVSI 653
             LSGGQ+ RI +AR + K+  I +LD+  SA+D    +  ++  L +L+ +K  T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNK--TRLLA 773

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            H+LS I ++  I+VLGNDGSV E G     Y  E ++  K+L E+
Sbjct: 774 THQLSLIDKASRIIVLGNDGSV-EIGDVQ--YMKETNKTLKVLLEN 816

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  142 bits (357), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 133/487 (27%), Positives = 222/487 (45%), Gaps = 57/487 (11%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMM--- 274
            ++ K +H    FFD   +G +++R   D     + +T  I +G   +L   V   ++   
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFI-EGAFYSLVQCVSTVVLITF 1186

Query: 275  ----FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKT 330
                F   + L + +  F     +  +   KR+ +ISR        + +   E   G+ T
Sbjct: 1187 ITPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR------SPIYQHFSETLVGVTT 1240

Query: 331  IKSFVAEGKEMR----RYNTAVRRLFN--VAKREGITSATFFSGTNVLGDVSFLLVLAYG 384
            I++F  E + MR    + +   R  F   VA R             + G   F+L+    
Sbjct: 1241 IRAFGDESRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMIGALVIFGAGIFVLL---N 1297

Query: 385  SHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD-----YK 439
               +  G+  + SLT  + +TE        L   YS +     +  RL E  D     Y 
Sbjct: 1298 IDHIDSGKAGI-SLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYD 1352

Query: 440  KSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
            +S+ +   +   P+ GRIE  D+S  Y P  P  ++ K +  T+ P S V IVG +G GK
Sbjct: 1353 QSILTPPVEW--PQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGK 1408

Query: 499  STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558
            STI + L RF D  +G I ID  DI+ +  + LR+ + ++ Q+P L +GTI+ N+     
Sbjct: 1409 STIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYDE 1468

Query: 559  YT-----PSMDEIRAVAKKCF-----------CHNFITKFPDGYDTVIGPRGALLSGGQR 602
            YT      ++  +  V ++                 I KF D   + I   G  +S GQR
Sbjct: 1469 YTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLD-LSSEISEGGGNISQGQR 1527

Query: 603  QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
            Q + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +       TI++IAHRL ++  
Sbjct: 1528 QLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVID 1585

Query: 663  SENIVVL 669
             + I+V+
Sbjct: 1586 YDKILVM 1592

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 115/481 (23%), Positives = 215/481 (44%), Gaps = 42/481 (8%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSR--SMTHNISDGVKAALCGGVGVGMMFHI 277
           ++ ++ D E      +G +I+ +  DA+ VS   +  H   + V  AL   V +  +   
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVVMALVAFVLLYHLLGF 521

Query: 278 SSTLTSAMIMFAPPL-LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVA 336
           ++ + +A+I+   PL    AT  G     + +E    T    +   E F  I+ IK F  
Sbjct: 522 AAIVGAALIVAMMPLNFKLATWLGH----LQKETLSVTDKRIQKLNEAFQAIRIIKFFSW 577

Query: 337 EGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLV--LAYGSHLVLQGELS 394
           E      +   +R +     +  +  +  ++G++ +  ++  +V   A+  ++ +QGE+ 
Sbjct: 578 ENN----FEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTSCAFWFYIYIQGEV- 632

Query: 395 LGSLTAFMLYTEYTGSSVFGL--------SNFYSELMKGAGAASRLFELTDYKKSVPSTV 446
           L +  AF      T  S+F L        S+  S +++   +  R+ E  + K +     
Sbjct: 633 LTTPIAF------TALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEKDT--EKY 684

Query: 447 GQTFVPRDGR-IEFKDVSFSYPT-RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASL 504
            Q    +D + I F++ + ++   RP  ++ K L +    G    I+GP+G GK+++   
Sbjct: 685 NQLSTAKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMA 743

Query: 505 LLRFYDANSGTILIDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTP 561
           LL      SG I++   D  +   + A  +   +    Q   L++ T+++NI +   Y  
Sbjct: 744 LLGEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFNSPYNE 803

Query: 562 SMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILD 621
              E  AV + C      +    G  T IG RG  LSGGQ+QRI++AR+L    + ++LD
Sbjct: 804 GRYE--AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLD 861

Query: 622 EATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
           +  SA+D  +   I  N   G LM  +  T + ++H  +   R+  +VV   +G V   G
Sbjct: 862 DCLSAVDSHTASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAELVVTMENGQVKNQG 919

Query: 680 K 680
           +
Sbjct: 920 E 920

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 137/491 (27%), Positives = 227/491 (46%), Gaps = 43/491 (8%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +  T T   I+ 
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQ----FFVNVVKVTFTIVVICTSTWQFILV 1080

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL +    Y +     SREL++   ++TR       +E   G+ TI+ +   G++ R 
Sbjct: 1081 VLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGVSTIRGY---GQQKRF 1136

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLL-----VLAYGSHLVLQGELSLGSL 398
             +    R+ N         + F+   N    ++F L     ++  G+  +    L  G+L
Sbjct: 1137 AHINQARIDN-------NMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTL 1189

Query: 399  TAFML-----YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPR 453
            TA M+     Y      S+  +     E+     +  R+ E  + K   P+ +  +  P+
Sbjct: 1190 TAGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPK 1249

Query: 454  ----DGRIEFKDVSFSYPTRPTSQ-IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRF 508
                 G I F+  S  Y  RP  Q I + + L I     V IVG +G GKS++   L R 
Sbjct: 1250 GWPSQGDIRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRI 1307

Query: 509  YDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEI-R 567
             +A  G I IDG     +    LR  L ++ Q+  + +GT+R+N+     +T   +EI  
Sbjct: 1308 IEAAEGHIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENVDPTEEFTD--EEIWH 1365

Query: 568  AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627
            A+       + ++   DG  T++   G+ LS GQRQ + +ARAL+   KIL+LDEAT+A+
Sbjct: 1366 ALELSHLKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAV 1425

Query: 628  DVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRD 687
            DVE++  I  T+    +++  TI++IAHR++TI  S+ I+VL N+G V E     +L + 
Sbjct: 1426 DVETDRVIQETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQR 1482

Query: 688  EDSELFKLLNE 698
             DS  + L  E
Sbjct: 1483 PDSLFYSLCKE 1493

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 108/403 (26%), Positives = 190/403 (47%), Gaps = 51/403 (12%)

Query: 318 TRVSEEQFNGIKTIKSFVAE--GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
           TRV  E  N IK++K +  E   K+   Y    + L N+ K  G T A      N+   V
Sbjct: 475 TRVISEILNNIKSLKLYAWEVPYKKKLDYVRNEKELKNLTKM-GCTLALASFQFNI---V 530

Query: 376 SFLLVLAYGSHLV-------LQGELSLGSLTAFMLYTEYTGSSVFGLS---NFYSELMKG 425
            FL+  +  +  V       L  +L   +LT F L +       F L+   N  +  ++ 
Sbjct: 531 PFLVSCSTFAVFVMTQKGRALTTDLVFPALTLFNLLS-------FPLAVVPNAITSFIEA 583

Query: 426 AGAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRL 480
           + + +RL   LT+ +    S   +  V   G I  K   D +F +  +P  ++  K +  
Sbjct: 584 SVSVNRLHSFLTNEELQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINF 643

Query: 481 TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQ 539
               G   CIVG  G GKS +   +L               D+ +V    ++   +  V 
Sbjct: 644 QAKKGELTCIVGRVGSGKSALIQSIL--------------GDLFRVKGFATIHGSVAYVS 689

Query: 540 QEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSG 599
           Q P +M+GT+++NI +G  Y PS  E     K C  +  ++  P G  T++G +G  LSG
Sbjct: 690 QIPWIMNGTVKENILFGHKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSG 747

Query: 600 GQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHR 656
           GQ+ R+++ARA+  +    +LD+  +A+D   ++  ++  LG   L+ SK  T V   ++
Sbjct: 748 GQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSK--TKVLATNK 805

Query: 657 LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
           ++ +  +++I +L N G +++ G + ++ RD+ S L KL++E+
Sbjct: 806 ITVLSIADSIALLEN-GEIVQQGSYDEVVRDDGSALSKLIHEY 847

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 139/518 (26%), Positives = 234/518 (45%), Gaps = 75/518 (14%)

Query: 223  LHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLT 282
            LH    FFD   +G +++R   D   V + +T  +        C      ++F I+  +T
Sbjct: 1089 LHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLE---VTMFCLIQCTSIIFLIT-IIT 1144

Query: 283  SAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEG 338
               ++ A  + I     G      SREL++    +   + +   E   G+ TI++F   G
Sbjct: 1145 PHFLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFSETLVGVCTIRAF---G 1201

Query: 339  KEMRRYNTAVRRLFNVAKREGITSATFFSGTNV------LGDVSFLLVLAYGSHLVLQ-G 391
             E R        L N+ K +    A F+    V      +  +   +VLA GS +++  G
Sbjct: 1202 DEKRFI------LENLDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLASGSFILINIG 1255

Query: 392  ELSLG----SLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT--------DYK 439
             +  G    SLT  +L+T+        L   YS       +  RL E +        DY 
Sbjct: 1256 NIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSSIEQENYFDYN 1311

Query: 440  KSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKS 499
            K     + Q+  P  G+IE  ++S  Y +     + K +  TI P S V IVG +G GKS
Sbjct: 1312 KDHIQELQQSSWPEHGQIEVDNLSLRYASN-LPPVIKNVSFTIEPQSKVGIVGRTGAGKS 1370

Query: 500  TIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNI------ 553
            TI + L R  +  +G I IDG DIS++   +LR+ + ++ Q+P+L +GTI+ N+      
Sbjct: 1371 TIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILFTGTIKSNVDPCDEY 1430

Query: 554  ----------------TYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALL 597
                            T  +    +M +    A+  F  N  T+  +G        G  +
Sbjct: 1431 DNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFV-NLQTEITEG--------GQNI 1481

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            S G+RQ + IAR+L+++PKI++LDEATS++D ES+  I   +         TI++IAHRL
Sbjct: 1482 SQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS--TILTIAHRL 1539

Query: 658  STIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
             ++   + ++V+ + G + E     +L ++E S  + +
Sbjct: 1540 RSVIDYDRVLVM-DAGEIKEYDHPYNLLKNEQSIFYSM 1576

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 135/515 (26%), Positives = 233/515 (45%), Gaps = 52/515 (10%)

Query: 205 MLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA 264
           ++GE     LR ++     ++D        +G +I+ +  D++ VS   T+     V+A 
Sbjct: 417 LIGEIYSKGLRRKLFTPPKNNDDSSSVSANLGTIINLISIDSFKVSEISTY-FYMTVQAI 475

Query: 265 LCGGVGVGMMFH---ISSTLTSAMIMFAPPL-LIAATIYGKRIRAISRELQQSTGNLTRV 320
           +   + VG++F    IS+    ++I+   PL    A + GK  ++    LQ +   + ++
Sbjct: 476 IMVLIVVGLLFKFLGISALAGISIILMMFPLNFRLAELLGKFQKS---ALQCTDKRIAKL 532

Query: 321 SEEQFNGIKTIKSFVAEG------KEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
           +E     I+ +K F  E       K +R+    +R LF  A    ++S  +F    ++  
Sbjct: 533 NE-CLQNIRIVKYFAWENNISKDIKSIRQ--NELRFLFQKALVWALSSFLWFVTPTLVTG 589

Query: 375 VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE 434
           V+F + + +  H  L   L+  +L+ F L      + +  LSN  S + +   +  R+ +
Sbjct: 590 VTFAIYI-FVQHQELNAPLAFTTLSLFTL----LKTPLDQLSNMLSFMNQSIVSLDRIVK 644

Query: 435 LT---DYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFK--KLRLTITPGSNV 488
                D +K    TV     P + +IEFK+ + ++      S IFK   L +T   G   
Sbjct: 645 FINEDDTEKYNQLTVS----PDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLN 700

Query: 489 CIVGPSGRGKSTIASLLLRFYDANSGTILIDG----QDISKVSAKSLRKHLGVVQQEPVL 544
            I+G +G GKS +   LL      SG+I + G     D+       L        Q   L
Sbjct: 701 LILGSTGSGKSALLMGLLGELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWL 759

Query: 545 MSGTIRDNITYGLSYTPSMDEIR--AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
           ++ T+++NI +  +Y    D++R   V   C     +   P G  T IG +G  LSGGQ+
Sbjct: 760 LNDTVKNNIIFNGAY----DDVRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQK 815

Query: 603 QRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLS-T 659
           QRI++ARA+    K ++LD+  SA+D  +   I  N   G +M ++  T + + H +S T
Sbjct: 816 QRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVSLT 873

Query: 660 IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
           IR +   V+L N G V   G    L   E + +FK
Sbjct: 874 IREAYFAVILEN-GKVKNQGTIKQL---EKTGIFK 904

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 137/520 (26%), Positives = 230/520 (44%), Gaps = 31/520 (5%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
            N   + LL     R   +L   +    ++   +FF+   +G +++R  +D   V  ++  
Sbjct: 1022 NLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRILNRFSADIDTVDSTLQM 1081

Query: 256  NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTG 315
                  K+     + V ++  IS  L    ++F   L++    Y K     SREL++ T 
Sbjct: 1082 VFMVFFKSIFSYLITV-ILITISMPL---FLVFCLFLMVIYIYYQKLFIVQSRELKRMTS 1137

Query: 316  ----NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNV 371
                 +  +  E   G+  I+++  +   M +Y    R  FN+       S   +     
Sbjct: 1138 ISYSPIMSLVGESLGGLAVIRAY--KHFSMFKYLNNERVQFNINCVFDYRSTNRWLSIR- 1194

Query: 372  LGDVSFLLVLAYG----SHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAG 427
            L  +  L+VL  G    S +     L+ G +   M Y     +S+  +      +  G  
Sbjct: 1195 LQTIGALMVLITGMLSLSTISSSKPLTAGMVGLLMSYVLQVTTSLMWIVRSSVMIETGIV 1254

Query: 428  AASRLFELTDYKKSVPSTVGQ----TFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTIT 483
            +  R+ E  +        V      +  P  G I+FK+ S  Y       + K + + I 
Sbjct: 1255 SVERIMEYCELPSEAEQIVDDYRPASNWPSKGAIQFKNYSTRYRAN-LDPVLKNISININ 1313

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
            PG  V IVG +G GKST+   L R  +   GTI+IDG DISK+    LR HL ++ Q+  
Sbjct: 1314 PGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDISKIGISDLRSHLAIIPQDAQ 1373

Query: 544  LMSGTIRDNIT-YGLSYTPSMDEIRAVAK-----KCFCHNFITKFP--DGYDTVIGPRGA 595
               GT+R N+  + +     +D    ++      K       ++ P  D  +  I   G+
Sbjct: 1374 AFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEESGSELPLNDYLELGIKESGS 1433

Query: 596  LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
             LS GQRQ + +ARAL+ + KIL+LDEAT+++DVE++  I  T+      +  TI++IAH
Sbjct: 1434 SLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKIIQATIRESFSDR--TIITIAH 1491

Query: 656  RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            R+ T+  S+ I+VL   G V E    A L  D+ +  ++L
Sbjct: 1492 RIDTVLDSDRILVL-EQGEVKEFNSPASLLADKSTLFYQL 1530

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 110/224 (49%), Gaps = 32/224 (14%)

Query: 489 CIVGPSGRGKSTIASLLLRFYDANSGT-------ILIDGQDISKVSAKSLRKHLGVVQQE 541
           C+VG  G GK+T+   +L      SG+       ++I G+ ++               QE
Sbjct: 663 CVVGRVGSGKTTLLKSILGQLPCTSGSQKAIPPKLIIRGESVAYCP------------QE 710

Query: 542 PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
             +M+ +I++NI +G  Y  +   +    K C         PDG +T++G +G  LSGGQ
Sbjct: 711 AWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQ 768

Query: 602 RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS-----KEITIVSIAHR 656
           + R+++ARA+  +  I +LD+  SA+D     +I   + R++ S     K   I+   + 
Sbjct: 769 KARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSI---IHRVLDSDTGLLKNKAIILTTND 825

Query: 657 LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSE--LFKLLNE 698
           +S +  S+ I VL  DG +IE   +A+   D D +  L+KLL E
Sbjct: 826 ISVLEHSDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKE 868

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 156/546 (28%), Positives = 234/546 (42%), Gaps = 85/546 (15%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  +L  +G      L  + +K+ LH    + D   +G +++R   D   +   +T ++
Sbjct: 952  GQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1011

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG----------KRIRAIS 307
               + +     VGV +M  +     +  I   P LLI   +            KR+ A+ 
Sbjct: 1012 R-LMTSQFANIVGVCVMCIVYLPWFAIAI---PFLLIIFVLIADHYQSSGREIKRLEAVQ 1067

Query: 308  RELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS 367
            R    +  N      E   G+ TIK++    +   R+      L N     G        
Sbjct: 1068 RSFVYNNLN------EVLGGMDTIKAY----RSQERFLAKSDFLINKMNEAGYLVVVLQR 1117

Query: 368  GTNVLGD---VSFLLVL--------------AYGSHL--VLQGELSLGSLTAFMLYTEYT 408
               +  D   + F L++              + G  L  VLQ    L +L   +  TE  
Sbjct: 1118 WVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVLQLPGLLNTLLRALTQTEND 1177

Query: 409  GSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-P 467
             +S   L ++ +EL   A          DY+K  P        P  G I FK+V FSY P
Sbjct: 1178 MNSAERLVSYATELPLEA----------DYRK--PEMAPPESWPSKGEIAFKNVDFSYRP 1225

Query: 468  TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527
              P   + K L L I  G  + I G +G GKSTI S L R  + + G ILID  +IS++ 
Sbjct: 1226 GLPV--VLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEILIDDVNISQIG 1283

Query: 528  AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR-------AVAKKCF------ 574
               LR+ L ++ Q+PVL  GTIR N+      T   DE+        A+AK         
Sbjct: 1284 LFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTE--DELWDALVRGGAIAKNDLPEVKLQ 1341

Query: 575  ------CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALD 628
                   H  + KF    D  +   G+  S G+RQ +A+ RAL+++ KILILDEATS++D
Sbjct: 1342 KPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVD 1399

Query: 629  VESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
             E++G I   +  +    + TI+ IAHRL TI   + I+VL   G V E      L+  E
Sbjct: 1400 YETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDTPWALFSQE 1456

Query: 689  DSELFK 694
            DS +FK
Sbjct: 1457 DS-IFK 1461

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 99/203 (48%), Gaps = 21/203 (10%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           FK L   I  G  + I GP G GKS++ + +        G I ++G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPS-MDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
             ++   P + + T++DNI +G  +     DE+  V   C     +   P G  T IG R
Sbjct: 652 --LMCGYPWIQNATVKDNIIFGSPFNKEKYDEVIHV---CSLKADLDILPAGDMTEIGER 706

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVS 652
           G  LSGGQ+ RI +AR++ K+  I + D+  SA+D    +  ++  L  L+ +K  T V 
Sbjct: 707 GITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVL 764

Query: 653 IAHRLSTIRRSENIVVLGNDGSV 675
             H+LS I ++  ++VLG DG V
Sbjct: 765 ATHQLSLIEKASRVIVLGTDGDV 787

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 135/496 (27%), Positives = 235/496 (47%), Gaps = 53/496 (10%)

Query: 229  FFDRNKVGDLISRLGSDAY----IVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSA 284
            FF+   +G +++R  +D Y    I+ R+ +    + VK     GV       I+ T    
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGV-------IAYTTWQF 1114

Query: 285  MIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGK 339
            + +  P  +         +R  SREL++   ++TR       +E   G+ TI+ +   G+
Sbjct: 1115 VFVIVPLGIFYIYYQQYYLRT-SRELRR-LESVTRSPIFSHFQETLGGLATIRGY---GQ 1169

Query: 340  EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLL-----VLAYGSHLVLQGELS 394
            + R  +    R+ N         + F+   N    +++ L     V+  G+  +   +L 
Sbjct: 1170 QKRFEHINECRVDN-------NMSAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLR 1222

Query: 395  LGSLTAFML-----YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQT 449
             G++TA M+     Y      ++  +     E+     +  R+ E ++ K   P  +   
Sbjct: 1223 AGTMTAGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIESN 1282

Query: 450  FVPRD----GRIEFKDVSFSYPTR---PTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIA 502
              P++    G I+F+     Y TR       + K + L I P   + IVG +G GKS++ 
Sbjct: 1283 RPPKEWPVAGEIKFE----HYYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLT 1338

Query: 503  SLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS 562
              L R  +A SG ILIDG  I+++    LR HL ++ Q+  +  GTIR+NI     +T +
Sbjct: 1339 LALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENIDPTNQFTDA 1398

Query: 563  MDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDE 622
             D  RA+       + +    DG  T++   G+ LS GQRQ + +ARAL+   K+L+LDE
Sbjct: 1399 -DIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDE 1457

Query: 623  ATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFA 682
            AT+A+DVE++  I  T+    + +  TI++IAHR++TI  ++ I+VL + G V+E     
Sbjct: 1458 ATAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVEFDTPE 1514

Query: 683  DLYRDEDSELFKLLNE 698
             L ++ +S  + L  E
Sbjct: 1515 ALLKNTNSIFYSLSKE 1530

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 111/412 (26%), Positives = 184/412 (44%), Gaps = 44/412 (10%)

Query: 306 ISRELQQSTGNL----TRVSEEQFNGIKTIKSFVAEG--KEMRRYNTAVRRLFNVAKREG 359
           I + LQ+S        TRV  E  N +K++K +  E   KE   Y    + L N+ K   
Sbjct: 487 IQKNLQKSQMKFKDERTRVISEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGV 546

Query: 360 ITSATFFSGTNV--LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSN 417
             + T F    V  L   S   V  Y     L  +L   +LT F L +      +  + N
Sbjct: 547 YMACTSFQFNIVPFLVSCSTFAVFVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPN 602

Query: 418 FYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPR-----DGRIEFKD-VSFSYPTRPT 471
             + +++ + + SRLF     ++     V +  +P+     D  +   D  +F +  +P 
Sbjct: 603 VITAIIESSVSVSRLFNFLTNEELQKDAVQR--LPKVKEIGDVAVNVGDNATFLWKRKPE 660

Query: 472 SQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-K 529
            ++  K +      G   CIVG  G GKS     LL               D+ +V    
Sbjct: 661 YKVALKNINYQAKKGELSCIVGKVGSGKSAFLQSLL--------------GDLFRVKGFA 706

Query: 530 SLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTV 589
           ++   +  V Q   +M+GT+RDN+ +G  Y P   E     K C     +    DG  T+
Sbjct: 707 TIHGSVAYVSQVAWIMNGTVRDNVLFGHKYDPEFYE--KTIKACALTIDLATLVDGDQTL 764

Query: 590 IGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSK 646
           +G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   S   + + LG   L+ SK
Sbjct: 765 VGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSK 824

Query: 647 EITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
             T +   +++S +  +++I +L N G + + G +AD  +DE+S L KLL E
Sbjct: 825 --TRILATNKISVLSAADSITLLEN-GEITQQGTYADCRKDEESALGKLLKE 873

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 138/490 (28%), Positives = 226/490 (46%), Gaps = 41/490 (8%)

Query: 229  FFDRNKVGDLISRLGSDAY----IVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSA 284
            FF+   +G +++R  +D Y    I+ R+     ++ VK        V     +    T  
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVK--------VSFTIVVICMATWQ 1094

Query: 285  MIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGK 339
             I    PL +    Y +     SREL++   ++TR       +E   G+ TI+ +  + +
Sbjct: 1095 FIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGLTTIRGYSQQNR 1153

Query: 340  -----EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELS 394
                 + R  N       +V     +     F G+ ++   S L V+  G+     G L+
Sbjct: 1154 FVHINQTRVDNNMSAFYPSVNANRWLAFRLEFIGSVIILAASMLAVIRLGN-----GTLT 1208

Query: 395  LGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQ----TF 450
             G +   + +      S+  +     E+     +  R+ E  + K   P  +        
Sbjct: 1209 AGMIGLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPYIIKDHRPPAS 1268

Query: 451  VPRDGRIEFKDVSFSYPTRPTSQ-IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFY 509
             P  G I+F  V++S   RP  + I K + L I P   + IVG +G GKS++   L R  
Sbjct: 1269 WPESGEIKF--VNYSTRYRPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRII 1326

Query: 510  DANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEI-RA 568
            +A SG I+IDG  I  +    LR  L ++ Q+  +  GT+R+NI     YT   +EI  A
Sbjct: 1327 EAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENIDPTNRYTD--EEIWNA 1384

Query: 569  VAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALD 628
            +A      + +    +G +T++   G+ LS GQRQ + +ARAL+    ILILDEAT+A+D
Sbjct: 1385 LALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVD 1444

Query: 629  VESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
            VE++  I  T+      KE TI++IAHR++TI  S+ I+VL + G V E     +L + +
Sbjct: 1445 VETDQLIQKTIRNAF--KERTILTIAHRINTIMDSDRIIVL-DKGRVTEFDTPQNLLQKK 1501

Query: 689  DSELFKLLNE 698
            DS  + L  E
Sbjct: 1502 DSIFYSLCLE 1511

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 108/396 (27%), Positives = 185/396 (46%), Gaps = 41/396 (10%)

Query: 318 TRVSEEQFNGIKTIKSFVAE--GKEMRRYNTAVRRLFNVAKREGITSATF---FSGTNVL 372
           TRV+ E  N IK++K +  E   K    +    + L N+ K+ G T A     F+    L
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNL-KKMGCTLALANFQFNIVPFL 540

Query: 373 GDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLS---NFYSELMKGAGAA 429
              S   V  Y     L  +L   +LT F L +       F L+   N  S  ++ + + 
Sbjct: 541 VSCSTFAVFVYTEERPLSTDLVFPALTLFNLLS-------FPLAVVPNAISSFIEASVSI 593

Query: 430 SRLFE-LTDYKKSVPSTVGQTFVPR--DGRIEFKDVSFSYPTRPTSQI-FKKLRLTITPG 485
           +RLF  LT+ +    + + +  V    D  ++  D +F +  +P  ++  K +      G
Sbjct: 594 NRLFAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEYKVALKNINFVAKKG 653

Query: 486 SNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLM 545
              CIVG  G GKS +   LL       G   + G D++ VS            Q P +M
Sbjct: 654 ELTCIVGKVGSGKSALIQSLLGDLIRVKGFATVHG-DVANVS------------QVPWIM 700

Query: 546 SGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRI 605
           +GT++DNI +G  Y P   ++    K C     ++  PDG  T++G +G  LSGGQ+ R+
Sbjct: 701 NGTVKDNILFGHKYDPEFYQL--TIKACALSIDLSMLPDGDQTLVGEKGISLSGGQKARL 758

Query: 606 AIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRLSTIRR 662
           ++ARA+  +    +LD+  +A+D   ++  I + LG   L+ SK  T V   ++++ +  
Sbjct: 759 SLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSK--TKVLATNKITVLSI 816

Query: 663 SENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           +++I ++ N G +I+ G +  +    +S L KL+ E
Sbjct: 817 ADSITLMEN-GEIIQQGSYDQVNESTNSPLSKLIAE 851

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 146/502 (29%), Positives = 226/502 (45%), Gaps = 86/502 (17%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            V+KK L+    FFD   +G +++R   D   V + +T             G  V ++  +
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELT---------PFVEGAFVSLVQCL 1188

Query: 278  SSTLTSAMIMFAPPLLIAAT-------IYGKRIRAISRELQQ----STGNLTRVSEEQFN 326
            S+ +  A I   P  L+ A        + G    A SREL++    S   + +   E   
Sbjct: 1189 STVILIAYI--TPGFLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLV 1246

Query: 327  GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGT---------NVLGDVSF 377
            GI TI++F   G E RR+      L N+ K +      F+            +++G    
Sbjct: 1247 GITTIRAF---GDE-RRF-----MLENLQKIDENNKPFFYLWVANRWLAFRIDMIGAC-- 1295

Query: 378  LLVLAYGSHLVLQ-GELSLG----SLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL 432
             +V A G  ++L   +L  G    SLT  + +TE        L   YS +     +  RL
Sbjct: 1296 -VVFAAGVFILLNIKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERL 1350

Query: 433  FELTDYKKSVPSTVGQ----TFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNV 488
             E    ++  PS  G        P  G+IE  D+S  Y T    ++ K +  T+ P   V
Sbjct: 1351 KEYMVIEQE-PSNDGAFNPPIEWPDQGKIEVNDLSLRYATN-LPRVIKNVSFTVDPKCKV 1408

Query: 489  CIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGT 548
             IVG +G GKSTI + L RF D  +G I ID  DI+ +  K LR+ + ++ Q+P L SGT
Sbjct: 1409 GIVGRTGAGKSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGT 1468

Query: 549  IRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT-----KFPDGYDTV-------------- 589
            ++ N+     YT   ++I    K+    N +T       PD  D                
Sbjct: 1469 VKSNLDPYDEYTD--EQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLR 1523

Query: 590  --IGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647
              I   GA LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+       +
Sbjct: 1524 NEITEGGANLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGD 1581

Query: 648  ITIVSIAHRLSTIRRSENIVVL 669
             TI++IAHRL +I   + I+V+
Sbjct: 1582 STILTIAHRLRSIIDYDKILVM 1603

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 116/472 (24%), Positives = 223/472 (47%), Gaps = 46/472 (9%)

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI---SSTLTSAMIMFAP 290
            +G +I+ +  DA+ VS    + +   V+A +   V + +++ +   ++ + + +I+   
Sbjct: 474 NLGGIINLMAVDAFKVSEICAY-LHAFVEATIMTIVALTLLYKLLGWAAVIGAILIVCML 532

Query: 291 PL-LIAATIYGKRIRAISRELQQSTGNLT--RVSE--EQFNGIKTIKSFVAEGKEMRRYN 345
           PL    A + GK        LQ+    +T  R+ +  E F  I+ IK F  E +   R  
Sbjct: 533 PLNFKLANLIGK--------LQKDNLGVTDKRIQKLNETFQSIRIIKFFSWE-ENFERDI 583

Query: 346 TAVR--RLFNVAKRE---GITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLG--SL 398
            A+R   L  + KR     + S  +F   +++  VSF        ++ +QGE+     + 
Sbjct: 584 KAIRTEELKILLKRSIVWALMSLVWFITPSIVTSVSF------AFYIYVQGEVLTTPIAF 637

Query: 399 TAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIE 458
           TA  L+T    + +  LS+  S +++   +  R+ E  D +++      Q  + R+ +I 
Sbjct: 638 TALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQEFLDEEET--EKYNQLTISRN-KIA 693

Query: 459 FKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILI 518
           F++ +F++  +  S   K L +    G    ++G +G GK+++   LL   D   G + +
Sbjct: 694 FENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKVYV 753

Query: 519 DGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFC 575
              D  +   + +  +   +    Q   L++ T+R+NI +   Y  +    +AV + C  
Sbjct: 754 PSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYKAVVEACGL 811

Query: 576 HNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
                    G  T IG +G  LSGGQ+QR+++ARAL    + ++LD+  SA+D  +   I
Sbjct: 812 KRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTALWI 871

Query: 636 --NYTLGRLMRSKEITIVSIAHRLS-TIRRSENIVVLGNDGSVIEAGKFADL 684
             N   G LM+ +  T + ++H ++ T++ +E +VVL N G + + G+  DL
Sbjct: 872 YENCITGPLMQGR--TCILVSHNVALTLKNAEWVVVLDN-GRIKDQGEPLDL 920

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 131/472 (27%), Positives = 218/472 (46%), Gaps = 47/472 (9%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +    T   I  
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQ----FFVNAVKVTFTITVICATTWQFIFI 1096

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL +    Y +     SREL++   ++TR       +E   G+ T++ +     + +R
Sbjct: 1097 IIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGLATVRGY----SQQKR 1151

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL-----------QGE 392
            ++       N  + +   SA F+   N    +++ L L  GS ++L           QG 
Sbjct: 1152 FSH-----INQCRIDNNMSA-FYPSINANRWLAYRLELI-GSIIILGAATLSVFRLKQGT 1204

Query: 393  LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452
            L+ G +   + Y      ++  +     E+     +  R+ E  D K   P  +     P
Sbjct: 1205 LTSGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPP 1264

Query: 453  RD----GRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
            +     G I F + S  Y  RP    + K++ + I P   V IVG +G GKS++   L R
Sbjct: 1265 KQWPAQGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFR 1322

Query: 508  FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-- 565
              +A+ G I+IDG  I+++    LR  L ++ Q+  +  GT+R+NI     Y+   DE  
Sbjct: 1323 MIEASEGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYS---DEAI 1379

Query: 566  IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATS 625
             RA+       + ++   DG D  +   G+ LS GQRQ + +ARA++   KIL+LDEAT+
Sbjct: 1380 WRALELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATA 1439

Query: 626  ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIE 677
            A+DVE++  +  T+    + +  TI++IAHRL+TI  S+ I+VL N G V E
Sbjct: 1440 AVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GKVAE 1488

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 109/412 (26%), Positives = 192/412 (46%), Gaps = 42/412 (10%)

Query: 306 ISRELQQSTGNL----TRVSEEQFNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAK 356
           I ++LQ+S        TRV  E  N IK++K +  E       E  R N  ++ L  +  
Sbjct: 469 IQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGC 528

Query: 357 REGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLS 416
              +TS  F     ++   +F  V  Y     L  +L   +LT F L +         L+
Sbjct: 529 YMAVTSFQFNIVPFLVSCCTFA-VFVYTEDRALTTDLVFPALTLFNLLSFPLMIIPMVLN 587

Query: 417 NFYSELMKGAGAASRLFELTDYKKSVPSTVGQT-FVPRDGRIEFK---DVSFSYPTRPTS 472
           +F    ++ + +  RLF     ++  P +V +   V   G I      D +F +  +P  
Sbjct: 588 SF----IEASVSIGRLFSFFTNEELQPDSVQRLPNVENIGDIAINIGDDATFLWQRKPEY 643

Query: 473 QI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KS 530
           ++  K +    T G+  CIVG  G GK+ + S +L               D+ +V    +
Sbjct: 644 KVALKNIDFQATKGNLTCIVGKVGSGKTALLSCML--------------GDLFRVKGFAT 689

Query: 531 LRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVI 590
           +   +  V Q P +M+GT+++NI +G  Y     E     K C     +    DG  T++
Sbjct: 690 VHGCIAYVSQVPWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDKTLV 747

Query: 591 GPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKE 647
           G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   +   I + LG   L+ +K 
Sbjct: 748 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK- 806

Query: 648 ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            T +   +++S +  +++I +L N G +I+ G ++D+ +D DS L+KLLN++
Sbjct: 807 -TRILATNKVSALSIADSIALLDN-GEIIQQGAYSDITKDADSPLWKLLNDY 856

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 146/519 (28%), Positives = 231/519 (44%), Gaps = 62/519 (11%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            ++KK L+    FFD   +G +++R   D   V + +T             G  V ++  +
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELT---------PFVEGAFVSLVQCL 970

Query: 278  SSTLTSAMI---MFAPPLLIAATIY--GKRIRAISRELQQ----STGNLTRVSEEQFNGI 328
            S+ +  A I    F   + IA   Y  G    A SREL++    S   + +   E   GI
Sbjct: 971  STVILIAYITPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGI 1030

Query: 329  KTIKSFVAEGKEMRRY------NTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLA 382
             TI++F  E + M+        N        VA R  +       G  V+      ++L 
Sbjct: 1031 TTIRAFGDERRFMQENLEKIDENNKPFFYLWVANR-WLAFRIDMIGACVIFAAGIFVLLN 1089

Query: 383  YGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSV 442
              S   L   L+  SLT  + +TE        L   YS +     +  RL E  + ++  
Sbjct: 1090 IKS---LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEP 1142

Query: 443  PSTVGQT---FVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
                  T     P  G+IE  D+S  Y P+ P  ++ K +  T+ P   V IVG +G GK
Sbjct: 1143 HYQSTHTPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGK 1200

Query: 499  STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558
            STI + L RF D  SG I ID  DI+ V  K LR+ + ++ Q+P L +GT++ N+     
Sbjct: 1201 STIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDE 1260

Query: 559  YTP-------------SMDEIR-----AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
            Y+              + +E+      A          + KF    D  I   GA LS G
Sbjct: 1261 YSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLR-LDNEITEGGANLSQG 1319

Query: 601  QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAHRLST 659
            QRQ + +AR+L++ PK+++LDEAT+++D  S+  I  T+ G    S   TI++IAHRL +
Sbjct: 1320 QRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRS 1376

Query: 660  IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            I   + I+V+ + G V E      L  +++S  + +  +
Sbjct: 1377 IIDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCED 1414

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 114/485 (23%), Positives = 223/485 (45%), Gaps = 41/485 (8%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI-- 277
           +K +  D E    N +G +I+ +  DA+ VS    + +   V+A +   V + +++ +  
Sbjct: 244 QKDIDADEESSTAN-LGAIINLMAVDAFKVSEICAY-LHSFVEALVMTIVALTLLYKLLG 301

Query: 278 -SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLT--RVSE--EQFNGIKTIK 332
            S+ +   +I+   PL         ++  +   LQ+ T + T  R+ +  E F  I+ IK
Sbjct: 302 WSAIVGVLLIIVILPL-------NFKLANLLGNLQKETLSFTDKRIQKLNETFQAIRIIK 354

Query: 333 SF-VAEGKEMRRYNTAVRRLFNVAKRE---GITSATFFSGTNVLGDVSFLLVLAYGSHLV 388
            F   E  E    N   + L  + KR     +T+  +F   +++  VSF       +++ 
Sbjct: 355 FFSWEENFEKDIQNIRDQELKMLVKRSIVWALTAFVWFVTPSIVTTVSF------ATYIY 408

Query: 389 LQGEL--SLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTV 446
           +QGE+  +  + TA  L+T    + +  LS+  S +++   +  R+    +  ++     
Sbjct: 409 IQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRVQVFLEEDET--EKY 465

Query: 447 GQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL 506
            Q  V R  RI F++ +FS+  +      K + +    G    ++GP+G GK+++   LL
Sbjct: 466 DQITVSRK-RIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLL 524

Query: 507 RFYDANSGTIL---IDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSM 563
              D   G +    +D ++   V    +   +    Q   L++ T+++NI +   +  + 
Sbjct: 525 GEMDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILFSSPFNEAR 584

Query: 564 DEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEA 623
            +  AV + C           G  T IG +G  LSGGQ+QR+++ARAL    + L+LD+ 
Sbjct: 585 YD--AVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDC 642

Query: 624 TSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKF 681
            SA+D  +   I  N   G LM  +  T + ++H ++   ++ + VV   +G V + G+ 
Sbjct: 643 LSAVDSHTALWIYENCITGPLMEGR--TCILVSHNVALTLKNADWVVFMENGKVKDQGEP 700

Query: 682 ADLYR 686
            +L++
Sbjct: 701 LELFQ 705

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  139 bits (351), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 145/526 (27%), Positives = 235/526 (44%), Gaps = 76/526 (14%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            ++KK L+    FFD   +G +++R   D   V + +T             G  V ++  +
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELT---------PFVEGAFVSLVQCL 1183

Query: 278  SSTLTSAMI---MFAPPLLIAATIY--GKRIRAISRELQQ----STGNLTRVSEEQFNGI 328
            S+ +  A I    F   + I    Y  G    A SREL++    S   + +   E   GI
Sbjct: 1184 STVILIAYITPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGI 1243

Query: 329  KTIKSFVAEGKEMRRYNTAVRR------LFNVAKREGITSATFFSGTNVLGDVSFLLVLA 382
             TI++F  E + M+   T +           VA R  +       G  V+      ++L 
Sbjct: 1244 TTIRAFGDERRFMQENLTKIDENNKPFFYLWVANR-WLAFRIDMIGACVIFAAGIFVLLN 1302

Query: 383  YGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSV 442
              S   L   L+  SLT  + +TE        L   YS +     +  RL E  + ++  
Sbjct: 1303 IKS---LDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYMEVEQEP 1355

Query: 443  PSTVGQT---FVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
                        P  G+IE  D+S  Y P+ P  ++ K +  T+ P   V IVG +G GK
Sbjct: 1356 HYQSTHNPPPEWPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGK 1413

Query: 499  STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558
            STI + L RF D  SG I ID  DI+ V  K LR+ + ++ Q+P L +GT++ N+     
Sbjct: 1414 STIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDE 1473

Query: 559  YT------------------------PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
            Y+                        PS D   AV++       + KF    +  I   G
Sbjct: 1474 YSDKQIFEALKRVNLVTQEELDHAANPSPDNASAVSEN------VNKFL-FLENEISEGG 1526

Query: 595  ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK--EITIVS 652
            + LS GQRQ + +AR+L++ PK+++LDEAT+++D +S+  I  T+    RS+  + TI++
Sbjct: 1527 SNLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTI----RSEFSDSTILT 1582

Query: 653  IAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            IAHRL +I   + I+V+ + G V E      L  +++S  + +  +
Sbjct: 1583 IAHRLRSIIDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCED 1627

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 107/466 (22%), Positives = 211/466 (45%), Gaps = 34/466 (7%)

Query: 235 VGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI--SSTLTSAMIMFA--P 290
           +G +I+ +  DA+ VS    + +   V+A +   V + +++ +   S +  A+++ A  P
Sbjct: 472 LGAIINLMAVDAFKVSEICAY-LHSFVEALVMTIVALTLLYKLLGWSAIIGALLIVAILP 530

Query: 291 PLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEG---KEMRRY-NT 346
                AT+ GK    + +E    T    +   E F  I+ IK F  E    K+++   + 
Sbjct: 531 LNFRLATLIGK----LQKETLSFTDKRIQKLNETFQAIRIIKFFSWEENFEKDIQSIRDQ 586

Query: 347 AVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGEL--SLGSLTAFMLY 404
            ++ L   +    +T+  +F    ++  VSF        ++ +QGE+  +  + TA  L+
Sbjct: 587 ELKMLVKRSVAWALTAFVWFITPTIVTSVSF------AFYIYVQGEVLTTPVAFTALSLF 640

Query: 405 TEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSF 464
           T    + +  LS+  S +++   +  R+      ++       Q  V R+ +I F++ +F
Sbjct: 641 T-LLRNPLDMLSDMLSYVIQSKVSLDRV--QEFLEEEETEKYEQITVHRN-KIGFENATF 696

Query: 465 SYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTIL---IDGQ 521
           S+  +      K + +    G    ++GP+G GK+++   LL   D   G +    +D +
Sbjct: 697 SWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPR 756

Query: 522 DISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITK 581
           +   +    +   +    Q   L++ T+++NI +   +        AV + C        
Sbjct: 757 EDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFSSPFNEG--RYNAVIEACGLKRDFEI 814

Query: 582 FPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTL 639
              G  T IG +G  LSGGQ+QR+++ARAL    + L+LD+  SA+D  +   I  N   
Sbjct: 815 LSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCIS 874

Query: 640 GRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
           G LM  +  T + ++H ++   ++   VV   +G V + G+  +LY
Sbjct: 875 GPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  139 bits (350), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 235/510 (46%), Gaps = 42/510 (8%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGM 273
            L   + K  +    +FF+   +G +I+R  SD   V  ++ +  S   ++ L   + V +
Sbjct: 1038 LHDSMAKAIIRSPVQFFETTPIGRVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVIL 1097

Query: 274  MFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKS 333
            +    S      ++F   ++I    Y K     SREL+       R++   ++ I ++ S
Sbjct: 1098 V----SVAMPWFLLFNALIMIIYFYYEKLYIVQSRELK-------RLTSIAYSPIISLMS 1146

Query: 334  FVAEGKE-MRRYN-TAVRRLFNVAKREGITSATF-FSGTNV-----LGDVSFLLVLAYG- 384
                G+  +  YN + + +  N+ + +   +  F F  TN      L  +   ++L  G 
Sbjct: 1147 ETLGGQMVISAYNHSKMFKFMNIERVQYNLNVLFTFRSTNRWLSIRLQSIGAFIILCTGL 1206

Query: 385  ---SHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
               + L     +  G +   M Y     S++  +     ++     +  R+ E       
Sbjct: 1207 LALTTLRTSSPIGSGLIGLLMSYVLQVTSALTWIVRSTVQIETNIVSVERILEYCHLPPE 1266

Query: 442  VPSTVGQTFVPRD----GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRG 497
                +    V RD    G IEFK+ + +Y     S + K + +TI P   V IVG +G G
Sbjct: 1267 AEDIIDSNRVERDWPQRGSIEFKNYTTTYRAN-LSPVLKNISVTINPSEKVGIVGRTGAG 1325

Query: 498  KSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL 557
            KST++  L R  +A  GTI IDG DIS++    LR ++ ++ Q+     GT+R N+    
Sbjct: 1326 KSTLSLALFRILEAAEGTIFIDGVDISRIGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQ 1385

Query: 558  SYTPSMDEIRAVAKKCFCHNFITKFPD---------GYDTVIGPRGALLSGGQRQRIAIA 608
             +T    E+  V +       + +  +         G D  I   G+ LS GQRQ + +A
Sbjct: 1386 KHTDV--ELWNVIELSHLKPHVLRMAEDDNLSGNLSGLDAKINENGSNLSVGQRQLLCLA 1443

Query: 609  RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVV 668
            RAL+ + K+L+LDEAT+A+DVE++  I  T+    + K+ TI++IAHRL TI  ++ I+V
Sbjct: 1444 RALLNQSKVLVLDEATAAVDVETDKIIQETIRT--QFKDRTILTIAHRLDTIMDNDKILV 1501

Query: 669  LGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            L + G V E     +L  DE +  ++L ++
Sbjct: 1502 L-DAGGVKEFDSPKNLLSDESTLFYQLCDK 1530

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 106/465 (22%), Positives = 216/465 (46%), Gaps = 53/465 (11%)

Query: 269 VGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGI 328
           V   + F + + + + ++M    L + + +  K+++ +++   +      +   E  N +
Sbjct: 417 VLFSLYFLLGNAIIAGLVMMVIMLPVNSYL-SKKVKTLTKTQMKYKDARIKTITEILNSM 475

Query: 329 KTIKSFVAEGKEMRRYNTAVRRLFNVA--KREGITSATFFSGTN---VLGDVSFLLVLAY 383
           K+IK +  E   M++ +  VR    +   K+ GI S   +   N   +L   S   +   
Sbjct: 476 KSIKLYAWEKPMMQKLD-HVRNDLEIGNLKKIGIASNLIYFAWNCVPLLVTCSTFGIFTL 534

Query: 384 GSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVP 443
            S   L  EL   +L+ F +  E    +++ + +  + +++   + +RL +    ++   
Sbjct: 535 ISDEPLTPELVFPALSLFNILNE----AIYAIPSTINTMIEVTVSLNRLKKFLLSEELDR 590

Query: 444 STVGQTFVPRDGRI---EFKDVSFSYPTRP---------------TSQI-FKKL-RLTIT 483
           S + QT  P +  I   E ++ +F + ++                T+Q+  K +   T +
Sbjct: 591 SFIEQTGKPANEYIPAVEIENATFLWKSQAQLINSENDDSEANIETTQVALKNIDHFTAS 650

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDIS-KVSAKSLRKHLGVVQQEP 542
           P S  C++G  G GK+T+   +L      SG+     + IS K+S +   + +    QE 
Sbjct: 651 PKSLTCVIGKVGSGKTTLLKAILGQLPCISGS----KESISPKLSIRG--ESIAYCPQEA 704

Query: 543 VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            +M+ TI++NI +G  +  +   +   A +      I   PDG  T++G +G  LSGGQ+
Sbjct: 705 WIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGEKGISLSGGQK 762

Query: 603 QRIAIARALIKKPKILILDEATSALDVE-----SEGAINYTLGRLMRSKEITIVSIAHRL 657
            R+++ARA+  +  I +LD+  SA+D        E  ++   G L+R+K  T++   + +
Sbjct: 763 ARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK--TVILSTNTV 819

Query: 658 STIRRSENIVVLGNDGSVIEAGKFADLYR----DEDSELFKLLNE 698
           S ++ S+ I  L N G ++E G + D+      D++S++  LL +
Sbjct: 820 SVLKHSQLIYALEN-GIIVERGNYNDIIESANSDDESKISALLKQ 863

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  139 bits (350), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 137/529 (25%), Positives = 242/529 (45%), Gaps = 60/529 (11%)

Query: 209  RLVARLRAQ------VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVK 262
              VA +RA       ++K  L+    FFD   +G +++R   D   + + +T  +     
Sbjct: 1121 NFVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFG 1180

Query: 263  AALCGGVGVGMMFHISST--LTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRV 320
            + +     + ++ +I+    + +A++M        A  Y    R + R    S   + + 
Sbjct: 1181 SLIQCVSTIIVIAYITPQFLIVAAIVMLL--FYFVAYFYMSGARELKRLESMSRSPIHQH 1238

Query: 321  SEEQFNGIKTIKSFVAEGK----EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVS 376
              E   GI TI++F  E +     M++ +   R  F +     + +        ++G   
Sbjct: 1239 FSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFYL----WVCNRWLSYRIELIGA-- 1292

Query: 377  FLLVLAYGSHLVLQGELSLGSLTAFML--YTEYTGSSVFGLSNFYSELMKGAGAASRLFE 434
             L+VLA GS ++L  +     L    L    ++T  +++ +   YS +     +  RL E
Sbjct: 1293 -LIVLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKE 1350

Query: 435  LTDYKKSVPSTVGQTF----VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCI 490
             T  ++  PS VG        P++G+IE KD+S  Y      ++ K +  T+     V I
Sbjct: 1351 YTTIEQE-PSNVGALVPPCEWPQNGKIEVKDLSLRYAA-GLPKVIKNVTFTVDSKCKVGI 1408

Query: 491  VGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIR 550
            VG +G GKSTI + L RF D  +G I ID  DI+ +  K LR+ + ++ Q+P L +GT++
Sbjct: 1409 VGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLK 1468

Query: 551  DNITYGLSYTPSMDEIRAVAKKCFCHNFIT---------------------KFPDGYDTV 589
             N+     Y+ +  EI    K+    N ++                     KF D  +  
Sbjct: 1469 TNLDPYNEYSEA--EIFEALKRV---NLVSSEELGNPSTSDSTSVHSANMNKFLD-LENE 1522

Query: 590  IGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEIT 649
            +   G+ LS GQRQ I +AR+L++ PK+++LDEAT+++D  S+  I  T+     +   T
Sbjct: 1523 VSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--T 1580

Query: 650  IVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            I++IAHRL +I   + I+V+ + G V E      L  + DS  + +  +
Sbjct: 1581 ILTIAHRLRSIIDYDKILVM-DAGEVKEYDHPYSLLLNRDSIFYHMCED 1628

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 118/491 (24%), Positives = 220/491 (44%), Gaps = 52/491 (10%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI-- 277
           K+ +  D E      +G +I+ +  DA+ VS    + +   ++A +   V + +++ +  
Sbjct: 467 KQHVDGDEESATTANLGAIINLMAVDAFKVSEICAY-LHSFIEAIIMTIVALFLLYRLIG 525

Query: 278 -SSTLTSAMIM-FAPPLLIAATIYG---KRIRAISRELQQSTGNLTRVSEEQFNGIKTIK 332
            S+ + SAMI+ F P     A++ G   K+  AI+ +  Q          E F  I+ IK
Sbjct: 526 WSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN-------EAFQAIRIIK 578

Query: 333 SFVAEGK-EMRRYNTAVRRLFNVAKRE---GITSATFFSGTNVLGDVSFLLVLAYGSHLV 388
            F  E   E    NT    L  + KR     ++S  +F   +++   SF        ++ 
Sbjct: 579 FFSWEENFEKDIQNTRDEELNMLLKRSIVWALSSLVWFITPSIVTSASF------AVYIY 632

Query: 389 LQGELSLGSLTAFMLYTEYTGSSVFGL--------SNFYSELMKGAGAASRLFELTDYKK 440
           +QG+ +L +  AF      T  S+F L        S+  S +++   +  R+ E  + ++
Sbjct: 633 VQGQ-TLTTPVAF------TALSLFALLRNPLDMLSDMLSFVIQSKVSLDRVQEFLNEEE 685

Query: 441 SVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
           +      Q  V R+ ++  ++ +F++         K L +    G    IVGP+G GK++
Sbjct: 686 T--KKYEQLTVSRN-KLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTS 742

Query: 501 IASLLLRFYDANSGTILIDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL 557
           +   LL   +  +G + +   +  +   V A  +   +    Q   L++ T+R+NI +  
Sbjct: 743 LLMGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNA 802

Query: 558 SYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKI 617
            Y    +   AV   C           G  T IG +G  LSGGQ+QR+++AR+L    + 
Sbjct: 803 PYNE--NRYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRH 860

Query: 618 LILDEATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSV 675
           L+LD+  SA+D  +   I  N   G LM  +  T V ++H ++   ++ + V++  +G V
Sbjct: 861 LLLDDCLSAVDSHTALWIYENCITGPLMEGR--TCVLVSHNVALTLKNADWVIIMENGRV 918

Query: 676 IEAGKFADLYR 686
            E G+  +L +
Sbjct: 919 KEQGEPVELLQ 929

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 154/542 (28%), Positives = 233/542 (42%), Gaps = 84/542 (15%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  +L ++G      L  + +K+ LH    + D   +G +++R   D   +   +T ++
Sbjct: 951  GQYTILCVMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1010

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG----------KRIRAIS 307
               + +     VGV +M  +     +  I   P LL+   +            KR+ A+ 
Sbjct: 1011 R-LLTSQFANIVGVCVMCIVYLPWFAIAI---PFLLVIFVLIADHYQSSGREIKRLEAVQ 1066

Query: 308  RELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS 367
            R    +  N      E   G+ TIK++    +   R+      L N     G        
Sbjct: 1067 RSFVYNNLN------EVLGGMDTIKAY----RSQERFLAKSDFLINKMNEAGYLVVVLQR 1116

Query: 368  GTNVLGD---VSFLLVL--------------AYGSHL--VLQGELSLGSLTAFMLYTEYT 408
               V  D   + F L++              + G  L  VLQ    L ++   M  TE  
Sbjct: 1117 WVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTEND 1176

Query: 409  GSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-P 467
             +S   L ++ +EL   A          DY+K  P        P  G I  ++V FSY P
Sbjct: 1177 MNSAERLVSYATELPLEA----------DYRK--PEMTPPESWPSKGEIVLENVCFSYRP 1224

Query: 468  TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527
              P   + K L L I  G  + I G +G GKSTI S L R  + ++G ILID  DISK+ 
Sbjct: 1225 GLPV--VLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLG 1282

Query: 528  AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR-------AVAKKCFCHNFIT 580
               LR+ L ++ Q+PVL  GTIR N+      T   DE+        A+AK       + 
Sbjct: 1283 LFDLRRKLAIIPQDPVLFRGTIRKNLDPFDERTD--DELWDALVRGGAIAKNDLSEAKLQ 1340

Query: 581  KFPDG-----------YDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDV 629
            K PD             D  +   G+  S G+RQ +A+ RAL+++ KILILDEATS++D 
Sbjct: 1341 K-PDKNGTHGRMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDY 1399

Query: 630  ESEGAINYTLGRLMRS-KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
            E++G I     R++    + TI+ IAHRL TI   + I+VL   G V E      L+  E
Sbjct: 1400 ETDGKIQ---ARIVEEFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAEFDTPWTLFTQE 1455

Query: 689  DS 690
            +S
Sbjct: 1456 NS 1457

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 117/245 (47%), Gaps = 29/245 (11%)

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
           RDG  + +  SF        + FK L   I  G  + I GP G GKS++ + +       
Sbjct: 590 RDGPEDLEKTSF--------RGFKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKT 641

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572
            G I ++G D+             ++   P + +  +RDNI +G  +    ++   V + 
Sbjct: 642 DGKIEVNG-DL-------------LMCGYPWIQNAPVRDNIIFGSPFIK--EKYNEVIRV 685

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-S 631
           C     +   P G  T IG RG  LSGGQ+ RI +AR++ K+ +I + D+  SA+D    
Sbjct: 686 CSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVG 745

Query: 632 EGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSE 691
           +  ++  L  ++ +K  T +   H+LS I R+  ++VLG DG V + G   +L +  +  
Sbjct: 746 KHIMDECLTGMLANK--TRILATHQLSLIERASRVIVLGTDGQV-DIGTVDEL-KARNQT 801

Query: 692 LFKLL 696
           L KLL
Sbjct: 802 LIKLL 806

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 143/511 (27%), Positives = 225/511 (44%), Gaps = 43/511 (8%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            +L   + K  +     FF+   VG +I+R  SD   V  S+ +  S   K+ L   V V 
Sbjct: 1053 KLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVI 1112

Query: 273  MM-FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331
            ++ +++   L   M +     +   T Y    R + R +  S   +  +  E  NG   I
Sbjct: 1113 LVGYNMPWFLVFNMFLLGI-YIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSII 1171

Query: 332  KS------FVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGS 385
             +      F+    E  +YN      F    R           T VL     +L LA   
Sbjct: 1172 DAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVRLQTIGATIVLATA--MLTLA--- 1226

Query: 386  HLVLQGELSLGSLTAFMLYT-EYTGSSVFGLSNFYSELMKGAGAAS-----RLFELTDYK 439
             +  + +LS G +   M Y+ E TGS  + +    + +M      S        EL    
Sbjct: 1227 TMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVR---TTVMIETNIVSVERIVEYCELPSEA 1283

Query: 440  KSV-PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK 498
            +S+ P        P  G IEFKD S  Y       + K + + I P   V IVG +G GK
Sbjct: 1284 QSINPEKRPDKNWPSRGSIEFKDYSTKY-RENLDPVLKDINVKIEPCEKVGIVGRTGAGK 1342

Query: 499  STIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLS 558
            ST++  L R  +   G I+IDG +IS +    LR HL ++ Q+     GT++ N+     
Sbjct: 1343 STLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNR 1402

Query: 559  YTPSMDEIRAVAKKCFCHNFITKF--------------PDGYDTVIGPRGALLSGGQRQR 604
            Y  S DE++   +       + K                D  D  I   G+ LS GQRQ 
Sbjct: 1403 Y--SEDELKKAVELAHLKPHLEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQL 1460

Query: 605  IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE 664
            + +ARAL+ + KIL+LDEAT+++D+E++  I  T+ R  + +  TI++IAHR+ T+  S+
Sbjct: 1461 LCLARALLNRSKILVLDEATASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSD 1518

Query: 665  NIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
             I+VL ++GSV E    + L  ++ S  + L
Sbjct: 1519 KIIVL-DEGSVKEFDSPSKLLSNKASIFYSL 1548

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 116/219 (52%), Gaps = 14/219 (6%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDIS-KVSAKSLRKHLGVVQQEPV 543
           G+ VCIVG  G GKST    +L      SG+     + I  K+  +S    L    QE  
Sbjct: 665 GNLVCIVGRVGAGKSTFLKAILGQLPCMSGS----KESIPPKLIIRS--SSLAYCSQESW 718

Query: 544 LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQ 603
           +M+ ++++NI +G  +  +  ++    K C     +   PDG +T++G +G  LSGGQ+ 
Sbjct: 719 IMNASVKENILFGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKA 776

Query: 604 RIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSKEITIVSIAHRLSTIR 661
           R+++ARA+  +  I +LD+  SA+D E S+  I Y L G+    K  TI+   + +S ++
Sbjct: 777 RLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILK 836

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDED--SELFKLLNE 698
            S+ I  L N G ++E G +  +   E+  S+L KLL E
Sbjct: 837 HSQMIYALEN-GEIVEQGNYDSVMNRENSTSKLKKLLEE 874

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 229/488 (46%), Gaps = 63/488 (12%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            ++ K LH    FFD   +G +++R   D   + + +T      V++ +   V +     +
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELT----PYVESVVYNSVQLIATVLL 1191

Query: 278  SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQ--QSTGN--LTRVSEEQFNGIKTIKS 333
             + +T+  I+ A  +++     G    + SREL+  +ST    + +   E   G+ TI++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 334  FVAEGKEMRRYNTAVRR------LFNVAKR------EGITSATFF-SGTNVLGDVSFLLV 380
            +  E + M+   T +           VA R      + I S   F +G  VL +++    
Sbjct: 1252 YGDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGSLVIFGAGVLVLMNIN---- 1307

Query: 381  LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKK 440
                    +   L+  SLT  + +TE    S   L   YS +     +  R+ E  D ++
Sbjct: 1308 -------KIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQ 1356

Query: 441  SVPSTVGQTFV----PRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
              P + G   V    P +G+IE  D+S  Y P+ P  ++ K +  T+ P   V +VG +G
Sbjct: 1357 E-PYSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTG 1413

Query: 496  RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
             GKSTI + L RF D  +G I ID  DI+ +  K LRK + ++ Q+P L +GTI+ N+  
Sbjct: 1414 AGKSTIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDP 1473

Query: 556  GLSYTPSMDEIRAVAKKC--------------FCHNFITKFPDGYDTVIGPRGALLSGGQ 601
               Y    D+I    ++                    + KF +   + I   G+ LS GQ
Sbjct: 1474 YNEYND--DQIFKALRRVNLIVDGNLNSDVTSVSSENVNKFLN-LQSEISEGGSNLSQGQ 1530

Query: 602  RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
            RQ + +AR+L++ P I++LDEAT+++D  S+  I  T+      K+ TI++IAHRL ++ 
Sbjct: 1531 RQLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVI 1588

Query: 662  RSENIVVL 669
              + I+V+
Sbjct: 1589 DYDKILVM 1596

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 106/223 (47%), Gaps = 10/223 (4%)

Query: 455 GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSG 514
            +I  ++V+ S+  +      + L +    G    ++GP+G GK+++   LL       G
Sbjct: 696 NKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEG 755

Query: 515 TILIDGQD---ISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAK 571
            I +   D        +  L   +    Q   L++ T+++NI +   Y    +   AV  
Sbjct: 756 KITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEYNE--ERYLAVIS 813

Query: 572 KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVES 631
            C           G  T IG RG  LSGGQ+QRI++ARAL    K ++LD+  SA+D  +
Sbjct: 814 ACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHT 873

Query: 632 EGAI--NYTLGRLMRSKEITIVSIAHRLS-TIRRSENIVVLGN 671
              I  N  +G LM ++  T + ++H ++ T++ +E ++++ N
Sbjct: 874 AAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMIDN 914

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 139/508 (27%), Positives = 232/508 (45%), Gaps = 54/508 (10%)

Query: 222  TLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL-CGGVGVGMMFHISST 280
             LH    FFD   VG +++R   D   + + +   +   V   + C  + + ++      
Sbjct: 1082 VLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILLLIVVITPRF 1141

Query: 281  LTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTI----- 331
             + A+I+F     I     GK     SR+L++    +   + +   E   G+ TI     
Sbjct: 1142 FSVAVIVF-----ILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGVCTIRAFGD 1196

Query: 332  -KSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQ 390
             K F+ E  E    N       +VA +             VLG  SF+L   +    +  
Sbjct: 1197 EKRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGAFIVLGSGSFIL---FNIDNIDS 1253

Query: 391  GELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD--------YKKSV 442
            G L+  SLT  +L+T+    S   L   YS       +  RL E +         Y +  
Sbjct: 1254 G-LAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIVQEKYLGYDEDH 1308

Query: 443  PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIA 502
               +  +  P+ G+IE +++S  Y +     + K +   + P S V IVG +G GKSTI 
Sbjct: 1309 IQALNDSSWPKHGKIEVENLSLRYASN-LPLVLKNVCFKVDPQSKVGIVGRTGAGKSTII 1367

Query: 503  SLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTP- 561
            + L R  +  +G I ID QDISK+   +LR+ + ++ Q+PVL +GTI+ NI     Y   
Sbjct: 1368 AALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIKSNIDPHDEYDER 1427

Query: 562  ------------SMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIAR 609
                        S  E + V       N   KF +    ++   G  LS G+RQ + IAR
Sbjct: 1428 RIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV-EGGLNLSQGERQLLFIAR 1486

Query: 610  ALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK--EITIVSIAHRLSTIRRSENIV 667
            +L+++ KI++LDEATS++D +S+  I      ++RSK  + TI++IAHRL ++   + I+
Sbjct: 1487 SLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILTIAHRLRSVIYYDKIL 1542

Query: 668  VLGNDGSVIEAGKFADLYRDEDSELFKL 695
            V+ + G + E G   +L ++E S  +++
Sbjct: 1543 VM-DAGEIKEYGHPYELLKNERSTFYRM 1569

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 120/258 (46%), Gaps = 19/258 (7%)

Query: 449 TFVPRDGRIEFKDVSFSYPTRPTS-QIFK--KLRLTITPGSNVCIVGPSGRGKSTIASLL 505
           T  P   +IEFK  +  +         FK   L +  + G    ++G +G GKS +   L
Sbjct: 656 TISPDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSL 715

Query: 506 LRFYDANSGTILIDG----QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTP 561
           L   D  SG I+I G     D+       L        Q   L+S TI++NI +  SY  
Sbjct: 716 LGELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDK 774

Query: 562 SMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILD 621
           S    + V   C  +  +   P G  T IG +G  LSGGQ+QRI++ARA+    K ++LD
Sbjct: 775 S--RYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLD 832

Query: 622 EATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
           +  SA+D  +   I  N   G+LM+++  T + + H +    R+ +  ++  DG V   G
Sbjct: 833 DCLSAVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQG 890

Query: 680 KFADL-----YRDEDSEL 692
              +L     +++E ++L
Sbjct: 891 TIKELQKKGIFKEEIAQL 908

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 136/536 (25%), Positives = 245/536 (45%), Gaps = 74/536 (13%)

Query: 205  MLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAA 264
            +LG R   ++   ++ +TLH    FFD   +G +++R   D   V + +T  +     A 
Sbjct: 1132 VLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLE---AAF 1188

Query: 265  LCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIY--------GKRIRAISRELQQ---- 312
             C          +    T A+I F  P  ++  I         G    A SREL++    
Sbjct: 1189 FC---------LVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYMAASRELKRFESI 1239

Query: 313  STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVL 372
            S   + +   E   G+ TI+++  E + M         L N+ K +   +  FF      
Sbjct: 1240 SKSPIYQHFSETLVGVATIRAYGDESRFM---------LENLHKIDE-NNKPFFYLWVFN 1289

Query: 373  GDVSF-------LLVLAYGSHLV-----LQGELSLGSLTAFMLYTEYTGSSVFGLSNFYS 420
              +SF        ++   G  ++     +   ++  SLT  + +TE        L  FY+
Sbjct: 1290 RWLSFRIDMIGAFVIFGAGVFILTNIKNIDSGMAGISLTYAISFTE----GALWLVRFYA 1345

Query: 421  ELMKGAGAASRLFELTDYKKSVPSTVGQTFV----PRDGRIEFKDVSFSY-PTRPTSQIF 475
            ++     +  RL E  + ++        T +    P +G+IE KD+S  Y P  P  ++ 
Sbjct: 1346 DVEMNMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP--KVI 1403

Query: 476  KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535
            K +   + P + + IVG +G GKSTI + + RF +  SG I ID  +I+ ++   LR+ +
Sbjct: 1404 KNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSI 1463

Query: 536  GVVQQEPVLMSGTIRDNITYGLSYT-----PSMDEIRAVAKKCFCHN--------FITKF 582
             ++ Q+P L +GTI+ N+     +T      ++  +  V ++   +N           KF
Sbjct: 1464 TIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKF 1523

Query: 583  PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 642
             +  +  I   G+ LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+ + 
Sbjct: 1524 LN-LENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRK- 1581

Query: 643  MRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
                + TI++IAHRL ++   + I+V+ + G V E      L  D++S  + +  +
Sbjct: 1582 -EFSQSTILTIAHRLRSVIDYDKIIVM-DAGEVKEYDHPYSLLLDKNSNFYSMCEQ 1635

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 114/468 (24%), Positives = 212/468 (45%), Gaps = 46/468 (9%)

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI---SSTLTSAMIMFAP 290
            +G +I+ +  DA+ VS    + +   V+A +   V + +++ +   ++ + +A+I+   
Sbjct: 491 NLGAIINLMAVDAFKVSEICGY-LHFFVEAVIMVFVAITLLYKLLGYAAFVGAALIIACL 549

Query: 291 PL-LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEG------KEMRR 343
           PL L  AT  GK    + +E    T    +   E    I+ IK F  E       KE+R 
Sbjct: 550 PLNLKLATFLGK----LQKESLGFTDKRIQKLNETLQAIRIIKFFSWEDNFSRDIKEVRE 605

Query: 344 YNTAVRRLFNVAKREGI---TSATFFSGTNVLGDVSFLLVLAYGSHLVLQGEL--SLGSL 398
                + L  + KR  I   +S  +F   +++   SF        ++ +QGE+  +  + 
Sbjct: 606 -----KELHLLLKRSLIWAFSSFVWFVTPSIVTSASF------AFYIYVQGEVLTTPVAF 654

Query: 399 TAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG-RI 457
           TA  L+T    + +  LSN  S +++   +  R+ +    + +      Q  + + G RI
Sbjct: 655 TALSLFT-LLKTPLDQLSNMISFVIQSKVSLDRIQDFLGEQDT--DKYNQLTIDKLGNRI 711

Query: 458 EFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTIL 517
            FK+V+ ++         + L +   PG+   ++GP+G GK+++   LL       G I+
Sbjct: 712 AFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEII 771

Query: 518 IDG----QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKC 573
           +      QD+  +    L   +    Q   L++ T+R+NI +   Y    +   AV   C
Sbjct: 772 VPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFNSPYNE--ERYNAVIDAC 828

Query: 574 FCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 633
                +        T IG +G  LSGGQ+QR+++ARAL    K ++LD+  SA+D  +  
Sbjct: 829 GLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTAL 888

Query: 634 AI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
            I  N   G LM  +  T + ++H ++   ++  +VV+  +G V + G
Sbjct: 889 WIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVILENGRVKDQG 934

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 129/488 (26%), Positives = 226/488 (46%), Gaps = 57/488 (11%)

Query: 217  QVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFH 276
            +++ + ++    FFD   +G +++R   D  ++   +   + DGV +     V   M+  
Sbjct: 1138 KLLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFL-DGVFSCFIQAVTALMLIV 1196

Query: 277  ISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIK 332
                +T   ++ A  ++ ++   G      SREL++    S   + +   E  +G+ TI+
Sbjct: 1197 F---ITPKFLIIAIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIR 1253

Query: 333  SFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSF-------LLVLAYGS 385
            +F  E K ++     +             +  FF   +V   +SF       + V   G+
Sbjct: 1254 AFGNEIKFLKENLDFIDE----------NNKFFFYMWSVNSWLSFRIDLLGAITVFGSGA 1303

Query: 386  HLVLQGE-----LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKK 440
             ++L  +     L+  SLT  + +TE+       +  FYS +     +  RL E  + ++
Sbjct: 1304 FILLNADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYMEIEE 1359

Query: 441  SVPSTVGQTF----VPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
               +  G        P  G I F + S  Y P  P   + K+L L I  GS + +VG +G
Sbjct: 1360 EALADPGAITPSENWPVQGAITFANYSLRYAPKLP--DVLKQLNLKIDGGSKIGVVGRTG 1417

Query: 496  RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
             GKSTI S L RF D +SG ILID  DIS+++ + LR  L ++ Q+P L  GTIR N+  
Sbjct: 1418 AGKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDP 1477

Query: 556  GLSYT-----PSMDEIRAVAKKCFCH-NFITKFPDGY--------DTVIGPRGALLSGGQ 601
               Y       ++ ++  + +    + N+       Y        D+ I   G  LS GQ
Sbjct: 1478 NEEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQ 1537

Query: 602  RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
            RQ I +AR+++   KI++LDEAT+++D +S+  +  T+      K  TI++IAHR+ ++ 
Sbjct: 1538 RQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVI 1595

Query: 662  RSENIVVL 669
              + I+VL
Sbjct: 1596 DYDKILVL 1603

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 115/474 (24%), Positives = 211/474 (44%), Gaps = 48/474 (10%)

Query: 236 GDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISST---LTSAMIMFAPPL 292
           G +I+ + +DA  V   + + +   ++A +   V V +++ I  T   + +A+I+F  P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIPF 554

Query: 293 LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLF 352
            +  T   K I    RE    T    +   E F  I+ IKSF  E   +++      +  
Sbjct: 555 NVFLT---KLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWENNIIQKILGLRNKEI 611

Query: 353 NVAKREGIT----SATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYT 408
           +V KR  IT    +  ++    ++  +SF       S+ +L  +  L +  AF      T
Sbjct: 612 SVLKRNSITWSINALVWYLSPTIITTLSF-------SYYILVDKQDLTTPVAF------T 658

Query: 409 GSSVFGL--------SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFK 460
             ++F L        SN  + L +   +  R+ +    K++       +      R+ F 
Sbjct: 659 ALALFNLLKAPLDQLSNTINFLTQSKVSLDRIEKFLSVKETTKFE-NLSVDSSQNRLAFS 717

Query: 461 DVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG 520
             +  +     S   + +      G    ++GP+G GK+++   LL      SG + +  
Sbjct: 718 GATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPN 777

Query: 521 QDISKVS----AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
            + SK +    + +L   +    Q P + + TIR+NI + + Y    D    V   C   
Sbjct: 778 LE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYDK--DRYENVVIACGLE 834

Query: 577 NFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 636
                   G  T++G +G+ LSGGQ+QRI++ARAL  K + LILD+  SA+D  S   I 
Sbjct: 835 RDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWI- 893

Query: 637 YTL---GRLMRSKEITIVSIAHRLS-TIRRSENIVVLGNDGSVIEAGKFADLYR 686
           Y +   G LM+ +  T + ++H +S TI+++  + ++ N G ++ +G+  DL +
Sbjct: 894 YNVCITGPLMQGR--TCILVSHNVSLTIKKASKVFMIEN-GYIVASGRPIDLIK 944

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 128/495 (25%), Positives = 225/495 (45%), Gaps = 52/495 (10%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            ++KK L+    FFD    G +++R   D   +   +     +G  A+L   +   ++   
Sbjct: 1163 LLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIP-FFEGAFASLVQCITTILLI-- 1219

Query: 278  SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKS 333
               +T   + FA  + ++  I G      SRELQ+    +   + +   E   G+ TI++
Sbjct: 1220 -GYITPVFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRA 1278

Query: 334  FVAE----GKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL 389
            F  E       + + +T  R  F +     +T+       + +G     ++LA G  ++L
Sbjct: 1279 FGDERRFLADNLSKVDTHNRPFFYL----WVTNRWLAFRIDFIGA---FVILASGIFILL 1331

Query: 390  Q-GELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPST--- 445
                L  G     ++Y          L   YS +     +  RL E    ++  PST   
Sbjct: 1332 NVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQE-PSTGLY 1390

Query: 446  VGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLL 505
                  P  G+IE  ++S  Y +    ++ K +  T+ P S V IVG +G GKSTI + L
Sbjct: 1391 EPPPEWPDRGKIEVNNLSLRYASN-LPKVIKNVTFTVEPQSKVGIVGRTGAGKSTIITAL 1449

Query: 506  LRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT----- 560
             RF D ++GTI +D  DI+ +  K LR+ + ++ Q+PVL +GTI+ N+     Y      
Sbjct: 1450 FRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDRIF 1509

Query: 561  PSMDEIRAVAKKCFC------------HNFITKFPDGYDTVIGPRGALLSGGQRQRIAIA 608
             ++  +  + ++                  + KF D   + I   G+ LS GQRQ + +A
Sbjct: 1510 EALKRVNLIVQEELTPTDIPSSSSSLSFENVNKFLD-LTSEITEGGSNLSQGQRQLVCLA 1568

Query: 609  RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVV 668
            R+L++ PK ++LDEAT+++D  S+  I  T+         TI++IAHRL +I   + ++ 
Sbjct: 1569 RSLLRNPKAILLDEATASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKVL- 1625

Query: 669  LGNDGSVIEAGKFAD 683
                  VI++G+ A+
Sbjct: 1626 ------VIDSGELAE 1634

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 101/469 (21%), Positives = 205/469 (43%), Gaps = 37/469 (7%)

Query: 234 KVGDLISRLGSDAYIVSR--SMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPP 291
            +G +I+ +  D+  VS+  +  H + + V  A+   V +  +   S+ + +  I+   P
Sbjct: 493 NLGAIINLMAVDSIKVSQVSAYIHMLLESVVMAIVAMVLLYRLLGWSALVGATFIICILP 552

Query: 292 LLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRL 351
           + +    +  ++  +  +    T    +   E    I+ IK F  E K    + + V+++
Sbjct: 553 INLR---FATKLGELQEDALACTDRRIQKLNETLQAIRIIKFFAWEDK----FESDVQKI 605

Query: 352 ----FNVAKRE----GITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFML 403
                +V  R      ++S  ++    ++   SF  V  Y    VL   ++  +L+ F+L
Sbjct: 606 REMELSVMLRRVVVWSLSSFVWYITPTLVASASFC-VYIYVQGEVLTTPVAFTALSLFVL 664

Query: 404 YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVS 463
                 + +  L +    L++ + +  R+    D  ++      Q  V +D R+ F + +
Sbjct: 665 LR----NPLDQLCDIVFSLVQCSVSLRRIQNFLDQDET--PKYRQLTVKKD-RLGFSNAT 717

Query: 464 FSYPTRPTSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG-- 520
             +     +    K L +    G    IVGP+G GK+++   LL   + + G I +    
Sbjct: 718 IGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALN 777

Query: 521 --QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNF 578
             +D+  V A  +   +G   Q   L++ T+R+NI +   Y    +   AV   C     
Sbjct: 778 PREDLV-VDADGMTDSIGYCSQSAWLLNDTLRNNILFSAPY--EANRYNAVIHACGLTRD 834

Query: 579 ITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--N 636
           +     G  T +G +G  LSGGQ+QR+++ARA+  + + ++LD+  SA+D  +   I  +
Sbjct: 835 LEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKH 894

Query: 637 YTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
              G LM  +  T V ++H  +   ++ + VV+  +  V   G+  +L+
Sbjct: 895 CITGPLMEGR--TCVLVSHNTALTLKNADWVVILENAKVTAQGEPLELF 941

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 139/527 (26%), Positives = 227/527 (43%), Gaps = 52/527 (9%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNIS--- 258
            LL +   R   +L   +    L     FF+   VG +I+R  SD   V  ++ + IS   
Sbjct: 1038 LLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRIINRFSSDMNSVDDNVQYVISFFL 1097

Query: 259  ----DGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQST 314
                D V   +  G  V +   +++ L    + +          Y    R + R +  S 
Sbjct: 1098 ISILDYVVVVVIIGYQVPLFLLVNAALLGIYLYYQ-------VFYVTLSRELKRLMSTSF 1150

Query: 315  GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNV-AKREGITSATFFSGTNV-- 371
              +  +  E   G   I +F        R++       N+ A +  I     F  TN   
Sbjct: 1151 SPIMSMLSETLAGHMVINAF----NHFSRFD-----YLNIEAVQFNINCVFNFRSTNRWL 1201

Query: 372  ---LGDVSFLLVL--AYGSHLVLQGE--LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMK 424
               L  +  L++L  A  S     G+  LS G +   M Y     + +  +     +L  
Sbjct: 1202 SIRLESIGALMILTTALLSLATTTGDKALSTGMVGLLMSYALQVTNKLMWIVRMSVQLET 1261

Query: 425  GAGAASRLFELTDYKKSVPSTVG----QTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRL 480
               +  R+ E  D     P  +     +   P  G + FKD S  Y       + KKL +
Sbjct: 1262 NVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSARY-RENLDPVLKKLNV 1320

Query: 481  TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
             I P   + IVG +G GKST++  L R  +   GTI+IDG DI+K+    LR HL ++ Q
Sbjct: 1321 EINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDITKIGLADLRSHLSIIPQ 1380

Query: 541  EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDG---------YDTVIG 591
            +     G++R N+     Y  S DEI    +       I K  +           +T I 
Sbjct: 1381 DAQAFEGSVRSNLDPFEQY--SDDEIWRALELSHLKPHILKMANEEGPEKTKNLLETKIS 1438

Query: 592  PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
              G+ LS GQRQ + ++RAL+ + +IL+LDEAT+A+D E++  I  T+    + +  TI+
Sbjct: 1439 ENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEFKDR--TIL 1496

Query: 652  SIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            +IAHR+ T+  S+ I+VL + G V E    ++L  D+++  + L ++
Sbjct: 1497 TIAHRIDTVMDSDKIMVL-DQGEVKEFDSPSNLLADKNTIFYNLCSQ 1542

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 106/462 (22%), Positives = 207/462 (44%), Gaps = 63/462 (13%)

Query: 267 GGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFN 326
           G V + +MF I+S L+                  ++I+ + ++  +      +   E  N
Sbjct: 443 GVVIMAVMFPINSYLS------------------RKIKVLIKKQMEYKDARIKTVTEILN 484

Query: 327 GIKTIKSFVAEGKEMRRYNTAVR---RLFNVAKREGITSATFFSGTNV--LGDVSFLLVL 381
            +KT+K +  E   ++R +  VR    L +  K   + + T F+   V  L   S  L+ 
Sbjct: 485 SVKTVKLYAWEEPMLKRLD-HVRNELELESFKKIAVMNNLTLFAWNCVPILVASSTFLIY 543

Query: 382 AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
           A    + L  ++   SL+ F    +     ++ +       ++   +  RL +    K+ 
Sbjct: 544 ALVMDVPLTPQIVFPSLSLF----DILNDCIYTIPRTIINFIETGVSMGRLKDFLLAKEL 599

Query: 442 VPSTVGQTFVPRDGR---IEFKDVSF--SYPTRPTSQ-------IFKKLRLTIT------ 483
             S +    +P D     IE  + +F  + PT+ TS+       + +  R+ +       
Sbjct: 600 DKSFIEFESLPDDPNVPVIEVHNATFLRNLPTKATSEENYDEEAMIESSRVALKNIDGFQ 659

Query: 484 --PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
              G  VC+VG  G GKST    LL      S +     Q   K+  +     + +  Q+
Sbjct: 660 ALKGQLVCVVGRVGAGKSTFLHALLGQLPCISSS---HDQATPKMHFRC--DSVALCSQQ 714

Query: 542 PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
             +++ +++ N+ +G  Y  +    +A  + C     +    DG +T++G +G  LSGGQ
Sbjct: 715 AWILNASVKYNVLFGHKYDEA--SYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQ 772

Query: 602 RQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSKEITIVSIAHRL 657
           + RI++ARA+  +  + +LD+  SA+D E  +  I++ L R   L+++K  T++   + +
Sbjct: 773 KARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNK--TVILTTNSI 830

Query: 658 STIRRSENIVVLGNDGSVIEAGKFADLY-RDEDSELFKLLNE 698
           S ++ S++I  L N G ++E G F ++  +D +S+L  L+ E
Sbjct: 831 SVLKHSQSIYALEN-GEIVERGSFDEIMSKDAESKLKTLIAE 871

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 128/496 (25%), Positives = 218/496 (43%), Gaps = 62/496 (12%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL--CGGVG 270
            ++   ++K +LH    FFD   +G +++R   D   V + +   +  G  A L  C  + 
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLG-GTFACLVECFSII 1227

Query: 271  VGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKT 330
            V ++  I+       I  A        +Y    R + R    +   + +   E   GI T
Sbjct: 1228 V-LITLITPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITT 1286

Query: 331  IKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSG---------TNVLGDVSFLLVL 381
            ++++  E + MR          N+ K +      F+           T ++G  +F+++ 
Sbjct: 1287 VRAYGDESRFMRE---------NLEKIDENNKPFFYMWVSNRWLSFRTQIIG--AFVILG 1335

Query: 382  AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
            A G  +    ++  G     + Y      +   L  FY +      +  R+ E  +  + 
Sbjct: 1336 AGGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQE 1395

Query: 442  VPSTVGQTFVPRD----GRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGR 496
             P   G    P D    G+IE  DVS  Y P  P  ++ K +  T+   S V IVG +G 
Sbjct: 1396 -PYNEGTVEPPADWPENGKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGA 1452

Query: 497  GKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYG 556
            GKSTI + L RF +  +G I ID  DI  +  + LR+ + ++ Q+P L +GTIR N+   
Sbjct: 1453 GKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLD-- 1510

Query: 557  LSYTPSMDEIRAVAKKCFCHNFITK-------FPDGYDTV----------------IGPR 593
              YT   D  + +     C N +++        P   DT                 +   
Sbjct: 1511 -PYTQYSD--KEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSEG 1567

Query: 594  GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSI 653
            G+ +S GQRQ + +AR+L+ KPKI++LDEAT+++D ES+  I  T+     +   TI++I
Sbjct: 1568 GSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFGNS--TILTI 1625

Query: 654  AHRLSTIRRSENIVVL 669
            AHRL ++   + I+V+
Sbjct: 1626 AHRLRSVIDYDKILVM 1641

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 128/530 (24%), Positives = 221/530 (41%), Gaps = 77/530 (14%)

Query: 198 GRMFLLKM----LGERLVARLRAQVIKKT-----------------LHHDAEFFDRNKVG 236
           GR   ++M    + E  +  LR Q+I KT                 +  D E      VG
Sbjct: 481 GRRICIRMRSIIISEIYIKALRRQIITKTKKSTDEVDPEQLNEDSKIDGDEESTASANVG 540

Query: 237 DLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAA 296
            +I+ +  DA+ V+    + +   +   +   V + ++F++   L SA  + A  +++  
Sbjct: 541 AIINLIAVDAFKVAEIGAY-LHTFIGTIIMTFVSIYLLFNL---LGSAAFIGALTIIVLI 596

Query: 297 TIYGKRIRAISRELQQSTGNLT--RVSE--EQFNGIKTIKSFVAEGK-EMRRYNTAVRRL 351
            +   +I      LQQ     T  R+ +  E F  I+ IK F  E   E   +      L
Sbjct: 597 PV-NYKIANWLGNLQQKNLKTTDKRIQKLNETFQAIRIIKFFSWEKNFENDIHKIREEEL 655

Query: 352 FNVAKR---EGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYT 408
           + +  R      ++  FF    ++  +SF    AY  ++ +Q +  L S  AF      T
Sbjct: 656 YILLLRCLVWSFSTFIFFISPTIVTSLSF----AY--YIFIQKQ-ELTSPVAF------T 702

Query: 409 GSSVFGL--------SNFYSELMKGAGAASRLFELTDYKKSVPST--VGQTFVPRD-GRI 457
             S+F L        +N  S +++   +  R+    D     P T    Q  VP +  ++
Sbjct: 703 ALSLFALLKIPLDQMANMLSYVVQSKVSLDRVQTFLD----EPDTKKYEQLTVPVEKNKL 758

Query: 458 EFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTIL 517
            FK+ + S+     S   + L +    G    ++GP+G GK+++   LL       G I 
Sbjct: 759 SFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQIN 818

Query: 518 IDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVA---K 571
           I   D      + +      +    Q   L++ T+R+NI +   Y     +   VA   K
Sbjct: 819 IPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIVAAGLK 878

Query: 572 KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVES 631
           + F          G  T IG RG  LSGGQ+QRI++ARAL    + ++LD+  SA+D  +
Sbjct: 879 RDF-----EILAAGDLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHT 933

Query: 632 EGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
              I  N   G LM  +  T V ++H ++   ++ ++VV+  +G V + G
Sbjct: 934 AAWIYDNCISGPLMEGR--TCVLVSHNIALTLKNASLVVMLKNGRVADQG 981

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 242/531 (45%), Gaps = 74/531 (13%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            ++   ++   LH    FFD   +G +++R   D   V + +T  +     A  C    V 
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLE---AAFYCLVECVS 1215

Query: 273  MMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGI 328
             M  I+  +T   ++ A  +     + G    A SREL++    +   + +   E   GI
Sbjct: 1216 TMLLIA-FITPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGI 1274

Query: 329  KTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSF-------LLVL 381
             TI+++  E + M         L N+ K +   +  FF        +SF       L+V 
Sbjct: 1275 VTIRAYGDEKRFM---------LENLHKIDE-NNKPFFYLWAFNRWLSFRIDMIGSLVVF 1324

Query: 382  AYGSHLVLQGE-----LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT 436
              G  ++L  +     L+  SLT  + +TE    +   L  FY+++     +  RL E  
Sbjct: 1325 GAGVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYM 1380

Query: 437  D-----YKKSV--PSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNV 488
            +     Y++ +     +     PR+G+IE  ++S  Y P  P  ++ K +   + P   V
Sbjct: 1381 EIDQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKV 1438

Query: 489  CIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGT 548
             +VG +G GKSTI + L RF DA +G I ID  DI+ V+   LR+ + ++ Q+P L SGT
Sbjct: 1439 GVVGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGT 1498

Query: 549  IRDNITYGLSYTPSMDEIRAVAKKCFCHNFI---------------------TKFPDGYD 587
            IR N+     Y    D+  A+ K     N I                      KF +  +
Sbjct: 1499 IRSNLD---PYNEFSDD--AIFKALRRVNLINENESTGPASSETSPSSTENVNKFLNLKN 1553

Query: 588  TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647
              I   G  LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +    KE
Sbjct: 1554 E-ITEGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRK--EFKE 1610

Query: 648  ITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
             TI++IAHRL ++   + I+V+ + G V E      L  +++S  + +  +
Sbjct: 1611 STILTIAHRLRSVCDYDKILVM-DAGEVKEYDHPYSLLLNKNSIFYSMCEQ 1660

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 113/462 (24%), Positives = 219/462 (47%), Gaps = 34/462 (7%)

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI---SSTLTSAMIM-FA 289
            +G +I+ +  DA+ VS    + +   V+A L   V + +++H+   ++ +  A+++ F 
Sbjct: 511 NLGAIINLMAVDAFKVSEICGY-LHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFL 569

Query: 290 PPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA-- 347
           P  L  AT+ G+  +   + L  +   + +++E  F  I+ IK F  E    R   T   
Sbjct: 570 PLNLKLATLLGEYQK---KSLAVTDKRIQKLNE-TFQAIRIIKYFSWEDNFTRDIETVRE 625

Query: 348 --VRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYT 405
             +  LF  +     +S  +F   +++   SF        ++ +QGE +L +  AF   +
Sbjct: 626 KELHLLFKRSLIWAFSSFIWFITPSIVTSCSF------AFYIYVQGE-TLTTPVAFTALS 678

Query: 406 EYT--GSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDG-RIEFKDV 462
            +T   + +  LSN  S +++   +  R+ +L   K++      Q  + ++G RI F++ 
Sbjct: 679 LFTLLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKET--EKYSQLTIDKNGNRIAFQNA 736

Query: 463 SFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILI---D 519
           + ++  + +    + L +   PG    ++GP+G GKS++   LL      +G I++   D
Sbjct: 737 TVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIVPSLD 796

Query: 520 GQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFI 579
            +D   +    +   +    Q   L++ T+R+NI +   Y  +     AV + C      
Sbjct: 797 PRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEA--RYNAVVEACCLKRDF 854

Query: 580 TKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NY 637
                G  T IG +G  LSGGQ+QR+++ARAL    + ++LD+  SA+D  +   I  N 
Sbjct: 855 EILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALWIYDNC 914

Query: 638 TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
             G LM ++  T + ++H ++   R+  +VV+  DG V + G
Sbjct: 915 ITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 140/522 (26%), Positives = 230/522 (44%), Gaps = 65/522 (12%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL-CGGVGVGMMFH 276
            ++ K LH    FFD    G +++R   D   + + +T  I     + + C    + + F 
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 277  ISSTLTSAMIM-----FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331
                L+ A+++     F     +A +   KR  +ISR        + +   E   G+ TI
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISR------SPIYQHFSETLVGVTTI 1254

Query: 332  KSFVAEGKEMRRY------NTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGS 385
            ++F  EG+ M+        N        VA R             + G   F+L      
Sbjct: 1255 RAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINN- 1313

Query: 386  HLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYK------ 439
               L   ++  SLT  + +TE        L   YSE+     +  R+ E  + +      
Sbjct: 1314 ---LDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNE 1366

Query: 440  -KSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRG 497
             K +P        P+DG+IE  D+S  Y P  P  ++ K +  ++   S + IVG +G G
Sbjct: 1367 HKEIPPPQW----PQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAG 1420

Query: 498  KSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN----- 552
            KSTI + L RF +  +G I ID  DIS V  + LR+ + ++ Q+P L SGTI+ N     
Sbjct: 1421 KSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYD 1480

Query: 553  ------ITYGLSYTPSMDE-------IRAVAKKCFCHNF--ITKFPDGYDTVIGPRGALL 597
                  I   L     + E        R  + +    N   + KF D   + I   G+ L
Sbjct: 1481 EFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLD-LSSEISEGGSNL 1539

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            S GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  +    TI++IAHRL
Sbjct: 1540 SQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRL 1597

Query: 658  STIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
             ++   + I+V+ + G V E      L  ++ S  + +  EH
Sbjct: 1598 RSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQSAFYSMC-EH 1637

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 112/479 (23%), Positives = 209/479 (43%), Gaps = 30/479 (6%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISS 279
           +K+++ D E      +G +I+ +  DA+ VS    + +   ++A +   V + +++ +  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSEICGY-LHSFLEAFVMTVVALALLYRLLG 518

Query: 280 TLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGK 339
                 ++    +L       K I  + ++    T N  +   E F  I+ IK F  E  
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN 578

Query: 340 EMRRYNT----AVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGEL-- 393
             +  NT     +  L   +    I+S  +F    ++   SF    AY  ++ +QGE+  
Sbjct: 579 FEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASF----AY--YIYVQGEVLT 632

Query: 394 SLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFEL---TDYKKSVPSTVGQTF 450
           +  + TA  L+T      +  LS+  S +++   +  R+ +     D KK    T+    
Sbjct: 633 TPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDTKKYDQLTID--- 688

Query: 451 VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK-STIASLLLRFY 509
            P   R  F++ + S+         K L +    G    ++GP+G GK S + +LL   Y
Sbjct: 689 -PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMY 747

Query: 510 DANSGTIL--IDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR 567
             N   ++  ++ +    V A      +    Q   L++ T+++NI +   +  +    +
Sbjct: 748 LLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEA--RYK 805

Query: 568 AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627
           AV + C           G  T IG +G  LSGGQ+QR+++ARAL    + ++LD+  SA+
Sbjct: 806 AVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAV 865

Query: 628 DVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
           D  +   I  N   G LM  +  T + ++H ++   R+  +VVL  DG V + G   D+
Sbjct: 866 DSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 151/542 (27%), Positives = 230/542 (42%), Gaps = 84/542 (15%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  +L  +G      L  + +K+ LH    + D   +G +++R   D   +   +T ++
Sbjct: 951  GQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1010

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG----------KRIRAIS 307
               + +     VGV +M  +     +  I   P LL+   +            KR+ A+ 
Sbjct: 1011 R-LMTSQFANIVGVCVMCIVYLPWFAIAI---PFLLVIFVLIADHYQSSGREIKRLEAVQ 1066

Query: 308  RELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS 367
            R    +  N      E   G+ TIK++    +   R+      L N     G        
Sbjct: 1067 RSFVYNNLN------EVLGGMDTIKAY----RSQERFLAKSDFLINKMNEAGYLVVVLQR 1116

Query: 368  GTNVLGD---VSFLLVL--------------AYGSHL--VLQGELSLGSLTAFMLYTEYT 408
               +  D   ++F L++              + G  L  VLQ    L ++   M  TE  
Sbjct: 1117 WVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTEND 1176

Query: 409  GSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-P 467
             +S   L  + +EL   A           Y+K  P        P  G I F++V F+Y P
Sbjct: 1177 MNSAERLVTYATELPLEAS----------YRK--PEMTPPESWPSMGEIIFENVDFAYRP 1224

Query: 468  TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVS 527
              P   + K L L I  G  + I G +G GKSTI S L R  +  +G ILID  DIS++ 
Sbjct: 1225 GLPI--VLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLG 1282

Query: 528  AKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR-------AVAKKCF------ 574
               LR+ L ++ Q+PVL  GTIR N+      T   DE+        A+AK         
Sbjct: 1283 LFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTD--DELWDALVRGGAIAKDDLPEVKLQ 1340

Query: 575  ------CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALD 628
                   H  + KF    D  +   G+  S G+RQ +A+ RAL+++ KILILDEATS++D
Sbjct: 1341 KPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVD 1398

Query: 629  VESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
             E++G I   +  +    + TI+ IAHRL TI   + I+VL   G V E      L+  E
Sbjct: 1399 YETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEFDTPWTLFSQE 1455

Query: 689  DS 690
            DS
Sbjct: 1456 DS 1457

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 107/224 (47%), Gaps = 27/224 (12%)

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
           RDG  + +  SF        + FK L   I  G  + I GP G GKS++ + +       
Sbjct: 590 RDGPEDLEKTSF--------RGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKT 641

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572
            G + ++G D+             ++   P + + ++RDNI +G  +    ++   V + 
Sbjct: 642 DGKVEVNG-DL-------------LMCGYPWIQNASVRDNIIFGSPFNK--EKYDEVVRV 685

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-S 631
           C     +   P G  T IG RG  LSGGQ+ RI +AR++ KK  I + D+  SA+D    
Sbjct: 686 CSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVG 745

Query: 632 EGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSV 675
           +  ++  L  ++ +K  T +   H+LS I R+  ++VLG DG V
Sbjct: 746 KHIMDECLTGMLANK--TRILATHQLSLIERASRVIVLGTDGQV 787

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 145/536 (27%), Positives = 229/536 (42%), Gaps = 65/536 (12%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  +L  +G      L  + +++ LH    + D   +G +++R   D   +   +T ++
Sbjct: 951  GQFTILCAMGIMASKCLNLRAVRRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESL 1010

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG----------KRIRAIS 307
               + +     VGV +M  +     +  I   P LL+   +            KR+ A+ 
Sbjct: 1011 R-LMTSQFANIVGVCVMCIVYLPWFAIAI---PFLLVVFVLIADHYQSSGREIKRLEAVQ 1066

Query: 308  RELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFS 367
            R    +  N      E   G+ TIK++    +   R+      L N     G        
Sbjct: 1067 RSFVYNNLN------EVLGGMDTIKAY----RSQERFLAKSDFLINKMNEAGYLVVVLQR 1116

Query: 368  GTNVLGDV-----SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSEL 422
               +  D+     + ++ L   +        S+G L  ++L      +++          
Sbjct: 1117 WVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTEND 1176

Query: 423  MKGA----GAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKK 477
            M  A      A++L    DY+K  P        P  G+I F++V F+Y P  P   + K 
Sbjct: 1177 MNSAERLVSYATKLPLEADYRK--PEMTPPESWPSKGKIVFENVDFAYRPGLPI--VLKN 1232

Query: 478  LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
              L I  G  + I G +G GKSTI S L R  +  +G I ID  DIS++    LRK L +
Sbjct: 1233 FNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAI 1292

Query: 538  VQQEPVLMSGTIRDNITYGLSYTPSMDEIR-------AVAKKCF------------CHNF 578
            + Q+PVL  GTIR N+      T   DE+        A+AK                H  
Sbjct: 1293 IPQDPVLFRGTIRKNLDPFDERTD--DELWDALVRGGAIAKNDLPEVRLQKPDENGTHGR 1350

Query: 579  ITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT 638
            + KF    D  +   G+  S G+RQ +A+ RAL+++ KILILDEATS++D E++G I   
Sbjct: 1351 MHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTR 1408

Query: 639  LGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFK 694
            +  +    + TI+ IAHRL TI   + I+VL   G V E      L+  EDS +FK
Sbjct: 1409 I--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAEYDTPWALFSQEDS-IFK 1460

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 107/225 (47%), Gaps = 29/225 (12%)

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
           RDG  + +  SF        + FK L   I  G  + I GP G GKS++ + +       
Sbjct: 590 RDGPEDLEKTSF--------RGFKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKV 641

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS-MDEIRAVAK 571
            G I ++G D+             ++   P + + T+RDNI +G  +     DE+  V  
Sbjct: 642 DGKIEVNG-DL-------------LMCGYPWIQNATVRDNIIFGSPFNKEKYDEVIHV-- 685

Query: 572 KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE- 630
            C     +   P G  T IG RG  LSGGQ+ RI +AR++ KK  I + D+  SA+D   
Sbjct: 686 -CSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRV 744

Query: 631 SEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSV 675
            +  ++  L  ++ +K  T +   H+LS I R+  ++VLG DG V
Sbjct: 745 GKHIMDECLTGMLSNK--TRILATHQLSLIERASRVIVLGTDGKV 787

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  135 bits (341), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 139/499 (27%), Positives = 217/499 (43%), Gaps = 72/499 (14%)

Query: 217  QVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGV-GVGMMF 275
            +++ K LH    FFD   +G +++R   D             +G+   L     G    F
Sbjct: 1133 KLLDKVLHAKLRFFDSTPIGRIMNRFSKDM------------EGIDQDLAPYFQGAFYSF 1180

Query: 276  HISSTLTSAMIMFAPPLLIAATIYGKRIRAI-------SRELQQ----STGNLTRVSEEQ 324
                T    +    P  L  A I G     I       SREL++    +   + +   E 
Sbjct: 1181 IECITTIILITFITPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSET 1240

Query: 325  FNGIKTIKSFVAEGKEMR----RYNTAVRRLFN--VAKREGITSATFFSGTNVLGDVSFL 378
              G+ TI++F  E + +R    + +   R  F   VA R             V G   F+
Sbjct: 1241 LVGVTTIRAFGDESRFLRENLLKIDENNRPFFYLWVANRWLSFRIDVIGALVVFGSGIFI 1300

Query: 379  LVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDY 438
            L      + +  G   + SLT  + +TE        L  FYSE+     +  R+ E    
Sbjct: 1301 LT---NINTIDSGMAGI-SLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTI 1352

Query: 439  KKSVPS--TVGQTFVPRD----GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVG 492
            ++       V  + VP D    GRIE  D+S  Y      ++ K +   + P + V +VG
Sbjct: 1353 EQEPYDEVQVSDSKVPADWPEEGRIEVSDLSLRYAAH-LPKVIKNVTFNVDPRAKVGVVG 1411

Query: 493  PSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN 552
             +G GKSTI + L RF +A +G I IDG DI+ V+   LR+ + ++ Q+P L SGTI+ N
Sbjct: 1412 RTGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSN 1471

Query: 553  ITYGLSYTPSMDE-----IRAVA----------------KKCFCHNFITKFPDGYDTVIG 591
            +     Y    DE     +R V                 +       I +F D  ++ I 
Sbjct: 1472 LD---PYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIA 1527

Query: 592  PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
              G   S GQRQ I +AR+L++ PKIL+LDEAT+++D +S+  +  T+       E TI+
Sbjct: 1528 EGGTNFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIR--TEFSESTIL 1585

Query: 652  SIAHRLSTIRRSENIVVLG 670
            +IAHRL ++   + I+V+G
Sbjct: 1586 TIAHRLRSVIDYDKILVMG 1604

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 110/481 (22%), Positives = 201/481 (41%), Gaps = 44/481 (9%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISS 279
           K+ ++ D E     K+G +I+ +  D++ +S          + A L   +G  +M  ++ 
Sbjct: 467 KENINGDEESIPSAKLGAVINLMAVDSFKISE---------ICAYLHLFIGAIVMVVVAL 517

Query: 280 TLTSAMIMFAP-----PLLIAATI---YGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331
           TL   +I +A       +LI   I       +  + RE    T    +   E F  I+ I
Sbjct: 518 TLLFKLIGYAAFVGVLVILIVLPINFYLANWLGRLQRESLAFTDKRIQKLNETFQAIRII 577

Query: 332 KSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQG 391
           K F  E       +       N+     I+ A   SG       S +   ++  ++ +QG
Sbjct: 578 KFFSWEDNFSSDIDKIREGELNLLLWRAISWA--ISGFVWYLTPSIVTTASFTFYIYVQG 635

Query: 392 ELSLGSLTAFMLYTEYTGSSVFGL--------SNFYSELMKGAGAASRLFELTDYKKSVP 443
           E+ L +  AF      T  S+F L        S+  S +++   +  R+ +  + ++   
Sbjct: 636 EV-LTTPVAF------TALSLFSLLRDPLDRLSDMLSFVIQSKVSLDRVQDFLN-EEDTD 687

Query: 444 STVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIAS 503
                T      +I FK+ + ++     S   + L +    G    I+GP+G GK+++  
Sbjct: 688 KYNQLTVATNKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLM 747

Query: 504 LLLRFYDANSGTILIDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
            LL   +   G I++   +      V +      +    Q   L++ T+R+NI +   Y 
Sbjct: 748 ALLGEMNLLEGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYN 807

Query: 561 PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620
            +      V + C           G  T IG +G  LSGGQ+QRI++ARAL    + ++L
Sbjct: 808 ET--RYHNVVEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLL 865

Query: 621 DEATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678
           D+  SA+D  +   +  N   G LM  +  T + ++H ++   R+ ++VV+  DG V + 
Sbjct: 866 DDCLSAVDAHTALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQ 923

Query: 679 G 679
           G
Sbjct: 924 G 924

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 136/518 (26%), Positives = 225/518 (43%), Gaps = 73/518 (14%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGV-----GVGMMFHISSTLTS 283
            FF+   +G +++R  SD   +   + +  S   ++ L   V     G  + + I+     
Sbjct: 1072 FFETTPIGRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVL 1131

Query: 284  AMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEGK 339
             MI F          Y      +SREL++    S   +  +  E   G   I +F     
Sbjct: 1132 IMIYFY---------YQAYYIMLSRELKRLTTISYSPIMSLISETLGGFSVINAF----D 1178

Query: 340  EMRRYNTAVRRLFNVAKREGITSATF-FSGTNV-----LGDVSFLLVLAYG----SHLVL 389
               R+N      FN    +      F F  TN      L  +  L++LA G    + L  
Sbjct: 1179 HTSRFN-----FFNFETVQYNIDCVFQFRSTNRWLSVRLQTIGNLIILATGLLSFATLGT 1233

Query: 390  QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQT 449
            + +LS G +   M Y+    SS+  +     ++     +  R  E  + K      +  +
Sbjct: 1234 KKQLSSGMVGLLMSYSLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENS 1293

Query: 450  F----VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLL 505
                  PR+G IEF + +  Y       + K + ++I P   + IVG +G GKST+   L
Sbjct: 1294 RPPEGWPREGAIEFNNYTTKY-RENLDPVLKDINVSIKPKEKIGIVGRTGAGKSTLTLAL 1352

Query: 506  LRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE 565
             R  +A  G+I IDG DISK+  + LR +L ++ Q+     GTIR N+     +    DE
Sbjct: 1353 FRLIEATGGSISIDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNLD---PFDQHSDE 1409

Query: 566  --IRAVAKKCFCHNFI-----------------TKFPDGYD------TVIGPRGALLSGG 600
               RAV       + +                    PD ++      T I   G+ +S G
Sbjct: 1410 ELWRAVELSHLKQHILRMNEEANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVG 1469

Query: 601  QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
            QRQ + ++RAL+   K+LILDEAT+A+D+E++  +  T+      KE TI++IAHR+ T+
Sbjct: 1470 QRQLLCLSRALLNPSKVLILDEATAAIDMETDKIVQDTIKN--EFKERTILTIAHRIDTV 1527

Query: 661  RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
               + I+VL + G V E    ++L  D+++  +KL  +
Sbjct: 1528 MNYDKILVL-DKGEVAEFDTVSNLLSDKNTMFYKLCEQ 1564

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 127/542 (23%), Positives = 237/542 (43%), Gaps = 62/542 (11%)

Query: 197 FGRMFLLKMLGERLVAR--LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMT 254
            G  F +K+    L  R  L A V KK+L   ++   ++  GD+I+ + +D   + R   
Sbjct: 347 LGNQFYIKIFEVGLGIRGSLMALVYKKSLRISSDARQKHSSGDIINLMSTDVLNLQRFFE 406

Query: 255 HNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQST 314
           ++ S          V + +   +   + + MI     + I A +  K       +++   
Sbjct: 407 NSQSIIGAPIQIVIVLISLYLLLDKAVFAGMISMVIMIPINAYLSRKVGSLYKTQMKYKD 466

Query: 315 GNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVA--KREGITSATFFSGTN-- 370
             LT ++E   N IK+IK +  E K M +    VR    +   K+ GI S   F   N  
Sbjct: 467 SRLTILTE-ILNSIKSIKLYSWE-KPMLKKLLHVRNDLELENFKKIGIFSNLIFFAWNCV 524

Query: 371 -VLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAA 429
            ++   S  L+ +  S + L  ++   SLT F +  +    +++ + +  +++++   + 
Sbjct: 525 PLMVTCSTFLIFSMISDVPLSPDIIFPSLTLFNILND----AIYVVPSTINDVIQANISM 580

Query: 430 SRL------FELTD----YKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTR---------- 469
            RL       EL D    YK   PS      V     IE  + +F + ++          
Sbjct: 581 KRLRDFLLAEELDDSFIEYKS--PSETDDAPV-----IEINNATFLWQSKKIINENSSTD 633

Query: 470 ------PTSQIFKKL-RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQD 522
                  +    K +   T+  GS  CIVG  G GKSTI   +L      S    +D   
Sbjct: 634 EESNIETSKAALKNIDNFTVKKGSLTCIVGKVGSGKSTILHAILGQLPCISA---LDQTR 690

Query: 523 ISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF 582
             KV+ ++    +    QE  +M+ ++++NI +G  +  +   +  V + C   + ++  
Sbjct: 691 APKVTIRA--TSIAYCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSIL 746

Query: 583 PDGYDTVIGPRGALLSGG-QRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLG 640
           PDG +T++G +G  L GG Q+ RI++ARA+  +  + +LD+  SA+D   S+  I Y L 
Sbjct: 747 PDGDETIVGEKGISLVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLS 806

Query: 641 R---LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
           +   L+R+K  TI+   + ++ ++ S+ I  +   G ++E   + ++    D+   K L 
Sbjct: 807 KETGLLRNK--TIILSTNNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLI 863

Query: 698 EH 699
           E 
Sbjct: 864 EE 865

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 138/499 (27%), Positives = 221/499 (44%), Gaps = 45/499 (9%)

Query: 229  FFDRNKVGDLISRLGSDAY----IVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSA 284
            FF+   +G +++R  +D Y    I+ RS +    + ++ +    V       I ST T  
Sbjct: 1034 FFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIVV-------ICST-TWQ 1085

Query: 285  MIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEGKE 340
             I    P+      Y +     SREL++    +   L    +E   G+ TI+ F  + + 
Sbjct: 1086 FIFLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGVSTIRGFAQQDRF 1145

Query: 341  MRRYNTAVRRLFNVAKREGITSATFFSG-TNVLGDVSFLLVLAYGSHLVLQGELSLGSLT 399
            +    + V     +A    I S  + +     LG +  L         +  G L+ G + 
Sbjct: 1146 IHINQSRVDSNM-MAYYPSINSNRWLAFRLEFLGSLIILGAATLSIFRLKNGSLTAGMIG 1204

Query: 400  AFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQT----FVPRDG 455
              M Y      S+  +     ++     +  R+ E +      P  +         P  G
Sbjct: 1205 LSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYSHLPSEAPLIIENNRPSEEWPSKG 1264

Query: 456  RIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSG 514
             IEFK+ S  Y  RP    + K + L I P   V IVG +G GKS++   L R  +A+SG
Sbjct: 1265 AIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSSLTLALFRIIEASSG 1322

Query: 515  TILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCF 574
            +I IDG +I+++    LR  L ++ Q+  +  G+IR+NI     +  S  EI    +   
Sbjct: 1323 SIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENIDPTQQF--SEQEIWNALEMAH 1380

Query: 575  CHNFITKF----PDG-----------YDTVIGPRGALLSGGQRQRIAIARALIKKPKILI 619
                I K     P+             D  I   G+ LS GQRQ I +ARAL+    +LI
Sbjct: 1381 LKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLICLARALLVPSNVLI 1440

Query: 620  LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
            LDEAT+A+DVE++  I +T+    + +  TI++IAHR++TI  S+ I+VL N G V E  
Sbjct: 1441 LDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDKIIVLDN-GEVAEFD 1497

Query: 680  KFADLYRDEDSELFKLLNE 698
            K   L  +++S  + L  E
Sbjct: 1498 KPEILLTNKNSLFYSLCYE 1516

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 128/522 (24%), Positives = 226/522 (43%), Gaps = 69/522 (13%)

Query: 207 GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALC 266
           G  + + L + + +K L    E  + +  GD+++ +  D   V R    ++S  +     
Sbjct: 362 GMNIRSALTSVIYQKALLLSNEATEVSTTGDIVNLMSVD---VQR--LQDLSQWINILWS 416

Query: 267 GGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG------KRIRAISRELQQSTGNL--- 317
           G       F ++  L S   +    + I   I G        I  I ++LQ+        
Sbjct: 417 GP------FQLTLCLISLYNLLGHSMWIGVFILGIMIPINSYIMRIQKKLQKDQMKYKDE 470

Query: 318 -TRVSEEQFNGIKTIKSFVAEG--KEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
            T +  E  N IK++K +  E   +E   +    + L N+ K+ G+ +A      N+   
Sbjct: 471 RTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELKNL-KKIGVFNAMIAFQFNI--- 526

Query: 375 VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNF--------YSELMKGA 426
           V FL+     +  V   +  L +   F   T      +F L NF         S  ++ +
Sbjct: 527 VPFLVSCCTFAIFVWVEDKPLTTDLVFPALT------LFNLLNFPLVAVPITISAFIEAS 580

Query: 427 GAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRLT 481
            + SRL+  LT+ +    +     FV ++G    K   + +F +  +P  ++  K +   
Sbjct: 581 VSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPEYKVALKNINFE 640

Query: 482 ITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQQ 540
              G   CIVG  G GKS     +L               D+ +V    S+  ++  V Q
Sbjct: 641 ARKGELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFASIHGNVAYVSQ 686

Query: 541 EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
              +M+GT++DNI +G  Y P   E     K C     ++  PDG  T++G +G  LSGG
Sbjct: 687 LAWIMNGTVKDNIIFGHRYDPEFYE--KTIKACALTIDLSILPDGDQTLVGEKGISLSGG 744

Query: 601 QRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRL 657
           Q+ R+++ARA+  +  I +LD+  +A+D   S+  I   LG   L++SK  T +   +++
Sbjct: 745 QKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSK--TRILTTNKI 802

Query: 658 STIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
             +  +++I +L N G + E G + D+   E S L KL+ E+
Sbjct: 803 PVLSIADSITLLEN-GEITEQGTYFDVMATEGSSLSKLITEY 843

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 140/514 (27%), Positives = 233/514 (45%), Gaps = 48/514 (9%)

Query: 207  GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALC 266
            G R +  + A  + K       FF+   +G +++R  +D + V   +    +        
Sbjct: 1007 GSRYLHNIMADAVFKA---PMSFFETTPIGRILNRFSNDIFKVDELLGRTFAQ----FFV 1059

Query: 267  GGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS----- 321
              + V     +    T   I+   P+      Y +     SREL++   ++TR       
Sbjct: 1060 NAIKVSFTIIVICFSTWQFILVILPMGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHF 1118

Query: 322  EEQFNGIKTIKSFVAEGKEMRRYNTAVRRL-FNVAKREGITSATFFSGTNVLGDVSF--- 377
            +E   GI TI          R YN   R +  N A+ +   SA ++   N    ++F   
Sbjct: 1119 QETLGGISTI----------RGYNQQKRFVHINQARVDNNMSA-YYPSVNANRWLAFRLE 1167

Query: 378  ----LLVLAYGSHLVL---QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAAS 430
                +++LA  S  VL   QG L+ G +   + Y      S+  +     E+     +  
Sbjct: 1168 FIGSVIILAASSLSVLRLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVE 1227

Query: 431  RLFELTDYKKSVPSTVGQTF----VPRDGRIEFKDVSFSYPTRPTSQI-FKKLRLTITPG 485
            R+ E  + +   P+ +         P  G I+F++ S  Y  RP  ++  K + L I P 
Sbjct: 1228 RIKEYANLESEAPAVIESNRPSEDWPSQGSIKFENYSARY--RPELELSLKDINLDIKPQ 1285

Query: 486  SNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLM 545
              + IVG +G GKS++   L R  +A SG I IDG  I  +  + LR HL ++ Q+  L 
Sbjct: 1286 ERIGIVGRTGAGKSSLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLF 1345

Query: 546  SGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF-PDGYDTVIGPRGALLSGGQRQR 604
             GTIR+NI     YT   ++I    +     + +     +  D  +   G+ LS GQRQ 
Sbjct: 1346 EGTIRENIDPTNEYTD--EQIWRALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQL 1403

Query: 605  IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE 664
            + +ARAL+   KIL+LDEAT+A+DVE++  I  T+    +++  TI++IAHR++TI  S+
Sbjct: 1404 MCLARALLIPSKILVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSD 1461

Query: 665  NIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
             I+VL + G V E     +L ++ +S  + L  E
Sbjct: 1462 RILVL-DSGKVAEFDTPDNLLKNPESLFYSLCYE 1494

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 103/420 (24%), Positives = 191/420 (45%), Gaps = 55/420 (13%)

Query: 299 YGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRR--YNTAVRRLFNVAK 356
           Y K+++ +  +++   G  TR+  E  N IK++K +  E    ++  Y    + L N+ +
Sbjct: 458 YQKKLQKV--QMKYKDGR-TRLISEILNNIKSLKLYAWEEPYRKKLDYVRNEKELKNL-R 513

Query: 357 REGITSATFFSGTNV---LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVF 413
           R GIT+A      NV   L   S   V  +     L  +L   +LT F L          
Sbjct: 514 RMGITNACASFQFNVIPFLVSCSTFGVFIWTQDAPLTTDLVFPALTLFNLLAFPLAVIPT 573

Query: 414 GLSNFYSELMKGAGAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTR 469
            ++ F    ++ + + +RL   LT+ +    S   ++ V + G +      D +F +  +
Sbjct: 574 AITAF----VEASVSITRLQSFLTNEELQRDSVQRKSKVTKKGEVAVNVGADATFLWQRK 629

Query: 470 PTSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA 528
           P  ++  K +      G   C+VG  G GKS +   +L               D+ +V  
Sbjct: 630 PEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL--------------GDLFRVKG 675

Query: 529 -KSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD 587
             S+   +  V Q P +M+GT++DNI +G  Y  S   +    K C     +   P G  
Sbjct: 676 FASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVDLAVLPKGDQ 733

Query: 588 TVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLG------ 640
           T++G +G  LSGGQ+ R+++ARA+  +    +LD+  +A+D   ++  + + LG      
Sbjct: 734 TLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLGPNGLLA 793

Query: 641 ---RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLN 697
              +++ + +IT++SIA         ++I +L N G +I+ G + D+   + S L K+++
Sbjct: 794 SKTKVLATNKITVLSIA---------DHIALLEN-GEIIQQGSYDDVTSAKSSALSKIIS 843

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 140/523 (26%), Positives = 232/523 (44%), Gaps = 67/523 (12%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL-CGGVGVGMMFH 276
            ++ K LH    FFD    G +++R   D   + + +T  I     + + C    + + F 
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 277  ISSTLTSAMIM-----FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331
                L+ A+++     F     +A +   KR  +ISR        + +   E   G+ TI
Sbjct: 1201 TPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISR------SPIYQHFSETLVGVTTI 1254

Query: 332  KSFVAEGKEMRRY------NTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGS 385
            ++F  EG+ M+        N        VA R             + G  + L +L    
Sbjct: 1255 RAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFG--AGLFILFNID 1312

Query: 386  HLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT-------DY 438
            H+     ++  SLT  + +TE        L   YSE+     +  R+ E         + 
Sbjct: 1313 HI--DSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMKIEQEPYNQ 1366

Query: 439  KKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRG 497
             K VP +      P+DG+IE  D+S  Y P  P  ++   +  ++   S + IVG +G G
Sbjct: 1367 HKEVPPSQW----PQDGKIEVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAG 1420

Query: 498  KSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN----- 552
            KSTI + L RF +  +G I ID  DIS V  + LR+ + ++ Q+P L SGTI+ N     
Sbjct: 1421 KSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYD 1480

Query: 553  ----------------ITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGAL 596
                            I+   S+  ++ E           N I KF D   + +   G+ 
Sbjct: 1481 EFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSEN-INKFLD-LSSEVSEGGSN 1538

Query: 597  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            LS GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  +    TI++IAHR
Sbjct: 1539 LSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHR 1596

Query: 657  LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            L ++   + I+V+ + G V E      L  ++ S +F  + EH
Sbjct: 1597 LRSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQS-IFYSMCEH 1637

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 112/477 (23%), Positives = 208/477 (43%), Gaps = 26/477 (5%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISS 279
           +K+++ D E      +G +I+ +  DA+ VS    + +   ++A +   V + +++H+  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSEICGY-LHSFLEAFVMTVVALALLYHLLG 518

Query: 280 TLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGK 339
                 ++    +L       K I  + ++    T N  +   E F  I+ IK F  E  
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN 578

Query: 340 EMRRYNT----AVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGEL-- 393
             +  NT     +  L   +    I+S  +F    ++   SF    AY  ++ +QGE+  
Sbjct: 579 FEKEINTIRENELSLLLMRSIIWSISSFVWFVTPTIVTAASF----AY--YIYVQGEVLT 632

Query: 394 SLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPR 453
           +  + TA  L+T      +  LS+  S +++   +  R+ +  + +K        T  P 
Sbjct: 633 TPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLN-EKDTKKYDQLTIDPN 690

Query: 454 DGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGK-STIASLLLRFYDAN 512
             R   ++ + S+         K L +    G    ++GP+G GK S + +LL   Y  N
Sbjct: 691 GKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLN 750

Query: 513 SGTILIDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAV 569
            G I++   +  +   V A      +    Q   L++ TI+ NI +   +  +    +AV
Sbjct: 751 -GKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFNSPFNEA--RYKAV 807

Query: 570 AKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDV 629
            + C           G  T IG +G  LSGGQ+QR+++ARAL    + ++LD+  SA+D 
Sbjct: 808 VEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVDS 867

Query: 630 ESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            +   I  N   G LM  +  T + ++H ++   R+  +VVL  DG + + G   D+
Sbjct: 868 HTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRIKDQGDPIDM 922

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 236/522 (45%), Gaps = 65/522 (12%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAAL-CGGVGVGMMFH 276
            ++ K LH    FFD    G +++R   D   + + +T  I     + + C    + + F 
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 277  ISSTLTSAMIM-----FAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331
                L+ A+++     F     +A +   KR  +ISR        + +   E   G+ TI
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISR------SPIYQHFSETLVGVTTI 1254

Query: 332  KSFVAEGKEMRRY------NTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGS 385
            ++F  EG+ M+        N        VA R             + G  + L +L   +
Sbjct: 1255 RAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFG--AGLFILFNIN 1312

Query: 386  HLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYK------ 439
            HL     ++  SLT  + +TE        L   Y+E+     +  R+ E  + +      
Sbjct: 1313 HL--DSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERVKEYMEIEQEPYNQ 1366

Query: 440  -KSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGRG 497
             K VP        P+DG+IE  D+S  Y P  P  ++ K +  ++   S + IVG +G G
Sbjct: 1367 HKEVPPPQW----PQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAG 1420

Query: 498  KSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGL 557
            KSTI + L RF +  +G I ID  DIS V  + LR+ + ++ Q+P L SGTI+ N+    
Sbjct: 1421 KSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYD 1480

Query: 558  SYT-----PSMDEIRAVAKK---------------CFCHNFITKFPDGYDTVIGPRGALL 597
             ++      ++  +  ++++                     + KF D   + +   G+ L
Sbjct: 1481 EFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSENVNKFLD-LSSEVSEGGSNL 1539

Query: 598  SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
            S GQRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+ +  +    TI++IAHRL
Sbjct: 1540 SQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRKEFQGS--TILTIAHRL 1597

Query: 658  STIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
             ++   + I+V+ + G V E      L  ++ S +F  + EH
Sbjct: 1598 RSVIDYDKILVM-DAGEVKEYDHPYSLLLNKQS-IFYSMCEH 1637

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 110/477 (23%), Positives = 209/477 (43%), Gaps = 26/477 (5%)

Query: 220 KKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISS 279
           +K+++ D E      +G +I+ +  DA+ VS    + +   ++A +   V + +++ +  
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSEICGY-LHSFLEAFVMTVVALVLLYRLLG 518

Query: 280 TLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGK 339
                 ++    +L       K I  + ++    T N  +   E F  I+ IK F  E  
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEEN 578

Query: 340 EMRRYNTAVRR-----LFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGEL- 393
             +  N A+R      L   +    I+S  +F    ++   SF    AY  ++ +QGE+ 
Sbjct: 579 FEKDIN-AIRENELSLLLMRSIVWSISSFVWFVTPTIVTAASF----AY--YIYVQGEVL 631

Query: 394 -SLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVP 452
            +  + TA  L+T      +  LS+  S +++   +  R+ +  + +K        T  P
Sbjct: 632 TTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLN-EKDTKKYDQLTIDP 689

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
              R  F++ + S+         K L +    G    ++GP+G GK+++   LL      
Sbjct: 690 NGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLL 749

Query: 513 SGTILIDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAV 569
           SG +++   +  +   V A      +    Q   L++ T+++NI +   +  +    +AV
Sbjct: 750 SGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFNSPFNEA--RYKAV 807

Query: 570 AKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDV 629
            + C           G  T IG +G  LSGGQ+QR+++ARAL    + ++LD+  SA+D 
Sbjct: 808 VEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDS 867

Query: 630 ESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            +   I  N   G LM  +  T + ++H ++   R+  +VVL  DG V + G   D+
Sbjct: 868 HTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDM 922

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 130/492 (26%), Positives = 222/492 (45%), Gaps = 45/492 (9%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    S          V V     +  + T   +  
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQ----FFVNAVKVSFTIIVICSSTWQFVFV 1075

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGKEMRR 343
              PL      Y +     SREL++   ++TR       +E   GI TI+ +  +G+ +  
Sbjct: 1076 IIPLGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLH- 1133

Query: 344  YNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL-----------QGE 392
                     N A+ +   SA F+   N    ++F L    GS ++L           QG 
Sbjct: 1134 --------INQARVDNNMSA-FYPSVNANRWLAFRLEFI-GSIIILGAATLSVFRLKQGA 1183

Query: 393  LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTF-- 450
            L+ G +   + Y      S+  +     E+     +  R+ E  +     P+ +      
Sbjct: 1184 LTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPA 1243

Query: 451  --VPRDGRIEFKDVSFSYPTRPTSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
               P  G I+F++ S  Y  RP   +  + + + I P   + IVG +G GKS++   L R
Sbjct: 1244 EDWPTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFR 1301

Query: 508  FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR 567
              +A  G I+IDG     +  + LR HL ++ Q+  +  GT+R+NI     YT   +EI 
Sbjct: 1302 IIEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENIDPTNEYTD--EEIW 1359

Query: 568  AVAKKCFCHNFITKF-PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSA 626
               +     + I     D  ++++   G  LS GQRQ + +ARAL+   +IL+LDEAT+A
Sbjct: 1360 HALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAA 1419

Query: 627  LDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYR 686
            +DVE++  I  T+    +++  TI++IAHR++TI  S+ I+VL + G + E      L +
Sbjct: 1420 VDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLK 1476

Query: 687  DEDSELFKLLNE 698
            + +S  + L  E
Sbjct: 1477 NRESLFYSLCQE 1488

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 104/419 (24%), Positives = 193/419 (46%), Gaps = 48/419 (11%)

Query: 299 YGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA--VRRLFNVAK 356
           Y K+++ I     ++    TR   E  N IK++K +  E     + +     + L N+ K
Sbjct: 452 YQKKLQKIQ---MKNKDERTRTISEILNNIKSLKLYAWEVPFREKLDKVRNEKELQNL-K 507

Query: 357 REGITSATFFSGTNVLGDVSFLLVLAYGSHLV-------LQGELSLGSLTAFMLYTEYTG 409
           R GIT+A      N+   V FL+  +  +  V       L  +L   +LT F L +    
Sbjct: 508 RMGITTAIASFQFNI---VPFLVSCSTFAVFVWTQKDRPLSTDLVFPALTLFNLLSFPLA 564

Query: 410 SSVFGLSNFYSELMKGAGAASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFS 465
                L++F    ++ + + +RL   LT+ +    S   +  V + G +      D +F 
Sbjct: 565 IIPTALTSF----IEASVSVNRLHSFLTNEELQRDSVQRKPKVTKTGEVAINVGADATFL 620

Query: 466 YPTRPTSQI-FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDIS 524
           +  +P  ++  K +      G   CIVG  G GKS +   +L               D+ 
Sbjct: 621 WQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGIL--------------GDLF 666

Query: 525 KVSA-KSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFP 583
           +V    S+   +  V Q P +M+GT+++NI +G  Y    D      + C     ++  P
Sbjct: 667 RVKGFASVHGSIAYVSQVPWIMNGTVKENILFGHKY--DADFYDTTLRACALAVDLSILP 724

Query: 584 DGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR- 641
            G +T++G +G  LSGGQ+ RI++ARA+  +    +LD+  +A+D   ++  I + LG  
Sbjct: 725 KGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQ 784

Query: 642 -LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            L+ SK   + +  +++S +  +++I +L N G +I+ G + ++  D+ S L K++  +
Sbjct: 785 GLLSSKVKVLAT--NKISVLSIADHISLLEN-GEIIQQGSYEEVTSDKSSALSKIIANY 840

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 135/515 (26%), Positives = 228/515 (44%), Gaps = 53/515 (10%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGM 273
            L + ++   L     FF+   +G +++R  +D Y +   +  + S          V V  
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQ----FFVNAVKVSF 1088

Query: 274  MFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIK 329
               +    T   I+   P+ +    Y +     SREL++    +   +    +E   G+ 
Sbjct: 1089 TILVICWNTWQFILLVIPMGVLYLYYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLA 1148

Query: 330  TIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVL 389
            TI+ +  + + +           N A+ +   SA + S   +  +      L +   L++
Sbjct: 1149 TIRGYEQQKRFIH---------INQARVDNNMSAYYPS---INSNRWLAYRLEFLGSLII 1196

Query: 390  QGELSL-------GSLTAFML-----YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTD 437
             G  SL       G+LTA M+     Y      S+  +     E+     +  R+ E  +
Sbjct: 1197 FGAASLSILKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAE 1256

Query: 438  YKKSVPSTVGQT----FVPRDGRIEFKDVSFSYPTRPT-SQIFKKLRLTITPGSNVCIVG 492
             K   P  + +       P  G I+F++ S  Y  RP    + K + L I P   V IVG
Sbjct: 1257 LKSEAPLIIEEKRPSENWPERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVG 1314

Query: 493  PSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN 552
             +G GKS++   L R  +A  G+I++DG +IS++    LR  L ++ Q+  +  GTIR+N
Sbjct: 1315 RTGAGKSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIREN 1374

Query: 553  ITYGLSYTPSMDEIRAVAKKCFCHNFITKFPD---------GYDTVIGPRGALLSGGQRQ 603
            I     YT   ++I    +       I +  +            T +   G  LS GQRQ
Sbjct: 1375 IDPTNIYTD--EQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQ 1432

Query: 604  RIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRS 663
             + +ARAL+   KILILDEAT+A+DVE++  I  T+    + +  TI++IAHRL+TI  S
Sbjct: 1433 LMCLARALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDS 1490

Query: 664  ENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            + IVVL + G V E     +L ++ +S  + L  +
Sbjct: 1491 DKIVVL-DKGEVAEFDTPQNLLKNTESLFYSLCEQ 1524

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 104/401 (25%), Positives = 184/401 (45%), Gaps = 48/401 (11%)

Query: 318 TRVSEEQFNGIKTIKSFVAEG--KEMRRYNTAVRRLFNVAKREGITSATFFSGTNV--LG 373
           TRV  E  N IK++K +  E   KE   +    + L N+ +     + T F    V  L 
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLV 544

Query: 374 DVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF 433
             S   V  Y     L  +L   +LT F L T    +    ++ F    ++ + + SRLF
Sbjct: 545 SCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALPIVITAF----IEASVSMSRLF 600

Query: 434 EL-------TDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRLTI 482
                    TD  + +P       V + G I      + +F +  +P  ++  K +    
Sbjct: 601 SFMTNEELQTDAIQRLPP------VKKQGDIAVNIGDNATFLWKRKPEYKVALKNIEFQA 654

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQQE 541
             G   CIVG  G GKS     +L               D+ +V    ++  ++  V Q 
Sbjct: 655 KKGELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFATIHGNVAYVSQL 700

Query: 542 PVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
           P +M+GT++DNI +G  Y     E     + C     ++  PDG  T++G +G  LSGGQ
Sbjct: 701 PWIMNGTVKDNILFGHKYNQEFYE--KTLRACALTIDLSILPDGDQTLVGEKGISLSGGQ 758

Query: 602 RQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRLS 658
           + R+++ARA+  +  + +LD+  +A+D   S+  I + +G   L+ +K  T V   +++S
Sbjct: 759 KARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKIS 816

Query: 659 TIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            +  ++NI +L +DG +++ G + ++  + +S L KL++E+
Sbjct: 817 VLSIADNITLL-DDGEIVQQGTYNEVTDNINSPLCKLISEY 856

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 134/499 (26%), Positives = 217/499 (43%), Gaps = 49/499 (9%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTH-------NISDGVKAALCGGVGVGMMFHISSTL 281
            FF+   VG +I+R  SD   +  S+ +       +I D +   +  G  V +   +++ L
Sbjct: 1056 FFETTPVGRIINRFSSDMNSLDDSVQYVMSFFLVSILDYLVVVIIIGYQVPLFLIVNAVL 1115

Query: 282  TSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGK-- 339
                  +          Y    R + R +  S   +  +  E   G   I +F    +  
Sbjct: 1116 LVIYFYYQ-------VYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAFRHSDRFD 1168

Query: 340  ----EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAY--GSHLVLQGEL 393
                E  ++N  +  LFN        S    S   ++   + LL LA   G H      L
Sbjct: 1169 YLNVENVQFN--INCLFNFRSTNRWLSIRLESIGALMILTTALLSLATKNGGH-----AL 1221

Query: 394  SLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPR 453
            S G +   M Y     + +  +     +L     +  R+ E  D     P  +  +  P+
Sbjct: 1222 STGMVGLLMSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPK 1281

Query: 454  D----GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFY 509
            +    G I FK+ S  Y       + + L L I P   + IVG +G GKST++  L R  
Sbjct: 1282 NWPSQGLIRFKNYSTRYRAN-LDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRIL 1340

Query: 510  DANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAV 569
            + + GTI IDG DISK+  K LR +L ++ Q+     GT+R N+     Y  S +EI   
Sbjct: 1341 EPSEGTIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPFEQY--SDEEIWKA 1398

Query: 570  AKKCFCHNFITKFP----------DGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI 619
             +       I K            D   T I   G+ LS GQRQ + ++RAL+ + +IL+
Sbjct: 1399 LELSHLKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILV 1458

Query: 620  LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
            LDEAT+A+D E++  I  T+    + +  TI++IAHR+ T+  S+ I+VL + G V E  
Sbjct: 1459 LDEATAAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFD 1515

Query: 680  KFADLYRDEDSELFKLLNE 698
              ++L   +DS  + L ++
Sbjct: 1516 SPSNLLAQKDSIFYNLCDQ 1534

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 106/419 (25%), Positives = 189/419 (45%), Gaps = 50/419 (11%)

Query: 311 QQSTGNLTRVSE--EQFNGIKTIKSFVAEGKEMRRYNTAVR---RLFNVAKREGITSATF 365
           QQ T    R+    E  N +KT+K +  E   ++R +  VR    L N  K   IT+   
Sbjct: 458 QQMTYKDARIKTITELLNSVKTVKLYAWEEPMLKRLD-HVRNDLELQNFKKISIITNLIL 516

Query: 366 FSGTNV--LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELM 423
           F+   V  L   S  L+ A    + L  ++   SL+ F    +     ++ +    +  +
Sbjct: 517 FAWNCVPILVASSTFLIYALTMDVPLTPQIVFPSLSLF----DILNDCIYTIPRTITNFI 572

Query: 424 KGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR---IEFKDVSF------------SYPT 468
           +   +  RL +    K+   S +    +P DG+   IE  + +F            SY  
Sbjct: 573 ETGVSLGRLKDFLLAKEIDKSFIEFESLPSDGKVPVIEVHNATFLRKIPNDSTDDESYDE 632

Query: 469 RP---TSQI-FKKLR-LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDI 523
                +SQ+  K +    +  G  VC+VG  G GKST    LL       G +       
Sbjct: 633 EAAVESSQVALKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSP 685

Query: 524 SKVSAK-SLRKH-LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITK 581
           S  S     R + + +  Q+  +M+ +++DN+ +G  +  +    +A  + C     +  
Sbjct: 686 SHASPTVHFRANSVALCSQQSWIMNASVKDNVLFGHRFDEA--TYKATLEACQLVPDLEI 743

Query: 582 FPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLG 640
             DG +T++G +G  LSGGQ+ R+++ARA+  +  + +LD+  SA+D E  +  I   L 
Sbjct: 744 LADGDETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLS 803

Query: 641 R---LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
           +   L+++K  T++   + +S ++ S++I  L  DG ++E+G F D+ R +DS   K L
Sbjct: 804 KKTGLLKNK--TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRL 859

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 131/489 (26%), Positives = 222/489 (45%), Gaps = 39/489 (7%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D Y V   +    +            V     +    T   I  
Sbjct: 1042 FFETTPIGRILNRFSNDIYKVDELLGRTFAQ----FFVNVTKVSFTIIVICVTTWQFIFL 1097

Query: 289  APPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRY 344
              P+++    Y +     SREL++    +   +    +E   G+ TI+ +     +  R+
Sbjct: 1098 ILPMIVLYVYYQQYYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY----DQQDRF 1153

Query: 345  NTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLL-----VLAYGSHLVLQGELSLGSLT 399
                    N ++ +   SA F+   N    ++F L     ++ +G+  +    L  GSLT
Sbjct: 1154 TH-----INQSRIDNNMSA-FYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLT 1207

Query: 400  AFML-----YTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRD 454
              M+     Y      S+  +     E+     +  R+ E ++ K   P  +     P D
Sbjct: 1208 PGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIKSEAPLVIEDHRPPAD 1267

Query: 455  ----GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYD 510
                G I+F+  S  Y     + + K + L + P   + IVG +G GKS++   L R  +
Sbjct: 1268 WPSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIE 1326

Query: 511  ANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVA 570
            A  G I+IDG  I+++    LR  L ++ Q+  +  GT+R+NI     Y  S +EI  V 
Sbjct: 1327 AAEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENIDPTNQY--SDEEIWRVL 1384

Query: 571  KKCFCHNFITKFP-DGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDV 629
            +     N +     DG  T +   GA LS GQRQ + +ARAL+   +ILILDEAT+A+DV
Sbjct: 1385 ELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDV 1444

Query: 630  ESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDED 689
            E++  I  T+    + +  TI++IAHRL+TI  S+ I+VL + G V E     +L + + 
Sbjct: 1445 ETDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVREFDTPENLLKQQG 1501

Query: 690  SELFKLLNE 698
            S  + L ++
Sbjct: 1502 SIFYSLCSD 1510

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 122/519 (23%), Positives = 218/519 (42%), Gaps = 65/519 (12%)

Query: 207 GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVS--RSMTHNISDGVKAA 264
           G  + + L + + KK L    E  D +  GD+++ +  D   +       H I  G    
Sbjct: 379 GMNIKSALTSTIYKKALVLSNEAADMSSTGDIVNLMSVDVQRLQDLTQYCHLIWSGPFQI 438

Query: 265 LCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRV 320
           L   V +  +   S  +   +++   PL          +  I ++LQ+    +    +R+
Sbjct: 439 LLCLVSLYKLLGRSMWIGVIILVIMMPL-------NSMLMRIQKKLQKVQMKNKDERSRL 491

Query: 321 SEEQFNGIKTIKSFVAEGK-----EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
             E  N IK++K +  E       E  R +  ++ L  +     +TS  F +    L   
Sbjct: 492 ISEILNNIKSLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQF-NIVPFLVSC 550

Query: 376 SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFE- 434
           S   V  Y     L  +L   +L  F L +         L+ F    ++ + + +RL+  
Sbjct: 551 STFAVFVYTEKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLYSF 606

Query: 435 LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRLTITPGSNVCI 490
           LT+ +    +        + G +  K   D +F +  +P  Q+  K + L +  G   C+
Sbjct: 607 LTNEELQKDAVHHLPKAQKAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACV 666

Query: 491 VGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQQEPVLMSGTI 549
           VG  G GKS +   LL               D+ +V    ++      V Q P +M+GT+
Sbjct: 667 VGKVGSGKSALVQSLL--------------GDLYRVKGYAAVHGSTAYVSQVPWIMNGTV 712

Query: 550 RDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIAR 609
           +DNI +G  Y P   ++    K C     +   PDG  T++G +G  LSGGQ+ R+++AR
Sbjct: 713 KDNILFGHKYDPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLAR 770

Query: 610 ALIKKPKILILDEATSALDVE-SEGAINYTLG---------RLMRSKEITIVSIAHRLST 659
           A   +    +LD+  +A+D   ++  I + LG         +L+ + +IT++SIA  +S 
Sbjct: 771 ATYARADTYLLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISL 830

Query: 660 IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           +            G +I+ G + D+ +D DS L  L+ E
Sbjct: 831 VE----------GGEIIQHGSYEDISKDLDSPLSNLVKE 859

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 144/532 (27%), Positives = 221/532 (41%), Gaps = 82/532 (15%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
            L+  +G     RL  + +++ LH    F D   +G +++R   D   V   +T ++   V
Sbjct: 964  LICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFV 1023

Query: 262  KAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321
               L   VGV +M           I++ P   IA          ++   Q S+  + R+ 
Sbjct: 1024 -FQLSNIVGVIVM----------CIIYLPWFAIAVPFLMLVFVGVADHYQSSSREIKRLE 1072

Query: 322  EEQ-------FN----GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTN 370
              Q       FN    G+ TI+++  E    RR+ T    L N     G           
Sbjct: 1073 AVQRSHVFNNFNEVLGGMDTIRAYRGE----RRFLTKSDFLTNKMNEAGYLVVAIQRWVA 1128

Query: 371  VLGDVSFLLVLAYGSHLVL-----QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELM-K 424
            +  D   ++ +A+   + L     Q  +S  S+   + Y       + GL N     M +
Sbjct: 1129 IALD---MIAMAFALIVTLLCVTRQFHISAASVGVLLTYV----LQLPGLLNMLLRAMTQ 1181

Query: 425  GAGAASRLFELTDYKKSVPSTVGQ--------TFVPRDGRIEFKDVSFSY-PTRPTSQIF 475
            G    +    L  Y   +P                P DGRIEF  VS +Y P  P   + 
Sbjct: 1182 GENDMNSTERLISYATELPLEAAYRRPEMSPPAEWPTDGRIEFDHVSLAYRPGLPL--VL 1239

Query: 476  KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535
            K + L +  G  + I G +G GKSTI S L R  + + G+I IDG DIS +    LR  L
Sbjct: 1240 KDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKL 1299

Query: 536  GVVQQEPVLMSGTIRDN----------------ITYGLSYTPSMDEIRAVAKK-----CF 574
             ++ Q+PV+  G +R N                +  G     S+  +RA   +       
Sbjct: 1300 SIIPQDPVMFKGDVRKNLDPFHERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSN 1359

Query: 575  CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGA 634
             H F           +   G   S G+RQ +A+ RAL+++ KILILDEATS++D E++  
Sbjct: 1360 MHKF------HLQQEVEEDGTNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDAK 1413

Query: 635  INYTLGRLMRS-KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
            I     R++ +    TI+ IAHRL+TI   + I+VL + G V E    A LY
Sbjct: 1414 IQ---TRIVEAFSNCTILCIAHRLNTILDYDRILVL-DQGRVCEFDTPAALY 1461

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 92/203 (45%), Gaps = 21/203 (10%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L + IT G  V + G  G GKS++   L  F     G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
             ++   P + + T+RDNI +G  Y  +      + + C     +   P G  T IG RG
Sbjct: 650 -MLLCGYPWIQNATVRDNILFGSPYNEA--RYNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIVS 652
             LSGGQ+ RI +ARA+ KK  I + D+  SA+D      I     +G+L  S   T V 
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRVL 763

Query: 653 IAHRLSTIRRSENIVVLGNDGSV 675
             H+LS I R+  ++ +  DGSV
Sbjct: 764 ATHQLSLIARASKVIYIDLDGSV 786

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 139/524 (26%), Positives = 231/524 (44%), Gaps = 65/524 (12%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            +L   + K  +     FF+   VG +I+R  SD   V  S+ +  S   K+ L   V + 
Sbjct: 1053 KLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIV 1112

Query: 273  MM-FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNG 327
            ++ +++   L   M      LL+    Y      +SREL++    S   +  +  E  NG
Sbjct: 1113 LVGYNMPWFLVFNMF-----LLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNG 1167

Query: 328  IKTIKSFVAEGKEMRRYNTAVRRLF-NVAKREGITSATF-FSGTNVLGDVSFLLVLAYGS 385
               I +          YN   R ++ N  K +      F F   N    V    +   G+
Sbjct: 1168 YSIIDA----------YNHYERFIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTI---GA 1214

Query: 386  HLVL------------QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF 433
             +VL            + +LS G +   M Y+    SS+  +      +     +  R+ 
Sbjct: 1215 TIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIV 1274

Query: 434  ELTDY---KKSV-PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVC 489
            E  +     +S+ P        P +GRIEFK+ S  Y       + K + ++I P   + 
Sbjct: 1275 EYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY-RENLDPVLKDINVSIQPCEKIG 1333

Query: 490  IVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTI 549
            IVG +G GKST++  L R  + + G I+ID  +IS++    LR +L ++ Q+     GT+
Sbjct: 1334 IVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTV 1393

Query: 550  RDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF------------------PDGYDTVIG 591
            R N+     Y  S DE++   +     + + K                    D  D  I 
Sbjct: 1394 RTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVKIN 1451

Query: 592  PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
              G+ LS GQRQ + +ARAL+   KIL+LDEAT+++D+E++  I  T+ R  + +  TI+
Sbjct: 1452 ENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--TIL 1509

Query: 652  SIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            +IAHR+ T+  S+ I+VL + G+V E    + L  D+ S  + L
Sbjct: 1510 TIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLSDKGSIFYSL 1552

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 115/220 (52%), Gaps = 16/220 (7%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRK--HLGVVQQEP 542
           G  +C+VG  G GKST    +L      SG+          ++ K + +   L    QE 
Sbjct: 665 GDLICVVGRVGAGKSTFLKAILGQLPCMSGSK-------ESLAPKLIIRASSLAYCSQES 717

Query: 543 VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            +M+ ++R+NI +G  +  +  ++    K C     +   PDG +T++G +G  LSGGQ+
Sbjct: 718 WIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQK 775

Query: 603 QRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSKEITIVSIAHRLSTI 660
            R+++ARA+  +  I +LD+  SA+D E S+  I + L G+    K  TI+   + +S +
Sbjct: 776 ARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSIL 835

Query: 661 RRSENIVVLGNDGSVIEAGKFADLYRDED--SELFKLLNE 698
           + S+ I  L N G ++E G +  + + E+  S+L KLL E
Sbjct: 836 KHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEE 874

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/477 (27%), Positives = 211/477 (44%), Gaps = 39/477 (8%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   +G +++R  +D + V   +    S  V       + V     +    T    +F
Sbjct: 1047 FFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNV----IKVSFTIIVICFTTWQFTLF 1102

Query: 289  APPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQFNGIKTIKSFVAEGK---- 339
              PL I    Y +     SREL++   + TR       +E   G+ TI+ +  + +    
Sbjct: 1103 VIPLGILYVYYQQYYLRTSRELRR-LDSTTRSPIYAHFQESLGGLSTIRGYNQQRRFIHI 1161

Query: 340  -EMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSL 398
             + R  N       +V     +     F GT ++   S L +L   S     G L+ G +
Sbjct: 1162 NQSRMDNNMSAYYPSVNANRWLAYRLEFIGTIIIFGASSLSILRLKS-----GSLTPGMI 1216

Query: 399  TAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQ----TFVPRD 454
               + Y      S+  +     E+     +  R+ E ++     P  +         P D
Sbjct: 1217 GLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIPSEAPYLIEDRRPSPNWPTD 1276

Query: 455  GRIEFKDVSFSYPTRP-TSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANS 513
            G I+F+  S  Y  RP    I K + L I P   + IVG +G GKS++   L R  +A  
Sbjct: 1277 GAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAE 1334

Query: 514  GTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKC 573
            G I+IDG  I ++    LR  L ++ Q+  +  G++R+NI     Y  S +EI  V    
Sbjct: 1335 GRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENIDPTEQY--SDEEIWRVLDLS 1392

Query: 574  FCHNFITKF-PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632
               N +     DG  T +   G  LS GQRQ + +ARAL+   KIL+LDEAT+A+DVE++
Sbjct: 1393 HLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETD 1452

Query: 633  GAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDED 689
              +  T+      +  TI++IAHRL+TI  S+ I+VL       +AG+ A+    E+
Sbjct: 1453 KVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-------DAGRVAEFDTPEN 1500

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 130/517 (25%), Positives = 226/517 (43%), Gaps = 59/517 (11%)

Query: 207 GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALC 266
           G  L + L + + KK+L   +E  D +  GD+++ +  D           + D   A  C
Sbjct: 378 GMNLKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDV--------QRLQD--LAQWC 427

Query: 267 GGVGVGMMFHISSTLTSAMIMFAPPLLIAATIY------GKRIRAISRELQQ----STGN 316
             +  G  F I   LTS   +    + +   I          +  + + LQ+    +   
Sbjct: 428 HLIWSGP-FQIILCLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQ 486

Query: 317 LTRVSEEQFNGIKTIKSFVAEG--KEMRRYNTAVRRLFNVAKREGITSATF---FSGTNV 371
            TR+  E  N +K++K +  E   KE   Y    + L N+ K  G+ +A     F+    
Sbjct: 487 RTRLINEILNNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKI-GVYNAIINFQFNIVPF 545

Query: 372 LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASR 431
               S   V  Y     L  +L   +LT F L + +  + V  + N Y E     G   R
Sbjct: 546 FVSCSTFAVFVYTEDRPLTTDLVFPALTLFGLLS-FPLAVVPLVLNSYIEASVSIG---R 601

Query: 432 LFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRLTITPGS 486
           L+  LT+ +    S      V   G +  K   + +F +  +P  ++  K +      G 
Sbjct: 602 LYSFLTNEELQRDSVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGE 661

Query: 487 NVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQQEPVLM 545
             C+VG  G GKS +   LL               D+ +V    ++  ++  V Q   +M
Sbjct: 662 LNCVVGRVGSGKSALIQSLL--------------GDLFRVKGFATVHGNIAYVSQVAWIM 707

Query: 546 SGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRI 605
           +GT++DNI +G  Y P   E     K C     +   PDG  T++G +G  LSGGQ+ R+
Sbjct: 708 NGTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARL 765

Query: 606 AIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRLSTIRR 662
           ++ARA+  +  I +LD+  +A+D   S   I++ LG   L+++K  T +   +++S +  
Sbjct: 766 SLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK--TKILATNKISALSI 823

Query: 663 SENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
           ++++ +L N G +I+ G F ++ +  DS L KL+ E+
Sbjct: 824 ADSVTLLEN-GEIIQQGTFCEITKAADSPLSKLIKEY 859

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  129 bits (325), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 141/540 (26%), Positives = 235/540 (43%), Gaps = 63/540 (11%)

Query: 196 NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
           N   + +L     R   +L   + K  +     FF+   VG +I+R  SD   V  S+ +
Sbjct: 465 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 524

Query: 256 NISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ--- 312
             S   K+ L   V + ++ +         ++F   LL+    Y      +SREL++   
Sbjct: 525 VFSFFFKSILTYLVTIVLVGYN----MPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLIS 580

Query: 313 -STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLF-NVAKREGITSATF-FSGT 369
            S   +  +  E  NG   I +          YN   R ++ N  K +      F F   
Sbjct: 581 ISYSPIMSLMSESLNGYSIIDA----------YNHYERFIYLNYDKIQSNIDLVFNFRSI 630

Query: 370 NVLGDVSFLLVLAYGSHLVL------------QGELSLGSLTAFMLYTEYTGSSVFGLSN 417
           N    V    +   G+ +VL            + +LS G +   M Y+    SS+  +  
Sbjct: 631 NRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIVR 687

Query: 418 FYSELMKGAGAASRLFELTDY---KKSV-PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQ 473
               +     +  R+ E  +     +S+ P        P +GRIEFK+ S  Y       
Sbjct: 688 TTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY-RENLDP 746

Query: 474 IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRK 533
           + K + ++I P   + IVG +G GKST++  L R  + + G I+ID  +IS++    LR 
Sbjct: 747 VLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRS 806

Query: 534 HLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF----------- 582
           +L ++ Q+     GT+R N+     Y  S DE++   +     + + K            
Sbjct: 807 NLAIIPQDAQAFEGTVRTNLDPFNRY--SEDELKRAIELAHLKSHLEKMLGNEAENNDIN 864

Query: 583 -------PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
                   D  D  I   G+ LS GQRQ + +ARAL+   KIL+LDEAT+++D+E++  I
Sbjct: 865 VEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKII 924

Query: 636 NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
             T+ R  + +  TI++IAHR+ T+  S+ I+VL + G+V E    + L  D+ S  + L
Sbjct: 925 QDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLSDKGSIFYSL 981

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 113/225 (50%), Gaps = 26/225 (11%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLR-------KHLGV 537
           G  +C+VG  G GKST    +L      SG            S +SL          L  
Sbjct: 94  GDLICVVGRVGAGKSTFLKAILGQLPCMSG------------SKESLAPKLIIRASSLAY 141

Query: 538 VQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALL 597
             QE  +M+ ++R+NI +G  +  +  ++    K C     +   PDG +T++G +G  L
Sbjct: 142 CSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISL 199

Query: 598 SGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSKEITIVSIAH 655
           SGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I + L G+    K  TI+   +
Sbjct: 200 SGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTN 259

Query: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDED--SELFKLLNE 698
            +S ++ S+ I  L N G ++E G +  + + E+  S+L KLL E
Sbjct: 260 TVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEE 303

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 137/507 (27%), Positives = 237/507 (46%), Gaps = 56/507 (11%)

Query: 223  LHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLT 282
            LH +  FFD   VG +++R   D   V + +   +   +    C    + ++F I+  +T
Sbjct: 1084 LHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTI---FCLIQCLSIIFLIT-IIT 1139

Query: 283  SAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEG 338
               ++ A  +L+     GK   +  REL++    +   + +   E   G+ TI++F  E 
Sbjct: 1140 PRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCTIRAFGDEK 1199

Query: 339  K----EMRRYNTAVRRLF--NVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGE 392
            +     M + +   R  F  +VA +             VLG  SF+L L  G    +   
Sbjct: 1200 RFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGAFIVLGSGSFIL-LNIGD---IDSS 1255

Query: 393  LSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELT-----DYKKSVPSTVG 447
            L+  SLT  +L+T+        L   YS       +  RL E +     +Y ++    + 
Sbjct: 1256 LAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYSGIEQENYNENHIQALQ 1311

Query: 448  QTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
             +  P  G+IE  ++S  Y +     + K +  T+ P + + IVG +G GKSTI + L R
Sbjct: 1312 NSLWPEHGKIEVDNLSLRYASN-LPPVIKNVSFTVDPQTKIGIVGRTGAGKSTIITALFR 1370

Query: 508  FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR 567
                 +G I IDG DISK+   +LR+ + ++ Q+P+L +GTI+ N+     Y    DE R
Sbjct: 1371 LLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDPYDEY----DE-R 1425

Query: 568  AVAKKCFCHNFIT------------KFPDGYDTVIGPR------GALLSGGQRQRIAIAR 609
             + K     N I+             F   ++  +  R      G  LS G++Q + IAR
Sbjct: 1426 RIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVEGGLNLSQGEKQLLFIAR 1485

Query: 610  ALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAHRLSTIRRSENIVV 668
            +L+++PKI++LDEATS++D +S+  I   +     RS   TI++IAHRL ++   + ++V
Sbjct: 1486 SLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSRS---TILTIAHRLRSVIDYDKVLV 1542

Query: 669  LGNDGSVIEAGKFADLYRDEDSELFKL 695
            + + G V E     +L ++E S  + +
Sbjct: 1543 M-DAGEVKEYDHPYELLKNERSIFYSM 1568

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 111/471 (23%), Positives = 204/471 (43%), Gaps = 39/471 (8%)

Query: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFH---ISSTLTSAMIMFAP 290
            +G +I+ +  D++ VS  +++ I   V+A +   + + ++F    +S+    ++I+   
Sbjct: 442 NLGTVINLISIDSFKVSE-ISNCIYTTVQAVIMILIVIVLLFKFLGLSALAGISIILVMF 500

Query: 291 PL-LIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTA-- 347
           PL    A++ G   R     L+ +   ++R++E     I+ +K F  E        ++  
Sbjct: 501 PLNFKLASLLG---RCQELALRCTDERISRLNE-CLQNIRIVKYFAWENNISNDIKSSRQ 556

Query: 348 --VRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYT 405
             ++ LF  +    ++S  +F    ++  V+F  V  +     L   L+  +L+ F L  
Sbjct: 557 KELKFLFRKSLLWAVSSFLWFVTPTLVTSVTFA-VYIFVQQQELNAPLAFTTLSLFTL-- 613

Query: 406 EYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFS 465
               + +  LSN  S + +   +  R+ E  + + +       T  P   +I+FK  +  
Sbjct: 614 --LKTPLDQLSNMLSFMNQSKVSLERIVEFLNEEDTAKYN-QLTVSPDKNKIKFKKATLV 670

Query: 466 YPTRPTSQIFKKLRL-----TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG 520
           +          K RL         G    I+G +G GKS +   LL      SG+I++ G
Sbjct: 671 WNENDND--INKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPG 728

Query: 521 ----QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
                D+       L        Q   L++GT+R+NI +   Y    +  + V   C   
Sbjct: 729 LEPRHDMIP-DLNGLTNSFAYCSQSAWLLNGTVRNNIIFNGVYDE--NRYKNVIDACGLK 785

Query: 577 NFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 636
             +   P G  T IG +G  LSGGQ+QRI++ARA+    K ++LD+  SA+D  +   I 
Sbjct: 786 RDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI- 844

Query: 637 YTL---GRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
           Y +   G LM+++  T + + H +S   R     V+  +G V   G   +L
Sbjct: 845 YEICITGLLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQGTITEL 893

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 140/519 (26%), Positives = 225/519 (43%), Gaps = 55/519 (10%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            +L   + K  +     FF+   VG +I+R  SD   V  S+ +  S   K+ L   V V 
Sbjct: 1053 KLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVI 1112

Query: 273  MMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGI 328
            ++ +          +F   LL+    Y      +SREL++    S   +  +  E  NG 
Sbjct: 1113 LVGYN----MPWFFVFNMFLLVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGY 1168

Query: 329  KTIKS------FVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLA 382
              I +      F+    E  +YN      F    R           T VL      L   
Sbjct: 1169 SIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRWLSVRLQTIGATIVLATAMLAL--- 1225

Query: 383  YGSHLVLQGELSLGSLTAFMLYT-EYTGSSVFGLSNFYSELMKGAGAAS-----RLFELT 436
              + +  + +LS G +   M Y+ E TGS  + +    + +M      S        EL 
Sbjct: 1226 --TTMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVR---TTVMIETNIVSVERIVEYCELP 1280

Query: 437  DYKKSV-PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSG 495
               +S+ P        P  G IEFK+ S  Y       + K + + I P   + IVG +G
Sbjct: 1281 SEARSINPENRPDESWPSKGSIEFKNYSTKY-RENLDPVLKDINVRIKPCEKIGIVGRTG 1339

Query: 496  RGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITY 555
             GKST++  L R  +   G+I+ID  +IS +    LR HL ++ Q+     GT+R N+  
Sbjct: 1340 AGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLAIIPQDAQAFEGTVRTNLDP 1399

Query: 556  GLSYT--------------PSMD-----EIRAVAKKCFCHNFITKFPDGYDTVIGPRGAL 596
               Y+              P ++     EIR        +  ++   D  +  I   G  
Sbjct: 1400 FNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENGNVS---DVLNVKINENGTN 1456

Query: 597  LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            LS GQRQ + +ARAL+ + KIL+LDEAT+++D+E++  I  T+ R  + +  TI++IAHR
Sbjct: 1457 LSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHR 1514

Query: 657  LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            + T+  S+ I+VL ++G+V E    + L  D+ S  + L
Sbjct: 1515 IDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKASIFYSL 1552

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 113/218 (51%), Gaps = 12/218 (5%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
           G  VC+VG  G GKST    +L      SG+    G    K+  ++    L    QE  +
Sbjct: 665 GDLVCVVGRVGAGKSTFLKGILGQLPCMSGS---KGSIPPKLIIRA--SSLAYCSQESWI 719

Query: 545 MSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
           M+ ++R+NI +G  +  +  ++    K C     +   PDG +T++G +G  LSGGQ+ R
Sbjct: 720 MNSSVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKAR 777

Query: 605 IAIARALIKKPKILILDEATSALDVE-SEGAINYTL-GRLMRSKEITIVSIAHRLSTIRR 662
           +++ARA+  +  I +LD+  SA+D E S+  + Y L G+    K  TI+   + +  ++ 
Sbjct: 778 LSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKH 837

Query: 663 SENIVVLGNDGSVIEAGKFADLYRDE--DSELFKLLNE 698
           S+ I  L N G +IE G +  +   E  +S+L KLL E
Sbjct: 838 SQMIYALEN-GEIIEQGNYEGVMNRENTNSKLKKLLEE 874

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 140/532 (26%), Positives = 235/532 (44%), Gaps = 62/532 (11%)

Query: 197  FGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHN 256
            F +   + +LG      L  + +++ LH    F D   +G +++R   D    + ++ + 
Sbjct: 927  FTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKD----TDTLDNE 982

Query: 257  ISDGVK------AALCGGVGVGM----MFHISSTLTSAMIMFAPPLLIAATIYGKRIRAI 306
            I++ V+      A L G + + +     F I+      + +F      A+    KR+ A+
Sbjct: 983  ITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQASGREIKRMDAV 1042

Query: 307  SRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFF 366
             R    +  N      E   G+ TIK++ +E + + + +  + ++ N A     +   + 
Sbjct: 1043 QRSFVYNNFN------EVLGGMDTIKAYRSEQRFLMKSDFLINKM-NEAGYLVTSIQRWV 1095

Query: 367  SGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGA 426
            + +  +  V F L++A    +  Q  +S GS+   + Y       +  L    ++     
Sbjct: 1096 AISLDMLAVIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQTQTENDL 1154

Query: 427  GAASRLFELTDYKKSVPSTVGQTFV--------PRDGRIEFKDVSFSY-PTRPTSQIFKK 477
             +A RL    +Y   +P       +        P +GRI+F++VS +Y P  P +   K 
Sbjct: 1155 NSAERL---VNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAYRPELPVA--LKN 1209

Query: 478  LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
            + + I     + I G +G GKSTI S L R  +  +G I ID  DIS +    LR  L +
Sbjct: 1210 VSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKLAI 1269

Query: 538  VQQEPVLMSGTIRDNITYGLSYT----------------PSMDEIRAVAKKCFCHNFIT- 580
            + Q+PVL  G IR N+      T                  +D IRA  K     N ++ 
Sbjct: 1270 IPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDA---NGLSG 1326

Query: 581  -KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 639
              F    D ++   G+  S G+RQ +A+ RAL++  KILILDEATS++D  ++  I    
Sbjct: 1327 DMFKFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKIQ--- 1383

Query: 640  GRLMRS-KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
             R++      TI+ IAHRL TI     I+VL + G V+E      LY D DS
Sbjct: 1384 SRIVEEFSNCTILCIAHRLKTILAYNRILVL-DQGQVVEFDTPKKLYNDRDS 1434

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 75/261 (28%), Positives = 118/261 (45%), Gaps = 35/261 (13%)

Query: 423 MKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQI-------F 475
           +K A      FEL +  K V    G+T    D       VS +   + +S+I       F
Sbjct: 540 VKNASFEWDNFELEE-AKDVAKLKGETLSISD------KVSTTETEKASSEIEQTPFRGF 592

Query: 476 KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHL 535
             L   +     + I GP G GKS++ + L  F   +SG++ I G D+            
Sbjct: 593 HGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL------------ 639

Query: 536 GVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGA 595
            ++   P + + T++DNI +G  +     + + V + C     +   P G  T IG RG 
Sbjct: 640 -LLCGYPWVQNATVKDNILFGSPFDKP--KYQKVIEICSLQADLDILPAGDRTEIGERGI 696

Query: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALD--VESEGAINYTLGRLMRSKEITIVSI 653
            LSGGQ+ RIA+AR++ K   I + D+  SA+D  V         +G L   K+ T +  
Sbjct: 697 TLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYL---KQKTRILA 753

Query: 654 AHRLSTIRRSENIVVLGNDGS 674
            H+LS I ++  ++ LG DGS
Sbjct: 754 THQLSLIDKASRVIFLGLDGS 774

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 140/531 (26%), Positives = 221/531 (41%), Gaps = 64/531 (12%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  L+  +G      L  + +++ LH    + D   +G +++R   D   +   +T ++
Sbjct: 942  GQYTLICYMGVTASKVLNLKAVERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESL 1001

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLI-------AATIYGKRIRAISREL 310
                       +GV +M  I     +  I F   + +       A+    KR+ AI R  
Sbjct: 1002 R-LFMTQFANIIGVCVMCIIYLPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSF 1060

Query: 311  QQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTN 370
              +  N      E   G+ TIK++ ++     R+      L N     G           
Sbjct: 1061 VYNNLN------EVLGGMDTIKAYGSQ----ERFLVKTDFLINKMNEAGYLLVALQRWVA 1110

Query: 371  VLGD---VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAG 427
            +  D   V+F L+++    +  Q  +S  S+   + Y       +  +    ++      
Sbjct: 1111 IFLDMIAVAFALIISLLC-VTRQFHISPASVGVLLTYVLQLPGLLNTILRALTQTENDMN 1169

Query: 428  AASRLF----EL---TDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLR 479
            +A RL     EL    DYK+  P        P  G I F+DVSF+Y P  P   + K + 
Sbjct: 1170 SAERLVYCANELPLEADYKR--PELAPPESWPSKGEIVFEDVSFAYRPGLPV--VLKGIS 1225

Query: 480  LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQ 539
            L I     + I G +G GKSTI S L R  + + G I ID  DI ++    LRK L ++ 
Sbjct: 1226 LDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIP 1285

Query: 540  QEPVLMSGTIRDNITYGLSYTP-------------SMDEIRAVAKK--------CFCHNF 578
            Q+PVL  GTIR N+     +               S +E+  V  +           H F
Sbjct: 1286 QDPVLFRGTIRKNLDPFQEHPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF 1345

Query: 579  ITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYT 638
                    D  +   GA  S G+RQ +A+ RAL+++ KILILDEATS++D E++  I   
Sbjct: 1346 ------HLDQKVEEEGANFSLGERQLLALTRALVRQSKILILDEATSSVDYETDNKIQSR 1399

Query: 639  LGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDED 689
            +       + TI+ IAHRL TI   + I+VL   G + E      LY  +D
Sbjct: 1400 IAAAF--GDCTILCIAHRLKTILTYDRILVL-EQGEIEEFDTPRSLYEKKD 1447

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 107/215 (49%), Gaps = 24/215 (11%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           FK L + I  G  V I GP G GKS++ S +  F    SGT+ +DG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPS-MDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
             ++   P + + T+RDNI +G  Y     DE   V + C     I   P G  T IG R
Sbjct: 644 --LMCGYPWIQNATVRDNIIFGSPYDKERFDE---VVRVCSLKADIDILPGGELTEIGER 698

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIV 651
           G  LSGGQ+ RI +AR++ K   I + D+  SA+D      I     LGRL   K  T +
Sbjct: 699 GITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRI 755

Query: 652 SIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYR 686
              H+LS I ++  ++VLG DGS  EAGK  DL R
Sbjct: 756 LATHQLSLIEKASVVIVLGVDGS-FEAGKLEDLKR 789

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 141/517 (27%), Positives = 238/517 (46%), Gaps = 39/517 (7%)

Query: 200  MFLLKML--GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            + +LK L  G    +++ A+++ + LH    FFD    G +++R+  D  I+ + +   +
Sbjct: 979  LIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQELMVLL 1038

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPL-LIAATIYGKRIRAISRELQQSTGN 316
               + A       +G +  + S + +  ++FA  L +I A +    I A  R+L++  G 
Sbjct: 1039 LQLLFAI----TSLGAILLLISVIATKFLIFAFLLGIIYAVMITSYIPAF-RDLKRYEGI 1093

Query: 317  LTRVSEEQFN----GIKTIKSFVAE----GKEMRRYNTAVRRLFNVAKREGITSATFFSG 368
                  EQF+    G  TI+ F  E    G+  R+ +   R  + V+    +        
Sbjct: 1094 TRSPIFEQFSELLSGFVTIRGFGKEKSCMGQLFRKLDLNNRPAYYVS----VVQLWLCLR 1149

Query: 369  TNVLGDVSFLLVLAYGSHLVLQG--ELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGA 426
              VLG     LVL   + L L    EL  G     + Y      S    +   S +    
Sbjct: 1150 VEVLGS----LVLGATATLSLLNAKELGAGLAGLALTYAMPFSQSALWTATVSSNVEIKM 1205

Query: 427  GAASRLFELT--DYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTIT 483
             +  R+ E T  D + +    +  T       I F  V   Y P  P   + K +  T+ 
Sbjct: 1206 TSVERIKEYTEIDCEDTKAGALINTQWSGGAEISFDHVYVRYAPHLP--DVLKNVSFTLL 1263

Query: 484  PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
            P S V IVG +G GKST+   L R  +  +GTI I G DI+ ++ ++LR+ L V+ Q+P 
Sbjct: 1264 PNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQDPS 1323

Query: 544  LMSGTIRDNITYGLSYTPSMDEIRAVAKKC--FCHNFITKFPDGYDTVIGPRGALLSGGQ 601
            L SGTI+ NI     Y  S  E+   A++   F      +  +   +++   G  +S GQ
Sbjct: 1324 LFSGTIKSNIDPFGRY--SDQELTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQ 1381

Query: 602  RQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIR 661
            RQ + +ARAL++K KILILDEAT+++D E++  I   + R   S  I ++++AHR+STI 
Sbjct: 1382 RQLLCLARALLQKSKILILDEATASIDHETDATIQQVV-RDFSSGGI-VITVAHRMSTII 1439

Query: 662  RSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
              + ++VL  D  +++      L   ++    ++  E
Sbjct: 1440 DYDQVIVL--DSGIVKENNHPYLLLKQNGAFHQMCKE 1474

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 113/233 (48%), Gaps = 11/233 (4%)

Query: 459 FKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILI 518
           F++ S ++    T  + K L +         I+GPSG GKS++   LL   D   G+I  
Sbjct: 637 FRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSI-- 694

Query: 519 DGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNF 578
               + +      R       Q P + + T+++NI +   +  +    + V   C     
Sbjct: 695 ---RVPRGYMHDDRCSFAFCSQTPWITNATVKENIVFSSQF--NTKRYQEVLHACGLEED 749

Query: 579 ITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--N 636
           I +  +G +TV+G +G  LSGGQRQR+A+ARA+    + L+LD+  SA+D      I   
Sbjct: 750 ILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWIFQK 809

Query: 637 YTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDED 689
             +G LM+ K  T +   H ++ +++  ++++L ++G V + GK  D   D +
Sbjct: 810 CIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFDSE 860

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 127/536 (23%), Positives = 248/536 (46%), Gaps = 61/536 (11%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G++++  + G     ++ A+++         F D   VG +++R   D  I+ + +  N 
Sbjct: 1058 GKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFHDITPVGRIMNRFSKDMDIIDQQLIPNF 1117

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----S 313
             +G+  ++   V + ++F I   +T   ++FA PL     I G      SREL++    +
Sbjct: 1118 -EGLFYSVV--VCLWVIFLIG-YITPRFLLFAIPLCALYYIVGSLYLRASRELKRIDNIN 1173

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRR------LFNVAKREGITSATFFS 367
               + ++  E   G+ TI++   E + + +   A+ +        N+A  E IT      
Sbjct: 1174 VSPIHQLFTEAIKGVATIRALADERRFITQTLVAIDKSNAPFFYLNLAT-EWITYRVDII 1232

Query: 368  GTNVLGDVSFLLVL------AYGSHLVLQGELSLGSLTAFMLYT----EYTGSSVFGLSN 417
            G  +L   S ++VL      A  + ++L    S      +++      E   SSV  +  
Sbjct: 1233 GALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTETAQWIIKVFSGVELLMSSVERIKE 1292

Query: 418  FYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKK 477
            +    ++ + + +    L ++             P+ G IEF++++  Y    +S+    
Sbjct: 1293 YVDVPLESSESNNYATPLANW-------------PQTGDIEFENLTLRYSPH-SSKALDG 1338

Query: 478  LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
            +   +  G+ V IVG +G GKS+I + + R  D   GTI+ID +DI  V  + LR  +  
Sbjct: 1339 VSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVPLECLRNSISC 1398

Query: 538  VQQEPVLMSGTIRDNITYGLSYT-----PSMDEIRAVAK-KCFC------------HNFI 579
            + Q P L  GTIR N+     Y+      +++++  + + +  C            H   
Sbjct: 1399 IPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQKLSYPSNHKLR 1458

Query: 580  TKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL 639
             +F D  +TV+   G+ +S GQRQ + +AR+++    I+++DEAT+++D  S+  I  T+
Sbjct: 1459 NRFID-LNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYVSDAKIQKTI 1517

Query: 640  GRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
               MR+   T+++IAHRL ++   + I+V+ + G V E     +L  D+++   +L
Sbjct: 1518 RETMRNT--TVLTIAHRLRSVIDYDKILVM-DMGRVEEYDHPYNLISDKNTIFHRL 1570

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 115/234 (49%), Gaps = 9/234 (3%)

Query: 456 RIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515
           ++ F++ +  +    TS   K + +     +   I+GP+G GKS++   LL   +  SG 
Sbjct: 664 KLGFENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGK 723

Query: 516 I---LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKK 572
           I    +  +D  ++    +   +    Q P L+SGTI+DNI +G  +  +  +   V K 
Sbjct: 724 INVPTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFGEFF--NQQKFDDVIKC 781

Query: 573 CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESE 632
           C     I     G  T +G  G  LSGGQ+QRIA+ARA+    + L+ D+  SA+D E+ 
Sbjct: 782 CCLEKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETA 841

Query: 633 GAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
             I      G +M+ +  T +  +H +S I +    +V+ ++G V   GK +DL
Sbjct: 842 LHIYEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDL 893

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  127 bits (318), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 139/535 (25%), Positives = 242/535 (45%), Gaps = 55/535 (10%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G++++  + G     ++ ++++         F D   VG +++R   D  I+ + +  N 
Sbjct: 1045 GKVWVAMLSGTNATKKIFSKLLSSIFEAKLRFHDITPVGRIMNRFSKDMDIIDQQLIPNF 1104

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----S 313
             +G+  ++   + + ++      +T   ++FA PL       G      SREL++    +
Sbjct: 1105 -EGLFYSVVVCLWIVILI---GYVTPRFLIFAIPLCGLYYFVGALYLRASRELKRIDNIN 1160

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRR---------LFNVAKREGITSAT 364
               + ++  E   G+ TI++   E    RR+ T              +     E IT   
Sbjct: 1161 VSPIHQLFTEAIKGVVTIRALADE----RRFITHTLEAIDGSNAPFFYLSVATEWITYRV 1216

Query: 365  FFSGTNVLGDVSFLLVLAYGSHLV--LQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSEL 422
               G  VL   S L+++A   +L   L G L    L+    +TE T   +  + +    L
Sbjct: 1217 DIIGALVLFSSS-LMIIARAPYLDAGLAGIL----LSNAFSFTE-TAQWIIKVFSGVELL 1270

Query: 423  MKGAGAASRLFEL-TDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLT 481
            M          E+  ++ KS  S       P+ G IEFK++S  Y    +S+    +   
Sbjct: 1271 MSSVERIKEYIEVPLEFSKSNDSATSPVDWPQTGEIEFKNLSLRYSPH-SSKALDNVSFK 1329

Query: 482  ITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
            +  G+ V IVG +G GKS+I + + R  D  SGTI+ID +DI  VS + LR  +  + Q 
Sbjct: 1330 VRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDIKCVSLECLRNSISCIPQN 1389

Query: 542  PVLMSGTIRDNITYGLSYTPS--MDEIRAVA----KKCFCHNFIT-----------KFPD 584
            P L  GTIR N+     Y+     D +  V      +  C   +T           KF D
Sbjct: 1390 PTLFDGTIRSNLDPYNQYSDKQVFDALAKVGLIERNEVLC--LVTDRQQSSSFSPNKFSD 1447

Query: 585  GYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMR 644
              ++V+   G+ LS GQRQ + +AR+++   KI+++DEAT+++D  S+  I  T+   M 
Sbjct: 1448 -LNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATASIDYISDAKIQKTIRETME 1506

Query: 645  SKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
            +   TI++IAHRL ++     I+V+ + G V E     +L  D+++ +F  L E 
Sbjct: 1507 NT--TILTIAHRLRSVIDYNKILVM-DMGRVKEYDHPYNLISDKNT-IFHHLCEQ 1557

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 120/464 (25%), Positives = 205/464 (44%), Gaps = 31/464 (6%)

Query: 233 NKVGDLISRLGSDAYIVSRSMT--HNISDGVKAALCGGVGVGMMFHISSTL-TSAMIMFA 289
           N V +++S    DA+ VS +M+  +   + V   +   V +  +   S+   T A+I   
Sbjct: 448 NSVNNIMS---VDAFKVSEAMSTFYLACEAVFMTITALVTLYSLLGWSAFAGTFALIAMI 504

Query: 290 PPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEG----KEMRRYN 345
           P     AT YGK     + +L  +    + +SE   N I+ IK    E     K M    
Sbjct: 505 PLNFWCATFYGKYQ---ADQLLLTDKRTSDISE-ALNSIRVIKVLAWEKLFYQKIMNIRE 560

Query: 346 TAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYT 405
             +R L   A    +    +F G  ++  V+F + + +     L   ++  +L+ F +  
Sbjct: 561 GEIRILRKKATIFFLNHLIWFFGPTLVSVVTFAVFIKFQKQ-TLTPSVAFTALSLFAILR 619

Query: 406 EYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFS 465
               + +  +++  S L++   +  R+    DY     ++  +       ++ FKD +  
Sbjct: 620 ----TPMDQIASTISLLVQSFISLKRI---EDYLDESETSKYEILTQSKSKVGFKDANME 672

Query: 466 YPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILI---DGQD 522
           +    TS   K + +     S   I+GP+G GKS++   LL   +  SG I +   D +D
Sbjct: 673 WDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQIYVPSVDSRD 732

Query: 523 ISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKF 582
             +V    +   +    Q P L+SGTI DNI +G    P+     AV K C     +   
Sbjct: 733 DLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ERPNQRRFNAVIKACCLEKDVKAM 790

Query: 583 PDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLG 640
             G  T +G  G  LSGGQ+QR+A+ARA+    + L+LD+  SA+D E+   I      G
Sbjct: 791 SAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPETALNIYEKCLCG 850

Query: 641 RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            +M+ +   I S  H +S I +    +V+ ++G V   GK +DL
Sbjct: 851 PIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQGKPSDL 892

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 143/535 (26%), Positives = 226/535 (42%), Gaps = 76/535 (14%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  LL  +G      L  Q + K LH    F D N +G +++R   D   +   +T N+
Sbjct: 960  GQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENL 1019

Query: 258  SDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIA-----------ATIYG------ 300
               + + +   +GVG M           I++ P   IA           A  Y       
Sbjct: 1020 RLAM-SQIANIIGVGAM----------CIIYLPWFAIAIPFLLLIFLLIADHYQSTGREV 1068

Query: 301  KRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGI 360
            KR+ AI R    +  N      E   G+ TIK++ A+     R+ T    L +       
Sbjct: 1069 KRLEAIQRSFVYNNLN------EMLTGMDTIKAYNAQD----RFATKSEFLIDKMNEAAY 1118

Query: 361  TSATFFSGTNVLGD---VSFLLV---LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVF- 413
             S        +  D   V+F L+   L       + G    G L  ++L      ++V  
Sbjct: 1119 ISIAVQRWAGIFLDLVAVAFALIITLLCVTRQFHISGA-DTGVLLTYVLQLPGLLNTVLR 1177

Query: 414  ---GLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTR 469
                  N  +   +    A++L +   Y+K  P        P++G I F++++F+Y P  
Sbjct: 1178 ALTQTENDMNSTERLVSYATQLPQEAQYRK--PECSPPIDWPQNGHIVFENINFAYRPGL 1235

Query: 470  PTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAK 529
            P   I K   L I P   + I G +G GKSTI + L R  +  +G I+ID  DIS +   
Sbjct: 1236 PI--ILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLY 1293

Query: 530  SLRKHLGVVQQEPVLMSGTIRDNITYGLSY----------------TPSMDEIRAVAKKC 573
             LR  L ++ Q+PVL  G IR N+     Y                +  ++ +++  K  
Sbjct: 1294 ELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNS 1353

Query: 574  FCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 633
               N + KF    +  +   G   S G+RQ +A+ RAL+++ KILILDEATS++D E++ 
Sbjct: 1354 DAKN-LHKF--HLNQSVDEDGNNFSLGERQVLALTRALVRQSKILILDEATSSVDYETDA 1410

Query: 634  AINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
             I   +         TI+ IAHRL TI   + I+VL   G V E     +L+ ++
Sbjct: 1411 KIQNLIATAF--NHCTILCIAHRLKTILNYDRILVL-EKGEVAEFDTPWNLFNND 1462

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 99/216 (45%), Gaps = 21/216 (9%)

Query: 474 IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRK 533
           +   +  TI  G  V + GP G GK+++   L    +  SG +   G  +          
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSGDLLL--------- 674

Query: 534 HLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
             G+    P + + TIRDNI +G  Y P+    + V   C   + +   P    T +G R
Sbjct: 675 -CGI----PWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVS 652
           G  LSGGQ+ RI++ARA+ K   I + D+  SA+D       ++Y +   +  K  T + 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 653 IAHRLSTIRRSENIVVLGN--DGSVIEAGKFADLYR 686
             H+LS + +++ I+VL    D    E G F +L +
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKELIK 821

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  125 bits (315), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 131/489 (26%), Positives = 221/489 (45%), Gaps = 62/489 (12%)

Query: 218  VIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHI 277
            V+ K LH    FFD    G +++RL  D   V + +     +G  AA+   +   ++   
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYF-EGSFAAVVQCISTLVLI-- 1170

Query: 278  SSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNGIKTIKS 333
             + +T   ++ A  +     + G      SREL++    +   + +   E   GI +I++
Sbjct: 1171 -AYVTPQFLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRA 1229

Query: 334  FVAEGKEM----RRYNTAVRRLFN-------VAKREGITSA--TFFSGTNVLGDVSFLLV 380
            +  E + M     R +   R  F        +A R  +  A  TFFSG          + 
Sbjct: 1230 YGDERRFMLENLSRIDDNNRPFFYLWIANRWLAFRVDLLGALVTFFSG--------LFIY 1281

Query: 381  LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKK 440
            L  G    L   L+  SLT  + +TE            YS +     +  RL E  + ++
Sbjct: 1282 LNIGK---LDAGLAGISLTYAIFFTE----GALWFVRHYSNVEMTMNSFERLKEYMEIEQ 1334

Query: 441  SVPSTVGQ---TFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRLTITPGSNVCIVGPSGR 496
               +   Q      P+ GRI+  D+S  Y P  P  ++ K +  ++ P   V IVG +G 
Sbjct: 1335 EPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGA 1392

Query: 497  GKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIR------ 550
            GKSTI + + RF D  +G + ID  DI+ +    LR+ + ++ Q+P L +GT++      
Sbjct: 1393 GKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPY 1452

Query: 551  ----DNITY------GLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
                D   Y       L     ++ + + + +    N I KF D  +  +   GA LS G
Sbjct: 1453 SQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGEN-INKFLD-LNNEVTEGGANLSQG 1510

Query: 601  QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
            QRQ + +AR+L++ PKI++LDEAT+++D  S+  I  T+    R    TI++IAHRL +I
Sbjct: 1511 QRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIREEFRDS--TILTIAHRLKSI 1568

Query: 661  RRSENIVVL 669
               + ++V+
Sbjct: 1569 IDYDKVLVM 1577

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 113/482 (23%), Positives = 205/482 (42%), Gaps = 58/482 (12%)

Query: 226 DAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAM 285
           +AE    + +G++I+ +  DA+ VS          + + L   +G  +M  +S      +
Sbjct: 446 NAEESKASNLGEIINLMAVDAFKVSE---------ISSYLYFFIGSFVMVVVSMIFLYRL 496

Query: 286 IMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----------EEQFNGIKTIKSF 334
           + ++  + +A  +    +  ++ +L Q  GNLT V+            E    I+ IK F
Sbjct: 497 LGWSALVGVALLV---AMLPLNYKLAQKLGNLTVVTLGFTDKRIQKLNETLQSIRIIKFF 553

Query: 335 VAEGKEMRRYNTAVRR--LFNVAKREGITSATFFSGTNVLGDVSFLLVLA-YGSHLVLQG 391
             E     +   A+R   L  + KR  + SA  F    +   VS ++V A +  ++ +QG
Sbjct: 554 AWE-TNFEKEVQAIREDELATLLKRAIVWSAISF----LWFMVSTIVVSASFACYIYIQG 608

Query: 392 ELSLGSLTAFMLYTEYTGSSVFG--------LSNFYSELMKGAGAASRLFELTDYKKSVP 443
           E+         +   +T  S+F         L++  S +++   +  R+    D  ++  
Sbjct: 609 EV-------LTIPVAFTALSLFVMLRNPLDVLADMLSYVVQSKVSLDRIQAFLDEDET-- 659

Query: 444 STVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIAS 503
            T  +       R+ F++ + ++   P+S   + + +    G      GP+G GKS++  
Sbjct: 660 -TKYEQLTISGNRLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLL 718

Query: 504 LLLRFYDANSGTILIDGQDISK---VSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYT 560
            LL       G I +   D  +   + A  L   +    Q   L++ T R NI +   Y 
Sbjct: 719 GLLGEMTLQEGKIYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFNSPYN 778

Query: 561 PSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILIL 620
                   V + C           G  T IG +G  LSGGQ+QRI++ARAL    + L+L
Sbjct: 779 E--QRYNDVLEACGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLL 836

Query: 621 DEATSALDVESEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEA 678
           D+  SA+D  +   I  N  +G LM  +  T V ++H ++   R+ + VV+  +G V   
Sbjct: 837 DDCLSAVDSHTALLIYENCIIGPLMEGR--TCVLVSHNVALTMRNADWVVILENGRVKAQ 894

Query: 679 GK 680
           G+
Sbjct: 895 GE 896

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 220/522 (42%), Gaps = 78/522 (14%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
            +L  +G      L  + +K+ LH    F D   +G +++R   D   +   +T ++   +
Sbjct: 949  VLCYMGLSAAKWLNLKAVKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVRLFL 1008

Query: 262  KAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321
              A    VGV +M           I++ P   IA         A++   Q S+  + R+ 
Sbjct: 1009 FQA-SNIVGVVIM----------CIIYLPWFAIAVPFLLLIFAAVADHYQSSSREIKRLE 1057

Query: 322  EEQ-------FN----GIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTN 370
              Q       FN    G+ TI+++  E     R+ T    L N     G          +
Sbjct: 1058 AVQRSHVFNNFNEVLSGMDTIRAYRGEA----RFLTKSDFLINKMNEAGYVVVAIQRWVS 1113

Query: 371  VLGDVSFLLVLAYGSHLVL-----QGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
            +  D   ++ +A+   + L     Q  +S  S+   + Y       V  L    + LM+ 
Sbjct: 1114 IALD---MIAMAFALIITLLCVTRQFSISAASVGVLLTY-------VLQLPGLLNTLMRA 1163

Query: 426  A-------GAASRLFEL-TD------YKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRP 470
                     +A RL    TD      Y++  P T      P +G I+F  VS +Y P  P
Sbjct: 1164 MTQGENDMNSAERLISYATDLPLEAAYRR--PETSPPESWPSEGAIDFDHVSLAYRPGLP 1221

Query: 471  TSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKS 530
               +   + L +  G  + I G +G GKSTI S L R  + + G+I IDG DI+++    
Sbjct: 1222 L--VLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITIDGIDIAQLGLYE 1279

Query: 531  LRKHLGVVQQEPVLMSGTIRDNIT--------------YGLSYTPSMDEIRAVAKKCFCH 576
            LR  L ++ Q+PVL  G +R N+                      + DE  A A      
Sbjct: 1280 LRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGAIATEDEAAARAVTRATA 1339

Query: 577  NFITKFPDGY-DTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
              +T     + +  +   G+  S G+RQ +A+ RAL++  +ILILDEATS++D E++  I
Sbjct: 1340 GALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEATSSVDYETDAKI 1399

Query: 636  NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIE 677
               +       E T++ IAHRL+TI   + I+VL + G V E
Sbjct: 1400 QARIADAF--SECTVLCIAHRLNTILDYDRILVL-DQGRVCE 1438

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 67/227 (29%), Positives = 107/227 (47%), Gaps = 24/227 (10%)

Query: 461 DVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDG 520
           D S S   +   + FK L + I  G  V + G  G GKS++ + +  F    SG I  +G
Sbjct: 580 DTSSSNEPKVNFKGFKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG 639

Query: 521 QDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIR--AVAKKCFCHNF 578
                    SL     ++   P + + T++DNI +G  +    DE R     + C     
Sbjct: 640 ---------SL-----LLCGYPWIQNTTVKDNILFGSPF----DEARYKETIRVCSLQAD 681

Query: 579 ITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINY 637
           +   P G  T IG RG  LSGGQ+ RI +AR++ KK  I + D+  SA+D    +  ++ 
Sbjct: 682 LDLLPAGDKTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDE 741

Query: 638 TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            +   +  K  T V   H+LS I R+  ++ +  DG+V ++G   +L
Sbjct: 742 CMMGALDGK--TRVLATHQLSLIARASKVIFIDLDGTV-DSGTLDEL 785

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 138/539 (25%), Positives = 229/539 (42%), Gaps = 71/539 (13%)

Query: 202 LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGV 261
           +L  LG      L  + +K  LH    F D   +G +++R   D    + SM + +++ +
Sbjct: 470 VLCFLGVTASKFLNLKAVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDI 525

Query: 262 KAALCGGVGVGMMFHISSTL--TSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTR 319
           +          MMF + + +      I++ P   IA          I+   Q S   + R
Sbjct: 526 RL---------MMFQLGNIIGVIVMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKR 576

Query: 320 VS-----------EEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSG 368
           +             E   G+ TI+++    +   R+      L N     G   A     
Sbjct: 577 LEAVQRSFVYNNLNEVLGGLDTIRAY----RSQDRFLVKSDFLINKMNEAGYMVAALQRW 632

Query: 369 TNVLGD---VSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKG 425
             +  D   V F L++     +  Q ++S  S    + Y       +  +    ++   G
Sbjct: 633 VAIFLDMLAVIFALIITLLC-VTRQFKISPSSTGVLLTYVLQLPGLLNTVLRALTQAENG 691

Query: 426 AGAASRLF-------ELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKK 477
             +A RL        +  +Y++  P        P  G I+F+ VSF+Y P+ P   + K 
Sbjct: 692 MNSAERLVTYALDLPQEAEYRR--PEMSPPENWPDRGEIKFEGVSFAYRPSLPP--VLKN 747

Query: 478 LRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGV 537
             L I  G  + I G +G GKSTI S L R  +   G I ID  +I+ +    LR  L +
Sbjct: 748 FSLNIGSGEKIGICGRTGAGKSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAI 807

Query: 538 VQQEPVLMSGTIRDNI---------------TYGLSYTP-SMDEIRAVAKKCF-CHNFIT 580
           + Q+PVL  GTI+ N+                 G +  P  ++E +A        H+ + 
Sbjct: 808 IPQDPVLFRGTIKKNLDPFGEKTDQELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMH 867

Query: 581 KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 640
           KF    +  +   G   S G++Q +A+ RAL++  +ILILDEATS++D E++  I     
Sbjct: 868 KF--HLEQKVEEEGGNFSLGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQ---S 922

Query: 641 RLMRS-KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
           R++ +  + TI+ IAHRL+TI   + I+VL   G V E     +L+  ED  +FK + E
Sbjct: 923 RIVEAFGDCTILCIAHRLNTILNYDRILVL-EQGEVAEFDTPWNLFTKEDG-IFKSMCE 979

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/223 (31%), Positives = 114/223 (51%), Gaps = 21/223 (9%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F+ L   I  G  + + GP G GK+++ S +  F   + G++ ++G+ +S          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
            G     P + + T+RDNI +G  Y  +  + R V K C   + +   P G  T IG RG
Sbjct: 156 CGY----PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVSI 653
             LSGGQ+ RI +AR + K   I + D+  SA+D    +  ++  L  L+  K  T +  
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK--TRILA 267

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
            H+L+ I ++  ++VLGNDGS    G + +L +  +S+L KLL
Sbjct: 268 THQLALIEKATRLIVLGNDGS-FTIGTYEELQK-SNSQLKKLL 308

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 124/490 (25%), Positives = 213/490 (43%), Gaps = 36/490 (7%)

Query: 229  FFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMF 288
            FF+   VG +++R  SD   +     H IS   ++ L   + + ++     T++    + 
Sbjct: 1082 FFETTPVGRIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVII-----TVSMPWFLL 1136

Query: 289  APPLLIAATIYGKRIRAI-SRELQQ----STGNLTRVSEEQFNGIKTIKSFVAEGKEMRR 343
               +L+    Y + +  + SREL++    S   +  +  E   G   I ++         
Sbjct: 1137 FNTILLGIYYYYQTLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY-KHANIFNY 1195

Query: 344  YN-----TAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSL 398
            YN     T +  +FN        S    +   V+  ++ L+ LA    L     +S G +
Sbjct: 1196 YNFENIQTNINFIFNFRSTNRWLSMRLQTIGAVIVLITSLMALA---SLGTSNPISAGLI 1252

Query: 399  TAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYK----KSVPSTVGQTFVPRD 454
               M Y     SS+  +      +     +  R+ E  D K    + +  +      P+ 
Sbjct: 1253 GLLMSYALQVSSSLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKR 1312

Query: 455  GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSG 514
            G I F+  +  Y       + K + L I     + +VG +G GKST+   L R  +   G
Sbjct: 1313 GEITFEHYTTKY-RENLDPVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEG 1371

Query: 515  TILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPS--MDEIRAVAKK 572
             I IDG DIS +    LR+ L ++ Q+     GT+R N+     +T +     +     K
Sbjct: 1372 KITIDGIDISTLGLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLK 1431

Query: 573  CFCHNFITKFPDG-------YDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATS 625
                  +++ PD         DT I   G  LS GQRQ + ++RAL+   KILILDEAT+
Sbjct: 1432 PHIERIVSELPDDENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATA 1491

Query: 626  ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
            A+D E++  I  T+    + +  TI++IAHR+ T+  S+ I+VL + G V E     +L 
Sbjct: 1492 AVDRETDKIIQETIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKEFDTPDNLL 1548

Query: 686  RDEDSELFKL 695
            ++++S  + L
Sbjct: 1549 KNKESLFYGL 1558

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 122/519 (23%), Positives = 227/519 (43%), Gaps = 70/519 (13%)

Query: 207 GERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH-NISDGVKAAL 265
           G ++   L + V +K+L   AE  +    GD+++ +  D   + R   +  I  G    L
Sbjct: 358 GLKIRGSLMSLVYQKSLRLSAEAREDKANGDVLNLMSVDVIRIQRFFENAQILVGSPIQL 417

Query: 266 CGGVGVGMMFHISSTLTSAMI--MFAPPLLIAATIYGKRI-RAISRELQQSTGNLTRVSE 322
                +G++  +   L +A I  + +  +++    Y  R+ + + +   Q      +   
Sbjct: 418 -----IGVLISLYVLLGNATIGGLVSIVIMVPINSYMTRLYKKLFKTQMQYKDKRIKTVT 472

Query: 323 EQFNGIKTIKSFVAEGKEMRRYNTAVR---RLFNVAKREGITSATFFSGTNV--LGDVSF 377
           E  N +K+IK +  E   + R N  VR    L N+ K   +++  FF    V  L   S 
Sbjct: 473 EILNSMKSIKLYAWEKPMLDRLN-HVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCST 531

Query: 378 LLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL----- 432
            ++ +Y +  VL  ++   SLT F +  +    ++F +    S +++   +  RL     
Sbjct: 532 FVLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKGYLL 587

Query: 433 -FEL-TDYKKSVPSTVGQTFVPRDGRIEF----KDVSFSYPTRPTSQI------------ 474
             EL T + +   +T     V     +      K  + S  T   ++I            
Sbjct: 588 AEELDTSFIEHARATASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSIEN 647

Query: 475 --FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI-LIDGQDISKVSAKSL 531
              KK +LT       CIVG  G GKST       F  A  G +  +     S V  K +
Sbjct: 648 FSAKKAQLT-------CIVGRVGSGKST-------FLQAILGQLPCVSSDSASGVKPKVV 693

Query: 532 RK--HLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTV 589
            +  +L    Q+P +M+ +++DNI +G  Y  +M   +   K C     +   PDG  T+
Sbjct: 694 IRADNLAYCPQQPWIMNASLKDNILFGYKYDEAM--YKKTIKACQLLPDLEILPDGDQTL 751

Query: 590 IGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRS 645
           +G +G  LSGGQ+ R+++ARA+  +  + +LD+  SA+D    +  I+  L R   L+++
Sbjct: 752 VGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKN 811

Query: 646 KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
           K  T++   + ++ +  S+ I +L N G ++E+  + ++
Sbjct: 812 K--TVILTTNAVNVLVHSDMIYLLKN-GKIVESNSYEEV 847

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 136/267 (50%), Gaps = 21/267 (7%)

Query: 441  SVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKST 500
            S P T      P +G+I+FKD +F Y       I K   + +  G  + I G +G GKST
Sbjct: 786  SKPETSPGHIWPENGKIQFKDANFRYK-EGLPLILKNFNMLVQSGEKIGICGRTGAGKST 844

Query: 501  IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNI---TYG- 556
            I + L R  +   G I ID  DIS +    LRK+L ++ Q+P+L  GTIR N+   +Y  
Sbjct: 845  IMNCLFRLDELTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFD 904

Query: 557  ---------LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAI 607
                     LS     D     ++K   +  +TKF       +   G   S G++Q +A 
Sbjct: 905  DATLWEAMILSGFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEKQLLAF 962

Query: 608  ARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIV 667
             RA+I   K+++LDEA+S++D E++  I   + +       TI+ IAHRL+TI + + I+
Sbjct: 963  TRAIIHHSKVVVLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRIL 1020

Query: 668  VLGNDGSVIEAGKFADLYRDEDSELFK 694
            VL + G++I       L+  E++ELF+
Sbjct: 1021 VL-DHGNIIGFENPRVLF--ENNELFR 1044

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 99/212 (46%), Gaps = 22/212 (10%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L  +I  G  + I GP G GK+++   +        GTI IDG            + 
Sbjct: 205 FNNLNFSIX-GEFIIITGPIGTGKTSLLYAMSGLMKKLEGTIEIDGN----------LQL 253

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
            G     P + + T+RDNI +G  Y    ++   V + C     +  F     T IG  G
Sbjct: 254 CGY----PWVQNTTVRDNIIFGSKYEK--EKFDHVIRICALTEDLENFSGKDLTEIGELG 307

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIVS 652
             LSGGQ+ RI +ARA+ K   I + D+  SA+D      I  N  LG L  S +   + 
Sbjct: 308 ITLSGGQKARINLARAIYKTSDIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXXIL 365

Query: 653 IAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
             H+LS I++++ IVVLGND S  E G + +L
Sbjct: 366 ATHQLSLIKKADRIVVLGNDNS-FEIGPYKEL 396

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  113 bits (282), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 79/265 (29%), Positives = 135/265 (50%), Gaps = 23/265 (8%)

Query: 452 PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDA 511
           P+ G +E K++S  Y    +S+    +   +  G+ V IVG +G GKS+I + + R  D 
Sbjct: 28  PQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 512 NSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT----------YG----L 557
            +GTI ID +DI  +  + LR  +  + Q+P L  GT+R N+           YG    +
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKV 146

Query: 558 SYTPSMDEIRAVAKK----CFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIK 613
                 DE+  + ++       H    +F D  +TV+   G+ LS GQRQ + +AR+++ 
Sbjct: 147 GLIEECDELCLIFEQEQPNFSSHKLRNRFID-LNTVVKSGGSNLSQGQRQLLCLARSMLG 205

Query: 614 KPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDG 673
              I+++DEAT+++D  S+  I  T+   M  K  TI++IAHRL ++   + I+V+   G
Sbjct: 206 ARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDKILVMEM-G 262

Query: 674 SVIEAGKFADLYRDEDSELFKLLNE 698
            V E      L  D ++  ++L  +
Sbjct: 263 RVKEYDHPYTLISDRNTIFYRLCRQ 287

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 139/519 (26%), Positives = 232/519 (44%), Gaps = 68/519 (13%)

Query: 198  GRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNI 257
            G+  LL  +G R    L  Q + + +H    F +   +G +++R   D    + S+ + I
Sbjct: 857  GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQI 912

Query: 258  SDGVKAAL---CGGVGVGMMFHIS-STLTSAMIMFAPPLLIAATIYGKRIRAISRELQQS 313
             D ++  +   C  VG+ ++  I       A+      L +A + Y    R I R     
Sbjct: 913  LDNLRFVVYQACTIVGISVLCIIYLPWFAIAIPGLGLILFVACSHYQSSAREIKRLEAVQ 972

Query: 314  TGNLTRVSEEQFNGIKTIKSFVAEGK-------------EMRRYNTAVRRLFN-VAKREG 359
               +     +   G+ TI+++ AE +             E     TAV+R  N V    G
Sbjct: 973  RSFIYNHLNDVLGGVDTIRAYGAEERFSYKLDYLIDKTNEASYLYTAVQRWINIVINLVG 1032

Query: 360  ITSATFFSGTNV-----LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFG 414
            I+     S   V     L   S  +VL+Y   ++L  +L   +LT  +  TE   +SV  
Sbjct: 1033 ISFTLIVSLLCVTKVFNLSGASTGVVLSY---VLLIPDLLNNTLT-MVTQTENDMNSVER 1088

Query: 415  LSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQI 474
            L  + +EL + A           + + VPS       P +G I+F++V +++       +
Sbjct: 1089 LVTYATELPQEAS----------HGEEVPSKTW----PENGEIKFENVRYTHRD-GLPAV 1133

Query: 475  FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
              K  L I  G  V I G +G GKST+   L R  +  SG ++ID  D+SK++  +LR  
Sbjct: 1134 LDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRSR 1193

Query: 535  LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFI---TKFPDGYDT--- 588
            L ++ Q+PVL  G++R N+     Y    D ++    +C    F     +  +G DT   
Sbjct: 1194 LAIIPQDPVLFQGSVRHNLDPFGEYDD--DVLKNALMRCTVGKFNKTGNESTEGIDTDAD 1251

Query: 589  --VIG---------PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINY 637
              ++G           G   S G+RQ +A+ARALI+   IL+LDEAT+A+D  ++  +  
Sbjct: 1252 NGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNSSILVLDEATAAVDAATDAHVQR 1311

Query: 638  TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVI 676
             +    + +  T++ +AHRL TI   + I+VL N G +I
Sbjct: 1312 LVAEAFKGR--TVLCVAHRLDTILNYDRILVLEN-GKII 1347

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 108/453 (23%), Positives = 197/453 (43%), Gaps = 65/453 (14%)

Query: 268 GVGVGMMF-HISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFN 326
           G+ +G++  ++     S + +F   +++   ++G  ++ +   + Q T     +  E  N
Sbjct: 313 GICLGLLIKNLGGIAMSGVGLFFVTIIVVIFLFGIVMK-MRLNINQVTDQRVSILREVLN 371

Query: 327 GIKTIKSFVAEG------KEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLV 380
            IK +K +  E       K++R   T+  +L  +   + +  +  FS  N+   ++FL +
Sbjct: 372 NIKMVKLYCWEQAYEKSIKKIRSLETS--KLTRMEILKNVIFSVTFSLPNICSLMTFLAL 429

Query: 381 LAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAG-----AASRLFEL 435
                   + G L      A  +++  +   +  L +FY  L  G       +  R  E 
Sbjct: 430 FK------IHGGLK----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRFQEF 479

Query: 436 TDYKKS-----VPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQI-------FKKLRLTIT 483
            + ++S     +  T  + +      I+    SF + T             F  L   I 
Sbjct: 480 LEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIM 539

Query: 484 PGSNVCIVGPSGRGKST----IASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQ 539
            G  + IVGP G GK++    I  L+ ++   N G + +DG  +S               
Sbjct: 540 KGELIIIVGPIGSGKTSLLNAICGLMPQY--GNEGELEVDGSLVS--------------C 583

Query: 540 QEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYD-TVIGPRGALLS 598
             P + + T+RDNI +G  Y  S  + + V + C     + K    YD T IG RG  LS
Sbjct: 584 GYPWIQNTTVRDNILFGSKYDES--KFKRVIRMCSLEEDLEKLS-AYDMTEIGERGVTLS 640

Query: 599 GGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGRLMRSKEITIVSIAHRL 657
           GGQ+ RI +AR+L K+  I + D+  SA+D    +  +   L   +++K  T V   H+L
Sbjct: 641 GGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLMEGLKNK--TRVLATHQL 698

Query: 658 STIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
           S I +++ ++VLGNDG   + G++ DL +  ++
Sbjct: 699 SLIGKADQLIVLGNDGK-FDMGRYEDLIKTNET 730

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 141/516 (27%), Positives = 228/516 (44%), Gaps = 50/516 (9%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            +L   + K  +     FF+   VG +I+R  SD   V  ++ +  S   K+ L   V V 
Sbjct: 1053 KLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVI 1112

Query: 273  MM-FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ----STGNLTRVSEEQFNG 327
            ++ +++   L   M      L++    Y      +SREL++    S   +  +  E  NG
Sbjct: 1113 LVGYNMPWFLVFNMF-----LVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNG 1167

Query: 328  IKTIKS------FVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVL 381
               I +      F+    E  +YN      F    R           T VL       +L
Sbjct: 1168 YSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRSTNRWLSVRLQTIGATIVLATA----IL 1223

Query: 382  AYGSHLVLQGELSLGSLTAFMLYT-EYTGSSVFGLSNFYSELMKGAGAASRLFELTDY-- 438
            A  + +  + +LS G +   M Y+ E TGS  + +    + +     +  R+ E  +   
Sbjct: 1224 ALAT-MNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPP 1281

Query: 439  -KKSV-PSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGR 496
              +S+ P        P  G IEFK+ S  Y       +   + + I P   V IVG +G 
Sbjct: 1282 EAQSINPEKRPDENWPSKGGIEFKNYSTKY-RENLDPVLNNINVKIEPCEKVGIVGRTGA 1340

Query: 497  GKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYG 556
            GKST++  L R  +   G I+IDG DIS +    LR HL ++ Q+     GT++ N+   
Sbjct: 1341 GKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPF 1400

Query: 557  LSYTPSMDEIRAVAKKCFCHNFITKF-----------------PDGYDTVIGPRGALLSG 599
              Y  S DE++   ++      + K                   D  D  I   G+ LS 
Sbjct: 1401 NRY--SEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSV 1458

Query: 600  GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLST 659
            GQRQ + +ARAL+ + KIL+LDEAT+++D+E++  I  T+ R  + +  TI++IAHR+ T
Sbjct: 1459 GQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDR--TILTIAHRIDT 1516

Query: 660  IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            +  S+ I+VL + GSV E    + L  D+ S  + L
Sbjct: 1517 VLDSDKIIVL-DQGSVREFDSPSKLLSDKTSIFYSL 1551

 Score = 94.0 bits (232), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 117/486 (24%), Positives = 209/486 (43%), Gaps = 94/486 (19%)

Query: 262 KAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS 321
           KA + G V + +M  I++ L+                  ++++ +S+   +      +  
Sbjct: 434 KAVIGGLVTMAIMMPINAFLS------------------RKVKKLSKTQMKYKDMRIKTI 475

Query: 322 EEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVA--KREGITSATFFSGTN---VLGDVS 376
            E  N IK+IK +  E   M R N  VR    +   ++ GI S   +   N   ++   S
Sbjct: 476 TELLNAIKSIKLYAWEEPMMARLN-HVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCS 534

Query: 377 FLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL--FE 434
              + +  S   L   +   SL+ F +      S+++ + +  + +++ + +  RL  F 
Sbjct: 535 TFGLFSLFSDSPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKSFL 590

Query: 435 LTDYKKSVPSTVGQTFVPR-----DGR----IEFKDVSFSYPTRP---TSQIFKKLR--- 479
           L+D        +  +F+ R     D R    IE  +++F + ++    +SQ    LR   
Sbjct: 591 LSD-------EIDDSFIERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDE 643

Query: 480 ----------------LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT-------I 516
                                G  VC+VG  G GKST    +L      SG+       +
Sbjct: 644 ESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKL 703

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
           +I    ++  S            QE  +M+ ++R+NI +G  +    D      K C   
Sbjct: 704 IIRSSSVAYCS------------QESWIMNASVRENILFGHKF--DQDYYDLTIKACQLL 749

Query: 577 NFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE-SEGAI 635
             +   PDG +T++G +G  LSGGQ+ R+++ARA+  +  I +LD+  SA+D E S+  I
Sbjct: 750 PDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNII 809

Query: 636 NYTL-GRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLY--RDEDSEL 692
            Y L G+    K  TI+   + +S ++ S+ I  L N G ++E G + D+   ++  S+L
Sbjct: 810 EYVLIGKTALLKNKTIILTTNTVSILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKL 868

Query: 693 FKLLNE 698
            KLL E
Sbjct: 869 KKLLEE 874

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  114 bits (284), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 128/524 (24%), Positives = 222/524 (42%), Gaps = 65/524 (12%)

Query: 213  RLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVG 272
            +L   + +  L     FF+   VG +I+R  SD  +V + +  + +              
Sbjct: 1048 KLHDTMARAVLRSPMSFFETTPVGRIINRFSSDVNVVDQGLQFSFT------------YF 1095

Query: 273  MMFHISSTLTSAMIMFAPPL--------LIAATIYGKRIRAISRELQQSTGN-----LTR 319
             ++ ++   T  +I F  PL        L+    Y      +SREL++ T       ++ 
Sbjct: 1096 FIYILNYLFTVILISFNMPLFLLFNGILLVLYFYYQIYYITLSRELKRLTSISYSPIMSL 1155

Query: 320  VSEEQ-----FNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGD 374
            +SE        N  K ++ F     E  ++N  +  +FN        S         +G 
Sbjct: 1156 LSETLGGHLVINAYKHLQRFTYLNNESIQFN--INCMFNFRSTNRWLSMRL----QTIGA 1209

Query: 375  VSFLLVLAYGSHLV-LQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLF 433
            V  LL        +     LS G +   M Y     +S+  +     ++     +  R+ 
Sbjct: 1210 VLVLLTALLSLSTINTDKALSSGMVGLLMSYALQVTTSLTWIVRMSVQVETDIVSVERIL 1269

Query: 434  ELTDYKKSVPSTVGQTFVPRD----GRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVC 489
            E  +      + + ++  P++    G I F++ S  Y       + K + + I P   + 
Sbjct: 1270 EYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKY-RENLDPVLKDITVEIKPQEKIG 1328

Query: 490  IVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTI 549
            IVG +G GKST++  L R  + + G+I+IDG DI+K+    LR +L ++ Q+     GTI
Sbjct: 1329 IVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTI 1388

Query: 550  RDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTV------------------IG 591
            + N+     Y  S +EI    +       I K     +T                   I 
Sbjct: 1389 KSNLDPFGQY--SDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELLSARIT 1446

Query: 592  PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
              G  LS GQRQ + ++RAL+   KIL+LDEAT+A+D+E++  I  T+    + +  TI+
Sbjct: 1447 ENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TIL 1504

Query: 652  SIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKL 695
            +IAHR+ T+  S+ I+VL + G V E     +L  D+ +  + L
Sbjct: 1505 TIAHRIDTVMDSDKIMVL-DKGEVKEFDTPTNLLADKSTIFYNL 1547

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 116/216 (53%), Gaps = 14/216 (6%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
           G   CIVG  G GKST    +L      SG   +D     K+  ++  K +    Q+P +
Sbjct: 656 GDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--KSIAYCPQQPWI 710

Query: 545 MSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQR 604
           M+ +++DN+ +G  +  + D  +A  +KC     +   PDG  T++G +G  LSGGQ+ R
Sbjct: 711 MNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLSGGQKAR 768

Query: 605 IAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR---LMRSKEITIVSIAHRLSTI 660
           +++ARA+  +  + +LD+  SA+D E S+  +   L R   ++++K  T++   + +S +
Sbjct: 769 LSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTGILKNK--TVILTTNAVSVL 826

Query: 661 RRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLL 696
           + S+NI  L  DG ++E   +AD    +DS + K L
Sbjct: 827 KHSQNIYALL-DGEIVENKSYADAMSCDDSSILKTL 861

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 129/264 (48%), Gaps = 27/264 (10%)

Query: 452  PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDA 511
            P  G I+F D S  Y  +    +  K+ L I P   + IVG +G GKST+   L R  +A
Sbjct: 1293 PAHGSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEA 1351

Query: 512  NSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-----I 566
              G I+IDG DIS +    LR +L ++ Q+     GTIR N+     +    DE     I
Sbjct: 1352 TDGKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLD---PFDQHSDEELWKAI 1408

Query: 567  RAVAKKCFCHNFITKFPDGYDTV---------------IGPRGALLSGGQRQRIAIARAL 611
             A   K      I+   D  ++                I   G+ LS GQRQ + ++RAL
Sbjct: 1409 EASHLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRAL 1468

Query: 612  IKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGN 671
            +   KIL+LDEAT+++D+E++  I  T+      +  TI++IAHR+ T+   + I+VL +
Sbjct: 1469 LNHSKILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-D 1525

Query: 672  DGSVIEAGKFADLYRDEDSELFKL 695
             G V E      L  +++S  + L
Sbjct: 1526 KGEVREFDSPDTLLENKNSIFYNL 1549

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 106/435 (24%), Positives = 196/435 (45%), Gaps = 57/435 (13%)

Query: 300 GKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRL-FNVAKRE 358
            K+++++++E  +      R   E  N IK+IK +  E   ++R +     L     K+ 
Sbjct: 450 SKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKI 509

Query: 359 GITSATFFSGTN---VLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415
           GI S   F   N   ++   S  ++ A  S + L  ++   +L  F +  +    +++ +
Sbjct: 510 GIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSV 565

Query: 416 SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR---IEFKDVSFSY------ 466
            +  + +++ + +  RL      ++   S + Q+    DG    +E  + +F +      
Sbjct: 566 PSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNL 625

Query: 467 ---------PTRPTSQI-FKKL-RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515
                     T   +Q+ FK +    +  GS  CIVG  G GK+T+   +L      SG 
Sbjct: 626 VSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGA 685

Query: 516 -------ILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA 568
                  ++I G  I+               Q+  +M+ ++++NI +G  Y      +  
Sbjct: 686 QESIPPKLIIRGNSIA------------YCPQQAWIMNSSVKENILFGHKYDEHYYNLTI 733

Query: 569 VAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALD 628
            A  C     +   PDG +T++G +G  LSGGQ+ R+++ARA+  +  I +LD+  SA+D
Sbjct: 734 EA--CQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVD 791

Query: 629 VE-SEGAINYTLGR---LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            E S+  I   L     L++SK  TI+   + +S ++ S+ I  L N   +IE G + D+
Sbjct: 792 AEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDV 848

Query: 685 YR-DEDSELFKLLNE 698
               EDS+L  L+NE
Sbjct: 849 MNSSEDSKLKALINE 863

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 129/264 (48%), Gaps = 27/264 (10%)

Query: 452  PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDA 511
            P  G I+F D S  Y  +    +  K+ L I P   + IVG +G GKST+   L R  +A
Sbjct: 1321 PAHGSIKFIDYSTKY-RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEA 1379

Query: 512  NSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDE-----I 566
              G I+IDG DIS +    LR +L ++ Q+     GTIR N+     +    DE     I
Sbjct: 1380 TDGKIVIDGVDISTLGLSDLRSNLAIIPQDAQAFEGTIRTNLD---PFDQHSDEELWKAI 1436

Query: 567  RAVAKKCFCHNFITKFPDGYDTV---------------IGPRGALLSGGQRQRIAIARAL 611
             A   K      I+   D  ++                I   G+ LS GQRQ + ++RAL
Sbjct: 1437 EASHLKPHLERIISNRDDNSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRAL 1496

Query: 612  IKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGN 671
            +   KIL+LDEAT+++D+E++  I  T+      +  TI++IAHR+ T+   + I+VL +
Sbjct: 1497 LNHSKILVLDEATASVDMETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-D 1553

Query: 672  DGSVIEAGKFADLYRDEDSELFKL 695
             G V E      L  +++S  + L
Sbjct: 1554 KGEVREFDSPDTLLENKNSIFYNL 1577

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 106/435 (24%), Positives = 196/435 (45%), Gaps = 57/435 (13%)

Query: 300 GKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRL-FNVAKRE 358
            K+++++++E  +      R   E  N IK+IK +  E   ++R +     L     K+ 
Sbjct: 478 SKKVKSLNKEQMKYKDIRIRTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKI 537

Query: 359 GITSATFFSGTN---VLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGL 415
           GI S   F   N   ++   S  ++ A  S + L  ++   +L  F +  +    +++ +
Sbjct: 538 GIVSNCIFFAWNCVPIMVTCSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSV 593

Query: 416 SNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGR---IEFKDVSFSY------ 466
            +  + +++ + +  RL      ++   S + Q+    DG    +E  + +F +      
Sbjct: 594 PSTITNIIEVSVSLGRLKNFLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNL 653

Query: 467 ---------PTRPTSQI-FKKL-RLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGT 515
                     T   +Q+ FK +    +  GS  CIVG  G GK+T+   +L      SG 
Sbjct: 654 VSSENGDEESTIDNTQVAFKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGA 713

Query: 516 -------ILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA 568
                  ++I G  I+               Q+  +M+ ++++NI +G  Y      +  
Sbjct: 714 QESIPPKLIIRGNSIA------------YCPQQAWIMNSSVKENILFGHKYDEHYYNLTI 761

Query: 569 VAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALD 628
            A  C     +   PDG +T++G +G  LSGGQ+ R+++ARA+  +  I +LD+  SA+D
Sbjct: 762 EA--CQLTEDLKMLPDGDETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVD 819

Query: 629 VE-SEGAINYTLGR---LMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
            E S+  I   L     L++SK  TI+   + +S ++ S+ I  L N   +IE G + D+
Sbjct: 820 AEVSKNIIEKVLDEQTGLLKSK--TIILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDV 876

Query: 685 YR-DEDSELFKLLNE 698
               EDS+L  L+NE
Sbjct: 877 MNSSEDSKLKALINE 891

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 131/515 (25%), Positives = 228/515 (44%), Gaps = 41/515 (7%)

Query: 196  NFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTH 255
            N    FLL  +G     RL     K+ L+    F D   +G +++R   D  ++   +T 
Sbjct: 882  NLEFTFLLH-IGLSASRRLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTD 940

Query: 256  NISDGVKAALCGGVGVGMM-------FHISSTLTSAMIMFAPPLLIAATIYGKRIRAISR 308
            +    V   +   VGV ++         I+  ++  +++F      +A    KR+ AI R
Sbjct: 941  STRMFV-FQMANVVGVFILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQR 999

Query: 309  ELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSG 368
                +  NL  V     +G+ TI+++ A+ + +R+ +  + R  N A    I +  + + 
Sbjct: 1000 SFVYN--NLGEV----LDGLDTIRAYNAQSRFLRKSDYFLNRT-NEAGYLVIGARCWVAL 1052

Query: 369  TNVLGDVSFLLV--LAYGSHLVLQGELSLGSL-TAFMLYTEYTGSSVFGLSNFYSELMKG 425
            T  L  ++  L+  L   + ++     S G L T  +    Y    + G    ++EL   
Sbjct: 1053 TTDLVAIAIALIVTLLCVTRVIHITPSSAGVLLTVVLQMPAYFNMVLRG----FTELENN 1108

Query: 426  AGAASRLFELTDYKKSVPSTVGQTFVPRDG--------RIEFKDVSFSY-PTRPTSQIFK 476
              +  R+     Y  ++P    Q                I F++VSF+Y P  P +    
Sbjct: 1109 MNSTQRVHY---YATALPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAYRPGLPLA--LC 1163

Query: 477  KLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLG 536
             +   +  G  + I G +G GK+++ + L R  +  SG+I IDG DI+ +    LR  L 
Sbjct: 1164 GVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALS 1223

Query: 537  VVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFI-TKFPDGYDTVIGPRGA 595
            ++ Q+P+L  GT+R N+     +T        V         + T      D  +   GA
Sbjct: 1224 IIPQDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGA 1283

Query: 596  LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
              S G+RQ +A+ARAL++  +ILILDEATS++D  ++  +   +    R  + T++ +AH
Sbjct: 1284 NFSLGERQLLALARALVRSTRILILDEATSSVDYATDARVQARIAAEFR--QATVLCVAH 1341

Query: 656  RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
            RL TI   + I+VL + G V E      L+  +DS
Sbjct: 1342 RLRTIISYDRILVL-DQGRVAEFDTPYRLFARKDS 1375

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 102/212 (48%), Gaps = 20/212 (9%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
              L  +I  G  + ++G  G GK+++ + +  +    +G++ ++G  +           
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLL----------F 600

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPS-MDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593
            GV    P + + TIRDNI +G S+  +  DE   V   C        FP G  T +G R
Sbjct: 601 CGV----PWIQNATIRDNIIFGSSFDQTRYDE---VVNACALEADFKIFPAGDKTEVGER 653

Query: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSI 653
           G  LSGGQ+ RI++ARA+ K   I + D+  SA+D      I      L R +  T +  
Sbjct: 654 GITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQKC-LLDRLQNRTRILA 712

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLY 685
            H+L+ ++ +  ++ LG DGS  + G  A+L+
Sbjct: 713 THQLALVQEASRVIFLGQDGS-FDMGTPAELH 743

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 116/460 (25%), Positives = 203/460 (44%), Gaps = 47/460 (10%)

Query: 263 AALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATI---------YGKRIRAISRELQ-Q 312
           A  C  +  G  F I+  L S   +    + I   I         Y  RI+   +++Q +
Sbjct: 404 AQWCNIIWSGP-FQITLCLVSLYKLLGNSMWIGVFILIFMMPINSYLMRIQKKLQKIQMK 462

Query: 313 STGNLTRVSEEQFNGIKTIKSFVAEG--KEMRRYNTAVRRLFNVAKREGITSATFFSGTN 370
           +    TR+  E  N IK++K +  E   KE   Y    + L N+ K     + T F    
Sbjct: 463 NKDERTRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQFNI 522

Query: 371 V--LGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGA 428
           V  L   S   V  +     L  +L   +LT F L +    +    +++F    ++ + +
Sbjct: 523 VPFLVSCSTFAVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASIS 578

Query: 429 ASRLFE-LTDYKKSVPSTVGQTFVPRDGRIEFK---DVSFSYPTRPTSQI-FKKLRLTIT 483
            +RLF  LT+ +    +      V   G +  K   D +F +  +P  ++  K +     
Sbjct: 579 INRLFSFLTNEELQKDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPEYKVALKNINFQAR 638

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSA-KSLRKHLGVVQQEP 542
            G   CIVG  G GKS +   +L               D+ +V    ++   +  V Q P
Sbjct: 639 KGELTCIVGKVGSGKSALIQSIL--------------GDLFRVKGFATVHGDVAYVSQVP 684

Query: 543 VLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQR 602
            +M+GT+++NI +G  +     E     K C     ++  PDG  T++G +G  LSGGQ+
Sbjct: 685 WIMNGTVKENILFGHKFDKKFYE--KTIKACALTIDLSILPDGDSTLVGEKGISLSGGQK 742

Query: 603 QRIAIARALIKKPKILILDEATSALDVE-SEGAINYTLGR--LMRSKEITIVSIAHRLST 659
            R+++ARA+  +    + D+  +A+D    +  I + LG   L+ SK  T V   ++++ 
Sbjct: 743 ARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSK--TKVLATNKITV 800

Query: 660 IRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEH 699
           +  ++ I +L N G +I+ GK+ ++  D  S L KL+NE+
Sbjct: 801 LNIADYITLLDN-GEIIQRGKYEEVTSDPGSPLCKLINEY 839

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 89/366 (24%), Positives = 153/366 (41%), Gaps = 35/366 (9%)

Query: 214  LRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAY----IVSRSMTHNISDGVKAALCGGV 269
            L +Q++   L     FF+   +G +++R  +D Y    ++ R+ +   S+ VK       
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFSNAVK------- 1061

Query: 270  GVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVS-----EEQ 324
             V     +    T   I F  P+      Y +     SREL++   ++TR       +E 
Sbjct: 1062 -VTFTLVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRR-LDSVTRSPTISHFQET 1119

Query: 325  FNGIKTIKSFVAEGKEMRRYNTAVRRLFN--VAKREGITSATFFSG-TNVLGDVSFLLVL 381
              GI TI+ +    +E R  +   +R+ N   A    I    + +     LG V  L   
Sbjct: 1120 LGGISTIRGY---SQENRFIHINQQRVDNNMSAYYPSINCNRWLAFRLEFLGSVIILGAS 1176

Query: 382  AYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKS 441
              G + + QG ++ G +   + Y      S+  +     E+     +  R+ E ++    
Sbjct: 1177 TLGIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASE 1236

Query: 442  VPSTVGQ----TFVPRDGRIEFKDVSFSYPTRPTSQ---IFKKLRLTITPGSNVCIVGPS 494
             PS V         P+DG ++F      Y TR  +    + K + L I P   + IVG +
Sbjct: 1237 APSIVEDKRPDVNWPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRT 1292

Query: 495  GRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNIT 554
            G GKS++   L R  +A+ G I +DG +  ++    LR  L ++ Q+  +  GT+RDNI 
Sbjct: 1293 GAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNID 1352

Query: 555  YGLSYT 560
                YT
Sbjct: 1353 PTGQYT 1358

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (61%), Gaps = 3/115 (2%)

Query: 584  DGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLM 643
            +  +T +   G+ LS GQRQ + +ARAL+    IL+LDEAT+A+DVE++  I  T+    
Sbjct: 1424 NALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAF 1483

Query: 644  RSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            +++  TI++IAHRL+TI  S+ I+VL + G + E      L  D+DS  + L  +
Sbjct: 1484 KNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDSLFYSLCEQ 1535

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
            similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/373 (23%), Positives = 166/373 (44%), Gaps = 40/373 (10%)

Query: 202  LLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISD-G 260
            L+  LG R    +  Q + + LH    F D   +G +++R   D  I+   +T ++    
Sbjct: 942  LVSYLGLRASKNINLQSLHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLRMFS 1001

Query: 261  VKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYG-----KRIRAISRELQQSTG 315
             +  +  GV +  + ++     +  ++    +L++          KR+ A+ R    +  
Sbjct: 1002 YQFTVIWGVIIMSIIYLPWFAVAVPLLVVVFILVSDHYQCSAREIKRLEAVQRSFVLNNF 1061

Query: 316  NLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDV 375
            N      E  +G+ TIK++ AE + +++ +  + R+ N        S  + S   ++G +
Sbjct: 1062 N------EVISGVDTIKAYHAEARFLKKSDILIDRM-NEMTFPLYASQRWVSI--LIGMI 1112

Query: 376  SFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGA-------GA 428
            + L  L   S L + G  ++   +  +L T      V  L N ++ L++          +
Sbjct: 1113 AVLFALII-SILCVTGWFNISPASTGVLLT-----YVLQLPNLFNTLLRAMTQLENDMNS 1166

Query: 429  ASRLFELTD-------YKKSVPSTVGQTFVPRDGRIEFKDVSFSY-PTRPTSQIFKKLRL 480
            A R+    +       Y+  +P        P  G I F +V+ +Y P  P   + + +  
Sbjct: 1167 AERVLSYANSLPKEAPYR--IPEMAPPKAWPERGAITFDNVALAYRPGLPL--VLQDVSF 1222

Query: 481  TITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
             I+ G  + I G +G GKSTI + L R  + ++G++ IDG DI+ +   +LR  L ++ Q
Sbjct: 1223 HISSGEKIGICGRTGAGKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQ 1282

Query: 541  EPVLMSGTIRDNI 553
            +P+L  GTIR N+
Sbjct: 1283 DPLLFRGTIRKNL 1295

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 95/202 (47%), Gaps = 21/202 (10%)

Query: 475 FKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKH 534
           F  L   +  G  + I G  G GK+++ + L  F    +G I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 535 LGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRG 594
             +    P + + TIRDNIT+G  Y  ++   R V + C     ++  P G  T +G RG
Sbjct: 637 -MLFCGAPWIQNATIRDNITFGSPYDENL--YREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTLGRLMRSKEITIVS 652
             LSGGQ+ RI +AR + K   I + D+  SA+D     +I  +  LG+L    + T + 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRIL 750

Query: 653 IAHRLSTIRRSENIVVLGNDGS 674
             H++S   ++  ++ LG DGS
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS 772

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 5/105 (4%)

Query: 587  DTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS- 645
            D  +   G+  S G+RQ +A+ARAL+++ KILILDEATS++D E++  I     R+++  
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQ---ARIVQEF 1474

Query: 646  KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
            +  TI+ +AHRL TI   + I+V+   G V E      LY ++ S
Sbjct: 1475 QHATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGS 1518

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 117/241 (48%), Gaps = 9/241 (3%)

Query: 454 DGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANS 513
           + +  F+D S  +    TS   K + +     S   I+GP+G GKS++   LL   +  S
Sbjct: 648 NTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLS 707

Query: 514 GTILI---DGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVA 570
           G I +   + +D  ++    +   +    Q P L+SGTI+DN+ +G  +     +   V 
Sbjct: 708 GKIYVPTVESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFGEIFNK--QKFDDVM 765

Query: 571 KKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVE 630
           K C     I     G  T +G  G  LSGGQ+QRIA+ARA+    + LILD+  SA+D E
Sbjct: 766 KSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPE 825

Query: 631 SEGAI--NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
           +   I      G +M+ +   I S  H +S + +  + +V+ + G V   GK +DL +  
Sbjct: 826 TALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGKPSDLIKSN 883

Query: 689 D 689
           +
Sbjct: 884 E 884

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/245 (26%), Positives = 123/245 (50%), Gaps = 21/245 (8%)

Query: 455  GRIEFKDVSFSYPTRPTSQ-IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYD--- 510
            G   +KDV +  P + + + +  K+   + PG    ++G SG GK+T+ ++L +  D   
Sbjct: 800  GVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGL-TALMGASGAGKTTLLNVLAQRMDFGI 858

Query: 511  ANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSG-TIRDNITYGL-----SYTPSMD 564
             +SG IL+D + + +      ++ +G VQQ+ +     T+R+++ +          P  +
Sbjct: 859  VSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFSARLRRPDSVPDAE 914

Query: 565  EIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEA 623
            ++  V K       +    D  D V+G  G  L+  QR++++I   L+ KP +L+ LDE 
Sbjct: 915  KMEYVEKIIV----VLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDEP 970

Query: 624  TSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRS-ENIVVLGNDGSVIEAGKFA 682
            TS LD +S  AI   L RL  + +  + +I    +T+  S + +++L + GSV+  G   
Sbjct: 971  TSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGNIG 1030

Query: 683  DLYRD 687
            D  +D
Sbjct: 1031 DHSKD 1035

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 97/236 (41%), Gaps = 46/236 (19%)

Query: 473 QIFKKLRLTITPGSNVCIVGPSGRGKS----TIASLLLRFYDANSGTILIDGQDISKVSA 528
           +I  ++   I PG    ++G  G G S    T+A  L  F D + G I  DG     +  
Sbjct: 117 KILSQINFLIKPGEMCLVLGRPGAGCSSFLRTVAGELGNFTDVD-GEISYDG-----IPQ 170

Query: 529 KSLRKHLG---------VVQQEPVLMSGTIRDNITYGLSYTPSMDEI---------RAVA 570
           K + KH            V    + +S T+   I     ++ S ++I         R + 
Sbjct: 171 KEMIKHFKGDIIYNGEMDVHFPHLTVSQTLEMAIACKEPHSLSDEKIPKKQHIHGNRDLY 230

Query: 571 KKCF--CHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALD 628
              F   H F TK   G D V G     +SGG+R+R++IA A+  +  +   D ++  LD
Sbjct: 231 AGIFHLTHTFNTKV--GNDFVRG-----VSGGERKRVSIAEAMAARGSVYCWDNSSRGLD 283

Query: 629 VESEGAINY-----TLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
             S  A +Y     T+  L++S  +  V+I      I R  + V +  DG  I  G
Sbjct: 284 --SSSAYDYIKAIRTVSDLIKS--VAFVAIYQAGENIYRKFDKVTVLYDGRQIYYG 335

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 104/213 (48%), Gaps = 25/213 (11%)

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV 543
           PGS++ I+GP+G GK++I  ++   +   +   L+        S  + R+ + + Q+   
Sbjct: 600 PGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLL--------SVPAERELICIPQKPYF 651

Query: 544 LMSGTIRDNITYGLSYTPSMD------EIRAVAKKCFCHNFITKFPDG--YDTVIGPRGA 595
           +  GT R+ I Y +S     D      E+  V K+     ++ K   G  Y   +     
Sbjct: 652 IQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYLDAVAEWKD 710

Query: 596 LLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
           +LSGG+RQR+  AR +  KPK ++LDEAT+A+  + E   +Y    L R +    ++I+ 
Sbjct: 711 VLSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFNMLKRYR-FNFITISQ 766

Query: 656 RLSTIRRSENIVVLGNDGSVIEAGKFADLYRDE 688
           R S I+  +  + +G D    E+ +  DL  DE
Sbjct: 767 RPSLIKYHDLALEIGAD----ESWRLQDLGTDE 795

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 106/207 (51%), Gaps = 15/207 (7%)

Query: 490 IVGPSGRGKSTIASLLLRFYDANSGTI----LIDGQDISKVSAKSLRKHLGVVQQEPVLM 545
           + GP+G GKS +   LL       G I    L    ++  +    L   +    Q P ++
Sbjct: 724 VAGPTGAGKSLLLMSLLGETHLFKGEIHVPSLASKHEL-MIHGDGLTNSISYCSQIPWII 782

Query: 546 SGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRI 605
           + +I++NI +G  +  ++     V + C   N +    DG ++++G RG  LSGGQRQR+
Sbjct: 783 NDSIKNNILFGSEF--NLKRYNDVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRV 840

Query: 606 AIARALIKKPKILILDEATSALDVESEGAINYTL---GRLMRSKEITIVSIAHRLS-TIR 661
           ++ARA+  K   +ILD+  SA+D +    I Y L   G LM+ +  T + ++H +   I+
Sbjct: 841 SLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR--TCILVSHNVELVIK 897

Query: 662 RSENIVVLGNDGSVIEAGKFADLYRDE 688
           ++  +++L N  +  + G   DL +D+
Sbjct: 898 KAAYLLILDNRTTAYK-GPPGDLLKDK 923

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 124/263 (47%), Gaps = 40/263 (15%)

Query: 445 TVGQTFVPRD--GRIEFKDVSFSYPTRPTSQ-IFKKLRLTITPGSNVCIVGPSGRGKSTI 501
           T+ ++F+  D    + F++++++  +  T + I K +   I PG  + ++G SG GK+T+
Sbjct: 363 TLDESFLKSDNAAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTL 422

Query: 502 ASLLL--RFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGT 548
             +L   R     +G+I ++G DI +   K   K +G V Q           E VL S  
Sbjct: 423 LDILAMKRKTGQVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSAL 479

Query: 549 IRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRI 605
           +R  +    S+      +  V ++        +  D  D VIG    RG  +SGG+++R+
Sbjct: 480 LR--LPRSFSFAAKQTRVYQVLEE-------LRILDIKDRVIGNDFERG--ISGGEKRRV 528

Query: 606 AIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRS 663
           +IA  L+  P IL LDE TS LD  +   +   L RL ++   T+V   H  R +  +  
Sbjct: 529 SIACELVTSPLILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLF 588

Query: 664 ENIVVLGN-----DGSVIEAGKF 681
           + +V+L N      G  I  G+F
Sbjct: 589 DKLVLLSNGEMVYSGDAIRVGEF 611

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 99/197 (50%), Gaps = 23/197 (11%)

Query: 480 LTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQ 539
           + + PGS++ I+GP+  GKS+I  +L   +   + T L+       + A+S    L  + 
Sbjct: 593 MLLGPGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLV------SIPAES---DLMCIA 643

Query: 540 QEPVLMSG-TIRDNITYGLSYTPSMD------EIRAVAKKCFCHNFITKFPDG--YDTVI 590
           Q P  + G T RD I Y +S     +      E+  + K+    +++ K  +G  Y   +
Sbjct: 644 QRPYFIQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL-DYLLKRSEGLSYLDFV 702

Query: 591 GPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITI 650
                +LSGG++QR+  AR +  +PK L+LDEAT+A+ V+ E      L  ++R      
Sbjct: 703 ADWKDILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDMED----YLFNMLRKCRFNF 758

Query: 651 VSIAHRLSTIRRSENIV 667
           +SI+ R S I+  + ++
Sbjct: 759 ISISQRPSLIKYHDYLL 775

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 117/244 (47%), Gaps = 35/244 (14%)

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTIT----PGSNVCIVGPSGRGKSTIASLLL--RFYD 510
           + F+++S+  P    S+I +K+  +IT    PG  + I+G SG GK+T+  +L   R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 511 ANSGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIRDNITYGLSY 559
              GTI ++G  I     K   K +G V Q           E VL S  +R  +   + +
Sbjct: 456 RVQGTIAVNGHSILN---KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 560 TPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIARALIKKPK 616
           T     +  V ++        +  D  D +IG    RG  +SGG+++R++IA  L+  P 
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERG--ISGGEKRRVSIACELVTSPA 561

Query: 617 ILILDEATSALDVESEGAINYTLGRLMRSKEITIV-SIAHRLSTIRRSENIVVLGNDGSV 675
           IL LDE TS LD  +   +   L RL ++   T+V SI    S I    + +VL +DG +
Sbjct: 562 ILFLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEM 621

Query: 676 IEAG 679
           I +G
Sbjct: 622 IYSG 625

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 111/252 (44%), Gaps = 40/252 (15%)

Query: 442 VPSTVGQTFVPRDGRIEFKDVSFSYP---------TRPTSQIFKKLRLTITPGSNVCIVG 492
           +PS  G     +DG      +SF  P         +     I KKL     PGS++ I+G
Sbjct: 554 IPSKYG-----KDGTRLINKLSFQVPPVITLGNGNSDSNLNINKKLAFQ-GPGSSMLILG 607

Query: 493 PSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSG-TIRD 551
           P+G GK++I  ++   +   +   L+     S          L  V Q+P  + G T R+
Sbjct: 608 PNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASD---------LFCVPQKPYFIQGGTFRE 658

Query: 552 NITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG--YDTVIGPRGALLSGGQR 602
            I Y +S     D       K   H       +++ K   G  Y   +     +LSGG+R
Sbjct: 659 QIIYPMSADQYFD--MGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEWKDVLSGGER 716

Query: 603 QRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRR 662
           QRI  AR +  KP+ ++LDEAT+A+  + E   +Y  G L R +    ++I+ R S I+ 
Sbjct: 717 QRINFARIMFHKPRFVVLDEATNAISADME---DYLFGLLKRYR-FNFITISQRPSLIKY 772

Query: 663 SENIVVLGNDGS 674
            +  + +  DG+
Sbjct: 773 HDLALDISTDGT 784

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/243 (29%), Positives = 118/243 (48%), Gaps = 33/243 (13%)

Query: 457 IEFKDVSFSYP-TRPTSQ-IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN-- 512
           + FKD+ +  P  R  S+ +  ++   + PG  + ++G SG GK+T+  +L     A   
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIRDNITYGLSYTP 561
           SG I ++G+ ISK   K   K +G V Q           E VL S  +R  +   L +  
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALPFEA 510

Query: 562 SMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIARALIKKPKIL 618
               +  V ++        +  D  D +IG    RG  +SGG+++R++IA  L+  P IL
Sbjct: 511 KRSRVYKVLEE-------LRILDIKDKIIGNEFERG--ISGGEKRRVSIACELVTSPLIL 561

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIV-SIAHRLSTIRRSENIVVLGNDGSVIE 677
            LDE TS LD  +   +   L RL R+   T+V SI    S I +  + +VL ++G ++ 
Sbjct: 562 FLDEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVY 621

Query: 678 AGK 680
           +G+
Sbjct: 622 SGE 624

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 101/203 (49%), Gaps = 27/203 (13%)

Query: 483 TPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEP 542
           + GS++ I+GP+G GKS+I  ++   +   +   L+         +K    +L  V Q+P
Sbjct: 642 SAGSSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLL---------SKPTEANLLCVPQKP 692

Query: 543 VLM-SGTIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDGY---DTVIG 591
                GT+RD I Y +S     D  R +  K           +++ K   G+   DTV  
Sbjct: 693 YFTRGGTLRDQIIYPMSSDEFFD--RGLKDKLLVQVLREVKLDYLLKRDKGWSYLDTVSD 750

Query: 592 PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
            +  +LSGG++QR+  AR +  KP+ ++LDEAT+A+  + E   +Y    L R +    +
Sbjct: 751 WKD-VLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFNVLKRYR-FNFI 805

Query: 652 SIAHRLSTIRRSENIVVLGNDGS 674
           +I+ R S I+  + ++ + +D S
Sbjct: 806 TISQRPSLIKYHDLLLEISDDNS 828

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 102/225 (45%), Gaps = 43/225 (19%)

Query: 452 PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI---------A 502
           PR G ++          + T QI + +     PG    I+GPSG GKS++         +
Sbjct: 675 PRHGWLQ----------KKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNS 724

Query: 503 SLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYG----LS 558
           SLL++F+  ++G+IL++   ISK   KS+  ++     + +L S T+R+   +     L 
Sbjct: 725 SLLVKFH--STGSILLNTNSISKEMFKSVCSYVSQ-DDDHLLASLTVRETFEFAAALRLH 781

Query: 559 YTPS------MDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGAL-LSGGQRQRIAIARAL 611
           Y  S      +DEI        C N          TVIG      +SGG+++R+ I   L
Sbjct: 782 YMTSQQRRSKIDEILLALGLTHCEN----------TVIGNEFVKGISGGEKRRVTIGVQL 831

Query: 612 IKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
           +    IL+LDE TS LD  +  AI   L  L      T++   H+
Sbjct: 832 LNNSPILLLDEPTSGLDSFTSAAILEILENLCTEDGKTVIITIHQ 876

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 101/217 (46%), Gaps = 17/217 (7%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQ------DISKVSAKSLRKHLGVV 538
           GS + ++G SG GK+T+ ++L       S  + +DG+      D S+         +  +
Sbjct: 48  GSVMAVMGGSGSGKTTLLNVLA---SKVSKGLQLDGEIHYALEDNSEHFNADTEASMAYL 104

Query: 539 QQEPVLMSG-TIRDN--ITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG-PRG 594
            Q  VL +  T R+   I   L    S+++   +  +           D  +T++G  R 
Sbjct: 105 PQHDVLPARLTCRETLMIAADLKLKSSLEKKNEIVDQLLLE---LGLRDCANTLVGDARN 161

Query: 595 ALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEIT-IVSI 653
             LSGG+++R+++A  L+  P  + LDE T+ LD  S   +  +L +L R  + + I+S+
Sbjct: 162 RGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLARDGQKSFIMSV 221

Query: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDS 690
               S I    + V + + G+V+  GK  ++    DS
Sbjct: 222 HQPRSDIMFLLDSVCILSKGNVVYCGKTTEMIPYFDS 258

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 100/236 (42%), Gaps = 48/236 (20%)

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I+ +DVSF Y     S + K + L +   S + +VG +G GK+T+               
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLL-------------- 575

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
                   KV  + LR   G V + P L  G       +   +  SMD +   A      
Sbjct: 576 --------KVMMEQLRPTKGYVSRNPRLRIGY------FTQHHVDSMD-LNTSAVDWMSK 620

Query: 577 NFITKFPDGYDTVIGPRG----------ALLSGGQRQRIAIARALIKKPKILILDEATSA 626
            F  K  + Y   +G  G           LLSGGQ+ R+A A   +  P IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 627 LDVESEGAI-----NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIE 677
           LD     A+     N+T G LM S +I++  I H  S I  SE+  V   DG++ +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 52/97 (53%), Gaps = 11/97 (11%)

Query: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            SGG R R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +++   T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 657 LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELF 693
            + +      ++  ++  +       D YR +D + F
Sbjct: 424 RAFLNEVATDIIYQHNERL-------DYYRGQDFDTF 453

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 95/203 (46%), Gaps = 33/203 (16%)

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
           PGS++ I+GP+  GKS+I  ++      Y+ N G + I  +D            L  + Q
Sbjct: 682 PGSSLLILGPNSCGKSSIQRIIAEIWPIYNKN-GLMSIPAED-----------ELMCIPQ 729

Query: 541 EPVLMSG-TIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG---YDTV 589
            P    G T RD I Y +      D  R +  K            ++ K   G   +D V
Sbjct: 730 RPYFSKGGTFRDQIIYPMGSDEFFD--RGLKDKLLVQILADVKLEYLLKRDKGWSYFDAV 787

Query: 590 IGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEIT 649
              +  +LSGG++QR+  AR L  KP+ +ILDEAT+A+ V+ E      L ++++     
Sbjct: 788 FDWKD-VLSGGEKQRMNFARILFHKPRFVILDEATNAISVDMEDY----LFKMLKKYRFN 842

Query: 650 IVSIAHRLSTIRRSENIVVLGND 672
            +SI+ R S ++  + ++ +  D
Sbjct: 843 FISISQRPSLVKYHDLLLEISED 865

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 3/94 (3%)

Query: 605 IAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE 664
           I +ARAL++  KIL++DEAT+++D E++  +  T+      +++TIV+IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 665 NIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNE 698
            I+VL + G VIE      L ++E    + +  E
Sbjct: 60  KILVL-DAGQVIEYDHPYTLLKNESGHFYDICKE 92

>ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YDR011W
            (SNQ2), YNR070W and YPL058C (PDR12)
          Length = 1488

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 123/264 (46%), Gaps = 34/264 (12%)

Query: 440  KSVPSTVGQTFV----PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTIT----PGSNVCIV 491
            K V STVG   V      D    ++D+SFS          KKL   IT    PG+   ++
Sbjct: 831  KMVASTVGTDDVFDGLKNDDVFIWRDISFSITHNGDK---KKLLDQITGYCIPGTLTALM 887

Query: 492  GPSGRGKSTIASLLL-RFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTI 549
            G SG GK+T+ + L  R     +G +L++G  I      S  +  G VQQ+ V +   T+
Sbjct: 888  GESGAGKTTLLNTLAQRNVGVITGDMLVNGLPIDA----SFERRTGYVQQQDVHVKEMTV 943

Query: 550  RDNITYG--------LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQ 601
            R+++ +         +S    M+ +  + +       I    D  D ++G  G  L+  Q
Sbjct: 944  RESLQFSARLRRPESVSEAEKMNYVEKIIE-------ILGMSDFADALVGDAGYGLNVEQ 996

Query: 602  RQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
            R++++I   L+ KP +L+ LDE TS LD +S  AI   L RL +S +  + +I    +T+
Sbjct: 997  RKKLSIGVELVAKPSLLLFLDEPTSGLDSQSSWAIVQLLKRLAQSGQAILCTIHQPSATL 1056

Query: 661  -RRSENIVVLGNDGSVIEAGKFAD 683
              + + +++L   G  +  G   +
Sbjct: 1057 FEQFDRLLLLQKGGQTVYFGDIGE 1080

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 100/233 (42%), Gaps = 33/233 (14%)

Query: 469 RPTSQIFKKLRLTITPGSNVCIVGPSGRGKS----TIASLLLRFYDANSGTILIDG---Q 521
           R    I + + L   PG  V ++G  G G +    T+A    +F+    G I  DG   +
Sbjct: 172 RRYRNILESVTLLARPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVE-GAISYDGIPQR 230

Query: 522 DISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSY-TPSMDEIRAVAKKCFCHNFIT 580
           ++ +     +  +  +    P L   T++  + + L+  TP M  +  V++      +IT
Sbjct: 231 EMMRRYRAEVVYNSEIDVHFPHL---TVKQTLDFALACKTPHM-RVNNVSRA----EYIT 282

Query: 581 KFPDGYDTVIGPRGAL-----------LSGGQRQRIAIARALIKKPKILILDEATSALDV 629
              + Y TV G R              +SGG+R+R++IA AL     +   D AT  LD 
Sbjct: 283 LMRELYATVFGLRHTYDTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDA 342

Query: 630 ESEGAINYTLG-RLMRS--KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
            +  A+ Y    R+M +  +  ++V++      I  + + V++  +G  I  G
Sbjct: 343 ST--ALEYAQAMRIMTNLLQSTSLVTLYQASENIYETFDKVLVLFEGRQIYFG 393

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 114/235 (48%), Gaps = 9/235 (3%)

Query: 455  GRIEFKDVSFSYPTRPTSQIF-KKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANS 513
            G   ++DV +  P + T +I    +   + PG+   ++G SG GK+T+ + L +   AN 
Sbjct: 867  GVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAK--RANV 924

Query: 514  GTILIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTIRDNITYG--LSYTPSMDEIRAVA 570
            G +  D     K    S  +  G VQQ+ + +   T+R+++ +   L    S+ +   VA
Sbjct: 925  GIVTGDMSINGKPVDSSFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAEKVA 984

Query: 571  KKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATSALDV 629
                    +     G D ++G  GA L+  QR++++I   L+ KP +L+ LDE TS LD 
Sbjct: 985  DAETVMKLLDMEEYG-DALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDS 1043

Query: 630  ESEGAINYTLGRLMRSKEITIVSIAHRLSTI-RRSENIVVLGNDGSVIEAGKFAD 683
            +S  AI   L R+ ++ +  + +I    +T+  + + +++L   G  +  G   +
Sbjct: 1044 QSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1098

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 101/234 (43%), Gaps = 46/234 (19%)

Query: 473 QIFKKLRLTITPGSNVCIVGPSGRGKS----TIASLLLRFYDANSGTILIDG--QDISKV 526
           +I + + +   PG  + ++G  G G S    T A +  +F     G IL DG  Q++   
Sbjct: 178 KILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQNVMMK 237

Query: 527 SAKS---LRKHLGVVQQEPVLMSGTIRDNITYGLSY-TPSM--------DEIRAVAKKCF 574
           + KS       L V    P L   T++  + + ++  TP++        + IRA      
Sbjct: 238 NYKSDVIYNPELDV--HFPFL---TVKQTLDFAIACKTPAVRVNNVSRKEHIRATRD--- 289

Query: 575 CHNFITKFPDGYDTVIGP---RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVES 631
            +  I      YDT +G    RG  +SGG+R+R++IA AL  +  +   D AT  LD  +
Sbjct: 290 LYATIFGLTHTYDTKVGNDFVRG--VSGGERKRVSIAEALAARGTVYSWDNATRGLDAST 347

Query: 632 EGAINYT-----LGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
             A+ Y      +  L+RS     +  A        SENI    +  +V+ +G+
Sbjct: 348 --ALEYAQAIRIMTNLLRSTAFVTIYQA--------SENIYETFDKVTVLHSGR 391

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 109/219 (49%), Gaps = 27/219 (12%)

Query: 481 TITPGSNVCIVGPSGRGKSTIASLLLRFYDAN--SGTILIDGQDISKVSAKSLRKHLGVV 538
           ++ PG  + ++G SG GK+T+  +L     A   SG+I I+G +I+K   ++L K  G V
Sbjct: 391 SVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKINGSEITK---QNLSKIAGFV 447

Query: 539 QQEPVLM-SGTIRDNITYG--------LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTV 589
            QE  L+ + T+ + +           LS+      +  V ++        +  D  D +
Sbjct: 448 DQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQKRVYQVLEE-------LRILDIKDRI 500

Query: 590 IG---PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL-MRS 645
           IG    RG  +SGG+++R++IA  L+  P +L LDE TS LD  +   +   L RL +  
Sbjct: 501 IGDDLERG--ISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHY 558

Query: 646 KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADL 684
               I+SI    S I +S + +VL + G ++ +G   D+
Sbjct: 559 NRTLILSIHQPRSNIFKSFDKLVLLSQGEMVFSGVATDV 597

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 114/244 (46%), Gaps = 25/244 (10%)

Query: 454  DGRIEFKDVSFSYPTR-PTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
            D    ++DV +    +  T +I   +   + PG+   ++G SG GK+T+  +L     AN
Sbjct: 839  DSIFHWRDVCYDIQIKNETRRILTNVDGWVKPGTLTALMGYSGAGKTTLLDVL-----AN 893

Query: 513  -------SGTILIDGQDISKVSAKSLRKHLGVVQQEPVL-MSGTIRDNITYGLSYTPSMD 564
                   +G I +DG     +   S ++  G  QQ+ +   + T+RD + +  +Y     
Sbjct: 894  RVRVGVVTGNIFVDGH----LRDTSFQRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQ 948

Query: 565  EIRAVAKKCFCHNFITKF-PDGY-DTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LD 621
             I    K  +  + I     + Y D V+G  G  L+  QR+R+ I   L+ KP++L+ LD
Sbjct: 949  SISRAEKNAYVEDIIKLLGMEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLD 1008

Query: 622  EATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE--NIVVLGNDGSVIEAG 679
            E TS LD ++  +I   + +L+   +  + +I H+ S I   E   +++L N G  +  G
Sbjct: 1009 EPTSGLDSQTAWSICQLIKKLVNHGQAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFG 1067

Query: 680  KFAD 683
               +
Sbjct: 1068 PLGE 1071

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 98/206 (47%), Gaps = 21/206 (10%)

Query: 470 PTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAK 529
           P S    +  + + PGS++ I+GP+  GKS+I  ++   +   + T L+        S  
Sbjct: 583 PASSNLTQANVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLL--------SIP 634

Query: 530 SLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMD------EIRAVAKKCFCHNFITKFP 583
           S    + + Q+   +  GT RD I Y +      +      E+  V K+    +++ K  
Sbjct: 635 SESDMMCIAQRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRA 693

Query: 584 DGYDTV--IGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGR 641
           D  + +  +     +LSGG++QR+  AR +  +PK ++LDEAT+A+  + E      L  
Sbjct: 694 DALNYLDHVADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADMED----YLFN 749

Query: 642 LMRSKEITIVSIAHRLSTIRRSENIV 667
           +++      +SI+ R S I+  + ++
Sbjct: 750 MLKKFRFNFISISQRPSLIKYHDYLL 775

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 96/201 (47%), Gaps = 31/201 (15%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           GS++ I+GP+G GKS+I  ++      Y+ N G + I  ++           ++  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------NIFFIPQK 685

Query: 542 PVLM-SGTIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG--YDTVIG 591
           P     GT+RD I Y +S     D  R    K           +++ K   G  Y   I 
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFD--RGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIA 743

Query: 592 PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
               LLSGG++QR+  AR +  KP  ++LDEAT+A+ V+ E      L  L++      +
Sbjct: 744 DWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY----LFNLLKRYRFNFI 799

Query: 652 SIAHRLSTIRRSENIVVLGND 672
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ABR125C
          Length = 1474

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 115/228 (50%), Gaps = 18/228 (7%)

Query: 459  FKDVSFSYPTRPTS-QIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL-RFYDANSGTI 516
            +K+VS++ P + T  ++  ++     PG+   ++G SG GK+T+ + L  R     +G +
Sbjct: 841  WKNVSYTIPYKGTKRKLLDEVSGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDM 900

Query: 517  LIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTIRDNITYGL-----SYTPSMDEIRAVA 570
            L++G  +      S  +  G VQQ+ V +   T+R+++ +          P  +++  V 
Sbjct: 901  LVNGLPVDI----SFERRTGYVQQQDVHIKEMTVRESLQFSARLRRPESVPDAEKLDYVE 956

Query: 571  KKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATSALDV 629
            K       +    D  D V+G  G  L+ GQR++++I   L+ KP +L+ LDE TS LD 
Sbjct: 957  KIIE----VLGMTDYADAVVGDVGYGLNVGQRKKLSIGVELVAKPSLLLFLDEPTSGLDS 1012

Query: 630  ESEGAINYTLGRLMRSKEITIVSIAHRLSTI-RRSENIVVLGNDGSVI 676
            +S  AI   L +L ++ +  + +I    +T+  + + +++L   G  +
Sbjct: 1013 QSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTV 1060

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 99/227 (43%), Gaps = 29/227 (12%)

Query: 473 QIFKKLRLTITPGSNVCIVGPSGRGKS----TIASLLLRFYDANSGTILIDG--QDISKV 526
            I +K+     PG  V ++G  G G S    T+A    +F  + SG+I  DG  QD    
Sbjct: 157 NILEKVDFIARPGEMVLVLGRPGAGCSSLLKTVAGDTDQF-KSVSGSISYDGIPQDEMMS 215

Query: 527 SAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGY 586
           + K+   + G  +++      T+R  + + ++       + ++ +     ++I+   + Y
Sbjct: 216 NFKAEVIYNG--EEDVHFPHLTLRQTLDFAIACKTPHVRVNSLTRA----DYISMMRELY 269

Query: 587 DTVIGPRGAL-----------LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
            T+ G + A            +SGG+R+R++IA AL     +   D AT  LD  +  A+
Sbjct: 270 ATIFGLKHAYDTPVGNEFVRGVSGGERKRVSIAEALAANGSVYCWDNATRGLDAST--AL 327

Query: 636 NYTLG-RLMRS--KEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
            Y    R+M +  K  ++V+I      I    + V +  DG  I  G
Sbjct: 328 EYAQAIRIMTNILKSTSLVTIYQASEKIYEVFDKVTVLYDGKQIYFG 374

>NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {ON}
           Anc_8.661
          Length = 868

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 99/201 (49%), Gaps = 27/201 (13%)

Query: 484 PGSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQ 540
           PGS++ I+GP+  GK++I  ++      Y+ N G + I  +D           +L  V Q
Sbjct: 636 PGSSLLILGPNSCGKTSIQRIIAEIWPIYNKN-GLLSIPAED-----------NLFCVPQ 683

Query: 541 EPVLM-SGTIRDNITYGLS----YTPSMDEIRAVAKKCFCH-NFITKFPDGYDTV--IGP 592
           +P     GT+RD I Y +S    Y   + + + V      H +++ K   G+  +  +  
Sbjct: 684 KPYFTRGGTLRDQIIYPMSSDEFYDRGIKDAQLVQIMAEVHLDYLLKRGTGFSYLDNVAD 743

Query: 593 RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVS 652
              +LSGG++QR+  AR L  KP+ ++LDEAT+A+  + E      L  +++      ++
Sbjct: 744 WKDVLSGGEKQRMNFARILFHKPRFVVLDEATNAISADMEDH----LFNILKKYRFNFIT 799

Query: 653 IAHRLSTIRRSENIVVLGNDG 673
           I+ R + I   + ++ +  +G
Sbjct: 800 ISQRPALIEYHDLLLEILEEG 820

>KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P25371 Saccharomyces cerevisiae
           YCR011C ADP1 Shows homology to ATP-dependent permeases
           Active transport ATPase
          Length = 1022

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 111/224 (49%), Gaps = 27/224 (12%)

Query: 471 TSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN--SGTILIDGQDISKVSA 528
           T+ +  ++  ++ PG  + I+G SG GK+T+  +L         +G+I ++G DI K   
Sbjct: 386 TADVLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDK--- 442

Query: 529 KSLRKHLGVVQQEPVLM-SGTIRDNITYG--------LSYTPSMDEIRAVAKKCFCHNFI 579
               K +G V QE  L+ + T+ + +           LS++     +  V ++       
Sbjct: 443 DKYSKIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVLEE------- 495

Query: 580 TKFPDGYDTVIGP---RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAIN 636
            +  D  D VIG    RG  +SGG+++R++IA  L+  P++L LDE TS LD  +   + 
Sbjct: 496 LRIFDIRDRVIGSEYERG--ISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVI 553

Query: 637 YTLGRLMRSKEITIV-SIAHRLSTIRRSENIVVLGNDGSVIEAG 679
             L RL      T+V SI    S+I +  + +VL ++G ++ +G
Sbjct: 554 ECLVRLANHYNKTLVLSIHQPRSSIFQLFDKLVLLSNGKMVYSG 597

>Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 bp,
           1288 aa] {ON} complement(92949..93236,93239..96817)
           [3867 nt, 1289 aa]
          Length = 1288

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 106/230 (46%), Gaps = 39/230 (16%)

Query: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI---------ASLLLRFYDANSGTILI 518
           +R + +I   +  T  PG    I+GPSG GKS++         +SL+ +F    SG++L+
Sbjct: 699 SRLSKEILHSIDATFKPGMINAIMGPSGSGKSSLLNLIAGKQKSSLMSKF--TKSGSLLL 756

Query: 519 DGQDISKVSAKSLRKHLGVVQQEPVLMSG-TIRDNITYGLS---YTPSMDE--------I 566
           +   +S    K+L  +  V Q +  L+   T+R+   Y      Y  S DE        I
Sbjct: 757 NRTPVSNELFKNLSSY--VTQDDSHLLPRLTVRETFHYAAELRLYYLSKDERESKIDELI 814

Query: 567 RAVAKKCFCHNFITKFPDGYDTVIGPRGAL-LSGGQRQRIAIARALIKKPKILILDEATS 625
           RA++    C N          T+IG      +SGG+++R+ +   L+K P IL+LDE TS
Sbjct: 815 RALSLT-HCQN----------TIIGDEFVKGISGGEKRRVTMGIQLLKDPPILLLDEPTS 863

Query: 626 ALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDG 673
            LD  +   I   L +L      T++   H  R    R+  N+++L   G
Sbjct: 864 GLDSFTSATILEILEKLCVEFNKTVIITIHQPRSELFRKFGNVLLLAKSG 913

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 109/249 (43%), Gaps = 43/249 (17%)

Query: 434 ELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGP 493
           EL +   S+PS      + R G ++ +D++ +  ++  + +     L +  GS + I+G 
Sbjct: 4   ELVENDLSLPS------IKRVG-LQVRDLTIA-ASKTNNVLINNFSLDLPSGSVMAIIGG 55

Query: 494 SGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMS-GTIRDN 552
           SG GK+T+ ++L       SG +  +G     +   S   +     QEP ++S  T  + 
Sbjct: 56  SGSGKTTLLNVLA---SKISGGLSYEGSIKYVLDNDSNTNN----SQEPNIVSDNTETET 108

Query: 553 ITYGLSYTPSMDEIRA---------------VAKKCFCHNFITK-------FPDGYDTVI 590
            +  ++Y P  D + A               + +    +N +T          D  D  +
Sbjct: 109 SSVSMAYVPQQDILSAGLTCRETLMYSAELKIQQSKEANNQLTSQLIDELGLKDCADIAV 168

Query: 591 GP---RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKE 647
           G    RG  LSGG+++R+ IA  +I  P I+ LDE T+ LD  S   +  TL +L +   
Sbjct: 169 GDNTHRG--LSGGEKRRLNIATHMIANPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEGG 226

Query: 648 ITIVSIAHR 656
            T +   H+
Sbjct: 227 RTFIMSIHQ 235

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 90/211 (42%), Gaps = 46/211 (21%)

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I+ +DVSF Y   P   + K + L I   S + +VG +G GK+T+  ++L          
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVML---------- 579

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
                       + LR   G V + P L  G       +   +  SMD +   A      
Sbjct: 580 ------------EQLRPLSGYVSRNPRLRIGY------FTQHHVDSMD-LSTSAVDWMSK 620

Query: 577 NFITKFPDGYDTVIGPRG----------ALLSGGQRQRIAIARALIKKPKILILDEATSA 626
            F  K  + Y   +G  G           LLSGGQ+ R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 627 LDVESEGAI-----NYTLGRLMRSKEITIVS 652
           LD     A+     N+T G LM S +I++++
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 53/97 (54%), Gaps = 11/97 (11%)

Query: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            SGG R R+++ARAL  +P +L+LDE ++ LDV S   I Y L   ++S   T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSHD 423

Query: 657 LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELF 693
            + +      ++  ++  +       D YR +D + F
Sbjct: 424 RAFLNEVATDIIYQHNERL-------DYYRGQDFDTF 453

>AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR011C (ADP1) and
           YOL075C
          Length = 1011

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 119/243 (48%), Gaps = 35/243 (14%)

Query: 457 IEFKDVSFS-YPTRPTS-QIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN-- 512
           + F+++ +  +P+R +  +I   +   ++PG  + ++G SG GK+ +  +L     A   
Sbjct: 364 LTFENLCYKVFPSRSSPVRILNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEV 423

Query: 513 SGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIRDNITYGLSYTP 561
           SGT+ I+G  I+K    ++ K +G V Q           E VL S  +R  +   +S+  
Sbjct: 424 SGTVKINGVPITK---HTVSKVVGFVDQDNHLLPTLTVYETVLNSALLR--LPRSMSFAA 478

Query: 562 SMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIARALIKKPKIL 618
               +  V ++        +  D  D +IG    RG  +SGG+++R++IA  L+  P IL
Sbjct: 479 KQKRVYQVLEE-------LRIFDIRDRLIGNDFERG--ISGGEKRRVSIACELVTSPLIL 529

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDGSVI 676
            LDE TS LD  +   +   L RL      T+V   H  R +  R  +N+V+L N+G ++
Sbjct: 530 FLDEPTSGLDSNNANNVIECLVRLASQYRRTLVLSIHQPRSNIFRLFDNLVLL-NEGEMV 588

Query: 677 EAG 679
            +G
Sbjct: 589 YSG 591

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 96/201 (47%), Gaps = 31/201 (15%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           GS++ I+GP+G GKS+I  ++      Y+ N G + I  ++           ++  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYNKN-GLLSIPPEN-----------NIFFIPQK 685

Query: 542 PVLM-SGTIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG--YDTVIG 591
           P     GT+RD I Y +S     D  R    K           +++ K   G  Y   + 
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVA 743

Query: 592 PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
               LLSGG++QR+  AR +  KP  ++LDEAT+A+ V+ E      L  L++      +
Sbjct: 744 DWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY----LFNLLKRYRFNFI 799

Query: 652 SIAHRLSTIRRSENIVVLGND 672
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1011

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 141/319 (44%), Gaps = 71/319 (22%)

Query: 409 GSSVFGLSN------FYSELMKGAGAASRLFELTDY---KKSVPSTVGQTFVPRDGRIEF 459
           GSS + ++N      F++ +    G          Y   K  +P+T           + F
Sbjct: 342 GSSFYYITNNISKSPFFTNITTAIGQNQVELPNDQYDFLKNDIPAT-----------LTF 390

Query: 460 KDVSFSYPT---------RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYD 510
           ++VS+S            +   +I + +     PG  + I+G SG GK+T+  +L     
Sbjct: 391 ENVSYSITESEGIRRDEGKSNVKILQNVSGVAKPGEIMAIMGGSGAGKTTLLDILAMKDK 450

Query: 511 AN---SGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIR--DNIT 554
            +   SG I I+G+ + K      RK +G V Q           E VL S  +R   +++
Sbjct: 451 TDGDVSGAIKINGKQLEK---SYFRKLIGFVDQYDYLFPTLSVYETVLNSALLRLPSSMS 507

Query: 555 YG---LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIA 608
           +    L     +DE+R +  K              D +IG    RG  +SGG+++R++IA
Sbjct: 508 FAAKQLRVLQVLDELRILEIK--------------DRLIGNDYQRG--ISGGEKRRVSIA 551

Query: 609 RALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEIT-IVSIAHRLSTIRRSENIV 667
             L+  P ILILDE TS LD  +   +   L RL ++   T IVSI    S I  S N +
Sbjct: 552 CELVTSPSILILDEPTSGLDSNNANNVINCLVRLAQNHNRTIIVSIHQPRSNIFYSFNKL 611

Query: 668 VLGNDGSVIEAGKFADLYR 686
           +L ++  +I +G+ +++ +
Sbjct: 612 ILLSNSRLIYSGEASNVTK 630

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 114/239 (47%), Gaps = 15/239 (6%)

Query: 454  DGRIEFKDVSFSYPT-RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN 512
            D  + ++D+ +     R + +I   +   + PG+   ++G SG GK+T+   L       
Sbjct: 850  DSVVHWRDLCYEVRIKRESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTG 909

Query: 513  --SGTILIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTIRDNITYGLSYTPSMDEIRAV 569
              +G I +DG    K+  +S  + +G  QQ+ + L + T+R+++ +  +       + A 
Sbjct: 910  VITGGIFVDG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFS-AMLRQPKSVPAS 964

Query: 570  AKKCFCHNFIT--KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATSA 626
             K+ +    I   +     D ++G  G  L+  QR+R+ I   L+ KPK+LI LDE TS 
Sbjct: 965  EKRKYVEEVINVLEMEPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSG 1024

Query: 627  LDVESEGAINYTLGRLMRSKEITIVSIAHRLST--IRRSENIVVLGNDGSVIEAGKFAD 683
            LD ++  +I   + +L    +  + +I H+ S   I+  + ++ L   G  +  G+  D
Sbjct: 1025 LDSQTAWSICQLIRKLANRGQAILCTI-HQPSAVLIQEFDRLLFLQKGGETVYFGELGD 1082

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 96/205 (46%), Gaps = 33/205 (16%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           GS++ I+GP+  GK++I  ++      Y+ N G + +  Q+           ++  + Q 
Sbjct: 665 GSSLLILGPNSSGKTSIQRIIAEIWPIYNKN-GLLSVPSQE-----------NIFCIPQR 712

Query: 542 PVLMS-GTIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG--YDTVIG 591
           P   S GT+RD I Y +S     D  R +               ++ K   G  Y   + 
Sbjct: 713 PYFTSSGTLRDQIIYPMSSDEFFD--RGLKDSLLIQILKEVNLKYLMKRSKGLTYLDTVA 770

Query: 592 PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
               LLSGG++QRI  AR L  KP+ ++LDEAT+A+  + E      L  +++      +
Sbjct: 771 DWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDMEDY----LFNILKKYRFNFI 826

Query: 652 SIAHRLSTIRRSENIVVLG--NDGS 674
           +I+ R S I+  + ++ +   NDG+
Sbjct: 827 TISQRPSLIKYHDLLLEISDHNDGT 851

>KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3.133
           YOL075C
          Length = 1273

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 109/228 (47%), Gaps = 37/228 (16%)

Query: 469 RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI---------ASLLLRFYDANSGTILID 519
           R   QI + +  +  PG    I+GPSG GKST+         +S+  +F    SG+I+ +
Sbjct: 684 REQKQILQCVSASFKPGMINAIMGPSGSGKSTLLNIISGRVKSSIFAKF--DKSGSIMFN 741

Query: 520 GQDISKVSAKSLRKHLGVVQQEPVLMSG-TIRD-----------NITYGLSYTPSMDEIR 567
           G ++S+   K++  +  V Q +  L+S  T+++           N+TY    T + + IR
Sbjct: 742 GNEVSEHMFKNVCSY--VSQDDDHLLSKLTVKETFKFAADLRLHNMTYEQRSTKTDELIR 799

Query: 568 AVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSAL 627
           A+  K  C N I     G + V G     +SGG+++R+ +   L   P I++LDE TS L
Sbjct: 800 ALGLK-HCENNII----GDEFVKG-----ISGGEKRRVTMGIQLQNDPPIILLDEPTSGL 849

Query: 628 DVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDG 673
           D  +   I   L +L  +   TI+   H  R    ++  N+++L   G
Sbjct: 850 DSFTSSTILEILKKLAVNYGKTIILTIHQPRAELFKQFGNVLLLAKSG 897

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 114/249 (45%), Gaps = 40/249 (16%)

Query: 451 VPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYD 510
           +PR   +  +++S S  ++   Q+     + +  GS + ++G SG GK+T+ ++L     
Sbjct: 15  IPRIS-LNVRNLSIS-ASKSGKQLIDSFSIDLHSGSVMAVMGGSGSGKTTLLNVLA---S 69

Query: 511 ANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRA-- 568
             SG + ++G DI  V    L ++ G++  +      +I +++   ++Y P  D + A  
Sbjct: 70  KISGGLTVEG-DIKYV----LEENNGMMDDD----DSSIEEHVK--MAYLPQQDILPARL 118

Query: 569 -VAKKCFCH-------------NFITKF------PDGYDTVIG-PRGALLSGGQRQRIAI 607
              +   C              N + +        D  DT++G  +   LSGG+++R++I
Sbjct: 119 TCRETLMCAADLKLNKSKQEKINIVNQLIDELGLKDCADTLVGDSKHKGLSGGEKRRLSI 178

Query: 608 ARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK-EITIVSIAHRLSTIRRSENI 666
              ++  P I+ LDE T+ LD  S   +  T+ +L +    I I+SI    S I    + 
Sbjct: 179 GTQMVSNPSIMFLDEPTTGLDSYSAYLVIKTIKKLAKDDGRIFIMSIHQPRSDILFLLDH 238

Query: 667 VVLGNDGSV 675
           V L + G V
Sbjct: 239 VTLLSRGQV 247

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 120/245 (48%), Gaps = 35/245 (14%)

Query: 457 IEFKDVSFSYPTRPTSQ----IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL--RFYD 510
           + F+++S++ P+   +     I K +   + PG  + I+G SG GK+T+  +L   R   
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 511 ANSGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIRDNITYGLSY 559
             SG I I+G+++S+   + + K +G V Q           E VL S  +R  +   +++
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSMTF 547

Query: 560 TPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIARALIKKPK 616
                 +  V ++   +N         D +IG    RG  +SGG+++R++IA  L+  P 
Sbjct: 548 YQKQQRVFQVLEELRIYNI-------KDRLIGDDFERG--ISGGEKRRVSIACELVTSPL 598

Query: 617 ILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR-LSTIRRSENIVVLGNDGSV 675
           IL LDE TS LD  +   +   L RL ++   T+V   H+  S I    + +VL + G +
Sbjct: 599 ILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEM 658

Query: 676 IEAGK 680
           + +G+
Sbjct: 659 VYSGE 663

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 97/202 (48%), Gaps = 12/202 (5%)

Query: 469  RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN--SGTILIDGQDISKV 526
            + T +I   +   + PG+   ++G SG GK+T+   L         +G + IDG    K 
Sbjct: 964  KETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KP 1019

Query: 527  SAKSLRKHLGVVQQEPV-LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT--KFP 583
              +S  + +G  QQ+ + L + T+R+++ +  +Y     E+    K  +  + I   +  
Sbjct: 1020 RDESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEME 1078

Query: 584  DGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGRL 642
               D ++G  G  L+  QR+R+ I   L  KPK+L+ LDE TS LD ++  AI   + +L
Sbjct: 1079 KYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKL 1138

Query: 643  MRSKEITIVSIAHRLSTIRRSE 664
                +  + +I H+ S I   E
Sbjct: 1139 CNQGQAILCTI-HQPSAILMQE 1159

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 107/259 (41%), Gaps = 46/259 (17%)

Query: 448 QTFVPRDGRIEFKDVSFSY-PTRPTS-----QIFKKLRLTITPGSNVCIVGPSGRGKSTI 501
           QTF+     + +K + + Y   +PT      QI K +   + PG  + ++G  G G +T 
Sbjct: 225 QTFL----NLPYKMLGYLYRKVKPTKEEDLFQILKPMDGCLKPGELLVVLGRPGSGCTT- 279

Query: 502 ASLLLRFYDANSGTILIDGQD----ISKVSAKSLRKH-----------------LGVVQQ 540
              LL+   +N+    + G+D     S  S K +++H                 L V Q 
Sbjct: 280 ---LLKSITSNTHGFHV-GKDSQISYSGFSPKEIKRHYRGEVVYNAESDIHLPHLTVYQT 335

Query: 541 EPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGG 600
              +       N   G+S     + I  VA   +  +       G D V G     +SGG
Sbjct: 336 LITVARLKTPQNRIQGVSREDYANHIAEVAMATYGLSHTRNTKVGNDLVRG-----VSGG 390

Query: 601 QRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI 660
           +R+R++IA   I   K    D AT  LD  +  A+ +   R +++ + TI + A  ++  
Sbjct: 391 ERKRVSIAEVAICGSKFQCWDNATRGLDAAT--ALEFV--RALKT-QATIANSAAAVAIY 445

Query: 661 RRSENIVVLGNDGSVIEAG 679
           + S++   L +   V++ G
Sbjct: 446 QCSQDAYDLFDKVCVLDDG 464

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 96/201 (47%), Gaps = 31/201 (15%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           GS++ I+GP+G GKS+I  ++      Y+ N G + I  ++           ++  + Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIADVWPVYNKN-GLLSIPSEN-----------NIFCIPQK 685

Query: 542 PVLM-SGTIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG--YDTVIG 591
           P     GT+RD I Y +S     D  R    K           +++ K   G  Y   + 
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVA 743

Query: 592 PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
               LLSGG++QR+  AR +  KP  ++LDEAT+A+ V+ E      L  L++      +
Sbjct: 744 DWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDY----LFNLLKRYRFNFI 799

Query: 652 SIAHRLSTIRRSENIVVLGND 672
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 114/249 (45%), Gaps = 15/249 (6%)

Query: 444  STVGQTFVPRDGRIEFKDVSFSYPTRP-TSQIFKKLRLTITPGSNVCIVGPSGRGKSTIA 502
            ST G   +       ++++ +  P +  T ++   +   + PG+   ++G SG GK+T+ 
Sbjct: 838  STNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTLL 897

Query: 503  SLLLRFYDAN--SGTILIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTIRDNITYGLSY 559
              L         +G +L+DG    +   +S  + +G  QQ+ + L + T+R+++ +  +Y
Sbjct: 898  DCLAERVTMGVITGDVLVDG----RPRDESFPRSIGYCQQQDLHLKTSTVRESLRFS-AY 952

Query: 560  TPSMDEIRAVAKKCFCHNFIT--KFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKI 617
                 E+    K  +    I   +     D V+G  G  L+  QR+R+ I   L  KPK+
Sbjct: 953  LRQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKL 1012

Query: 618  LI-LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSE--NIVVLGNDGS 674
            L+ LDE TS LD ++  +I   L R + S    I+   H+ S I   E   ++ L + G 
Sbjct: 1013 LVFLDEPTSGLDSQTAWSIC-QLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQDGGQ 1071

Query: 675  VIEAGKFAD 683
                G+  D
Sbjct: 1072 TTYFGELGD 1080

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 109/235 (46%), Gaps = 28/235 (11%)

Query: 455 GRIEFKDVSFSYPTRPTSQI--FKK-----LRLTITPGSNVCIVGPSGRGKSTIASLLLR 507
           G + F+  S   P+  +S I  FKK     + L  + G+++ I+GP+  GKS+I  ++  
Sbjct: 594 GTLTFQIPSVIEPSSKSSSIQDFKKNFDPNVPLIDSTGASLLILGPNSCGKSSIQRIITE 653

Query: 508 FYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLM-SGTIRDNITYGLSYTPSMD-- 564
            +   +   L+       + A S   +L  V Q P     GT RD I Y +S     D  
Sbjct: 654 VWPVYNKNGLL------SIPAPS---NLFCVPQRPYFTRGGTFRDQIIYPMSSDEFFDRG 704

Query: 565 ----EIRAVAKKCFCHNFITK-FPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI 619
                +  + K+      + +     Y   +     +LSGG++QR+  AR L  +P+ ++
Sbjct: 705 LKDKNLARILKEVHLDYLLDREIGCSYMDAVADWKDVLSGGEKQRMNFARILFHRPRFVV 764

Query: 620 LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGS 674
           LDEAT+A+ V+ E      L  L++      ++I+ R S I+  + ++ + + GS
Sbjct: 765 LDEATNAISVDMEDY----LFNLLKRYRFNFITISQRPSLIKYHDMLLEVDSSGS 815

>Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {ON}
           complement(38346..41489) [3144 nt, 1048 aa]
          Length = 1047

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 123/277 (44%), Gaps = 54/277 (19%)

Query: 448 QTFVPRD--GRIEFKDVSFSYPTRPTS----QIFKKLRLTITPGSNVCIVGPSGRGKSTI 501
           ++F+  D    + F++VS+            +I  K+   + PG  + I+G SG GK+T+
Sbjct: 383 ESFLKTDSSATLSFENVSYYINNEENEFEPRKIIHKVSGLVKPGEILAIMGGSGAGKTTL 442

Query: 502 ASLLLRFYDAN--SGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGT 548
             +L +       SGT+ I+G DI +       K +G V Q           E VL S  
Sbjct: 443 LDILAKKRKTGRVSGTLKINGIDIPR---NKYTKLIGFVDQDDYLLPTLTVYETVLNSAL 499

Query: 549 IRDNITYGLSYTPS-------MDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLS 598
           +R  +   +S+          +DE+R +  K              D +IG    RG  +S
Sbjct: 500 LR--LPRSMSFAAKRARVFQVLDELRILDIK--------------DRIIGNDYERG--IS 541

Query: 599 GGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRS-KEITIVSIAHRL 657
           GG+++R++IA  L+  P IL LDE TS LD  +   +   L RL +  K   I SI    
Sbjct: 542 GGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVVECLLRLSKDYKRTLIFSIHQPR 601

Query: 658 STIRRSENIVVLGNDGSVIEAG---KFADLYRDEDSE 691
           S I    + +VL ++G +I +G   K  D  R+   E
Sbjct: 602 SNIFHLFDKLVLLSNGDMIYSGDAIKVNDFLRNSGYE 638

>KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa]
           {ON} Anc_3.133 YOL075C
          Length = 1284

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 103/220 (46%), Gaps = 21/220 (9%)

Query: 469 RPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI---------ASLLLRFYDANSGTILID 519
           R   +I + +  T  PG    I+GPSG GKST+         ++L  RF     G++  +
Sbjct: 691 RERKKILRSVNATFKPGMVNAIMGPSGSGKSTLLNLISGRVKSTLFSRF--TKDGSMSFN 748

Query: 520 GQDISKVSAKSLRKHLGVVQQEPVLMSG-TIRDNITYGLSYTPSMDEIRAVAKKCFCHNF 578
           G ++S+   K +  +  V Q +  L+S  T+R+  T+  +    +  + A  ++   +N 
Sbjct: 749 GAEVSETMFKQICSY--VSQDDDHLLSKLTVRE--TFKFASDLRLHHLNAKEREAKRNNL 804

Query: 579 ITKF--PDGYDTVIGPRGAL-LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAI 635
           I         DT+IG      +SGG+++R+ +   L+  P IL+LDE TS LD  +   I
Sbjct: 805 IIALGLKHCEDTIIGNEFVKGISGGEKRRVTMGIQLLNDPPILLLDEPTSGLDSFTSSTI 864

Query: 636 NYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDG 673
              L  L +    T++   H  R    ++  N+++L   G
Sbjct: 865 LEILSNLCQEYGKTVILTIHQPRAELFKKFGNVLLLAKSG 904

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 118/258 (45%), Gaps = 42/258 (16%)

Query: 442 VPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI 501
           V + +  + VPR  +++ +D+S    ++  +++ K   L +  GS + ++G SG GK+T+
Sbjct: 6   VENKLSFSHVPR-LKLQVRDLSI-IASKTDAELVKSFSLDLPSGSIMAVMGGSGSGKTTL 63

Query: 502 ASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVV--------------QQEPVLMSG 547
            ++L       SG +   G+         +R+  GV               QQ+ +    
Sbjct: 64  LNVLA---SKISGGLKTVGE------INYIREDCGVNDGDHPEHAVMTYLPQQDVLPARL 114

Query: 548 TIRDNITYGLSYT---PSMDEIRAVAKKCFCHNFITKF--PDGYDTVIGP---RGALLSG 599
           T RD + +        P  ++++ V +       I +    D  DT+IG    RG  LSG
Sbjct: 115 TCRDTMMFAADLKLDKPKHEKVQIVEQ------LIDELGLKDCADTIIGDSSHRG--LSG 166

Query: 600 GQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK-EITIVSIAHRLS 658
           G+++R++I   +I  P I+ LDE T+ LD  S   +  T+ +L      I I+SI    S
Sbjct: 167 GEKRRLSIGTQMIANPSIMFLDEPTTGLDAYSAYLVVKTIRKLAEDDGRIFIMSIHQPRS 226

Query: 659 TIRRSENIVVLGNDGSVI 676
            I    + V + + G+++
Sbjct: 227 DIMFLLDKVCILSKGNIV 244

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 96/200 (48%), Gaps = 12/200 (6%)

Query: 471  TSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDAN--SGTILIDGQDISKVSA 528
            T +I   +   + PG+   ++G SG GK+T+   L         +G + IDG    K   
Sbjct: 908  TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KPRD 963

Query: 529  KSLRKHLGVVQQEPV-LMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFIT--KFPDG 585
            +S  + +G  QQ+ + L + T+R+++ +  +Y     E+    K  +  + I   +    
Sbjct: 964  ESFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEMEKY 1022

Query: 586  YDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGRLMR 644
             D ++G  G  L+  QR+R+ I   L  KPK+L+ LDE TS LD ++  AI   + +L  
Sbjct: 1023 ADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKLCN 1082

Query: 645  SKEITIVSIAHRLSTIRRSE 664
              +  + +I H+ S I   E
Sbjct: 1083 QGQAILCTI-HQPSAILMQE 1101

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 104/226 (46%), Gaps = 32/226 (14%)

Query: 473 QIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQD----ISKVSA 528
           QI K +   + PG  + ++G  G G +T    LL+   +N+    + G+D     S  S 
Sbjct: 198 QILKPMDGCLKPGELLVVLGRPGSGCTT----LLKSITSNTHGFHV-GKDSQISYSGFSP 252

Query: 529 KSLRKHL-GVV----QQEPVLMSGTIRDN-ITYGLSYTPSMDEIRAVAKKCFCHNFITKF 582
           K ++KH  G V    + +  L   T+    IT     TP  + I+ V+++ F ++     
Sbjct: 253 KEIKKHYRGEVVYNAEADIHLPHLTVYQTLITVARLKTPQ-NRIQGVSREEFANHLAEVV 311

Query: 583 PDGY------DTVIGP---RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEG 633
              Y      +T +G    RG  +SGG+R+R++IA   I   K    D AT  LD  S  
Sbjct: 312 MATYGLSHTRNTKVGNDLVRG--VSGGERKRVSIAEVAICGSKFQCWDNATRGLD--SAT 367

Query: 634 AINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
           A+ +   R +++ + TI + A  ++  + S++   L +   V++ G
Sbjct: 368 ALEFV--RALKT-QATIANSAAAVAIYQCSQDAYDLFDKVCVLDDG 410

>ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1518

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 106/209 (50%), Gaps = 12/209 (5%)

Query: 482  ITPGSNVCIVGPSGRGKSTIASLLLRFYDAN--SGTILIDGQDISKVSAKSLRKHLGVVQ 539
            + PG+   ++G SG GK+T+ + L +  +    +G +LI+G+ +      S  +  G VQ
Sbjct: 898  VAPGTMTALMGESGAGKTTLLNTLAKRVNVGVVTGDMLINGKPVDS----SFERRTGYVQ 953

Query: 540  QEPV-LMSGTIRDNITYG--LSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGAL 596
            Q+ + +   T+R+++ +   L    S+ +   VA        +    +  D ++G  GA 
Sbjct: 954  QQDIHIAEMTVRESLIFSARLRRPQSIPDAEKVADAETVMKLL-DMEEYADALVGGLGAG 1012

Query: 597  LSGGQRQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
            L+  QR++++I   L+ KP +L+ LDE TS LD +S  AI   L R+ R+ +  + +I  
Sbjct: 1013 LNVEQRKKLSIGVELVSKPDLLLFLDEPTSGLDSQSSWAIVQLLKRISRAGQSILCTIHQ 1072

Query: 656  RLSTI-RRSENIVVLGNDGSVIEAGKFAD 683
              +T+  + + +++L   G  +  G   +
Sbjct: 1073 PSATLFEQFDRLLLLKKGGQTVYFGDIGE 1101

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 101/235 (42%), Gaps = 40/235 (17%)

Query: 469 RPTSQIFKKLRLTITPGSNVCIVGPSGRGKS----TIASLLLRFYDANSGTILIDGQDIS 524
           R   +I + +     PG  V ++G  G G S    T A +  +F     G I+ DG    
Sbjct: 177 RRMRKIIRNVNAFALPGEMVLVLGRPGSGCSSFLKTAAGVTDQFAGGVEGDIMYDG---- 232

Query: 525 KVSAKSLRKHLGVVQQEPVLMSG---------TIRDNITYGLSYTPSMDEIRAVAKKCFC 575
            V   ++ KH     +  V+ +G         T++  + + ++       +  V++  + 
Sbjct: 233 -VPQDTMMKHY----RSDVIYNGELDVHFPYLTVKQTLDFAIACKTPAIRVNNVSRSEYI 287

Query: 576 ------HNFITKFPDGYDTVIGP---RGALLSGGQRQRIAIARALIKKPKILILDEATSA 626
                 +  I      YDT +G    RG  +SGG+R+R++IA AL  +      D AT  
Sbjct: 288 RETRDLYATIFGLTHTYDTKVGNDFVRG--VSGGERKRVSIAEALAARGTFYCWDNATRG 345

Query: 627 LDVESEGAINYTLG-RLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGK 680
           LD  +  A+ Y +  R+M +    +++    ++  + SENI    +  +V+ +G+
Sbjct: 346 LDAST--ALEYAMAIRIMTN----LLNSTAFVTIYQASENIYETFDKVTVLHSGR 394

>NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON}
           Anc_1.427
          Length = 1060

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 118/249 (47%), Gaps = 40/249 (16%)

Query: 457 IEFKDVSFSYPT-------RPTS--QIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL- 506
           + F+++++  P+       +P S  ++ K +   + PG    I+G SG GK+T+  +L  
Sbjct: 390 LSFENITYEVPSLNKNHKSQPNSNVKVLKSIDGIVKPGQIFAIMGGSGAGKTTLLDILAM 449

Query: 507 -RFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIRDNIT 554
            R      G I ++G  +S+   KS  K +G V Q           E VL S  +R  + 
Sbjct: 450 KRKTGQVGGEIKVNGNIMSR---KSYSKLIGFVDQNDYLHPTLTVYETVLNSALLR--LP 504

Query: 555 YGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIARAL 611
             +S+      +  + ++        +  D  D +IG    RG  +SGG+++R++IA  L
Sbjct: 505 RTMSFESKQSRVFQILEE-------LRIFDIKDRIIGNDFERG--ISGGEKRRVSIACEL 555

Query: 612 IKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR-LSTIRRSENIVVLG 670
           +  P IL LDE TS LD  +   +  +L RL ++   T++   H+  S I    N +VL 
Sbjct: 556 VTSPLILFLDEPTSGLDANNANNVITSLVRLAKNYNRTLILTIHQPRSNIFNQFNKLVLL 615

Query: 671 NDGSVIEAG 679
           + G ++ +G
Sbjct: 616 SQGEMVFSG 624

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 115/237 (48%), Gaps = 38/237 (16%)

Query: 459 FKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLL--------LRFYD 510
           +K+ +F + T+   +I + +     PG    I+GPSG GKS++ +L+           +D
Sbjct: 697 WKEGNFHHETK---EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFD 753

Query: 511 ANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSG-TIRDNITYG-------LSYTPS 562
             SG+I+ +   +S++  K++  +  V Q +  L++  T+++ + Y        L+    
Sbjct: 754 T-SGSIMFNDIQVSELMFKNVCSY--VSQDDDHLLAALTVKETLKYAAALRLHHLTEAER 810

Query: 563 MDE----IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618
           M+     IR++  K  C N I     G + V G     +SGG+++R+ +   L+  P IL
Sbjct: 811 MERTDNLIRSLGLK-HCENNII----GNEFVKG-----ISGGEKRRVTMGVQLLNDPPIL 860

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDG 673
           +LDE TS LD  +   I   L +L R +  TI+   H  R    +R  N+++L   G
Sbjct: 861 LLDEPTSGLDSFTSATILEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSG 917

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 109/244 (44%), Gaps = 42/244 (17%)

Query: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLL-------------LRFYDANSG 514
           ++  + +     + +  GS + ++G SG GK+T+ ++L             +R+   ++G
Sbjct: 38  SKTNTTLVNTFSMDLPSGSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTG 97

Query: 515 T---------ILIDGQDISKVSAKSLRKH--LGVVQQEPVLMSG-TIRDNITYGLSYTPS 562
           +           +DGQD        ++KH  +  + Q+ VL    T R+ + +      +
Sbjct: 98  SEPNETEPKRAHLDGQD------HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLN 151

Query: 563 MDEIRAVAKKCFCHNFITKF--PDGYDTVIGP---RGALLSGGQRQRIAIARALIKKPKI 617
             E     KK      I +    D  DT++G    RG  LSGG+++R++I   +I  P I
Sbjct: 152 SSE---RTKKLMVEQLIEELGLKDCADTLVGDNSHRG--LSGGEKRRLSIGTQMISNPSI 206

Query: 618 LILDEATSALDVESEGAINYTLGRLMRSKEIT-IVSIAHRLSTIRRSENIVVLGNDGSVI 676
           + LDE T+ LD  S   +  TL +L +    T I+SI    S I    + V + + G+V+
Sbjct: 207 MFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVV 266

Query: 677 EAGK 680
              K
Sbjct: 267 YCDK 270

>NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON}
           Anc_1.427
          Length = 1097

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 122/288 (42%), Gaps = 58/288 (20%)

Query: 428 AASRLFELTDYKKSVPSTVG-QTFVPRD-----------GRIEFKDVSFSYPTRPT---- 471
           A S +F  TD   S  +  G +  +P D             + F+++S+  P  P     
Sbjct: 366 AGSPMFRSTDDLNSKDTKKGSRILLPEDEDNDFLQTNNAATLTFENISYRVPQLPGDHGN 425

Query: 472 ----------SQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL--RFYDANSGTILID 519
                       I   +   + PG    I+G SG GK+T+  +L   R     +GTI ++
Sbjct: 426 NNSNNDNDDGKSILNNISGIVKPGQIFAIMGGSGAGKTTLLDILAMKRKTGIVTGTIKVN 485

Query: 520 GQDISKVSAKSLRKHLGVVQQ-----------EPVLMSGTIRDNITYGLSYTPSMDEIRA 568
           GQ IS+   K   K  G V Q           E VL S  +R  +   +S+      +  
Sbjct: 486 GQTISR---KDYSKLTGFVDQNDYLHPMLTVYETVLNSALLR--LPRSMSFEAKESRVYQ 540

Query: 569 VAKKCFCHNFITKFPDGYDTVIGP---RGALLSGGQRQRIAIARALIKKPKILILDEATS 625
           V ++        +  D  D +IG    RG  +SGG+++R++IA  L+  P IL LDE TS
Sbjct: 541 VLEE-------LRIFDIKDRIIGSDFERG--ISGGEKRRVSIACELVTSPLILFLDEPTS 591

Query: 626 ALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGN 671
            LD  +   +  +L RL +    T+V   H  R +   + + +V+L N
Sbjct: 592 GLDANNASNVINSLVRLSQHYNRTLVLTIHQPRSNIFYQFDKLVLLSN 639

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 95/201 (47%), Gaps = 31/201 (15%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRF---YDANSGTILIDGQDISKVSAKSLRKHLGVVQQE 541
           GS++ I+GP+  GKS+I  ++      Y+ N G + I  ++           ++  + Q+
Sbjct: 638 GSSLLILGPNSCGKSSIQRIIAEIWPVYNKN-GLLSIPSEN-----------NIFCIPQK 685

Query: 542 PVLMSG-TIRDNITYGLSYTPSMDEIRAVAKKCFCH-------NFITKFPDG--YDTVIG 591
           P    G T+RD I Y +S     D  R    K           +++ K   G  Y   + 
Sbjct: 686 PYFSKGGTLRDQIIYPMSSDEFFD--RGFKDKELVQILVEVRLDYLLKRGVGLTYLDAVA 743

Query: 592 PRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIV 651
               LLSGG++QR+  AR +  KP  ++LDEAT+A+ V+ E      L  L++      +
Sbjct: 744 DWKDLLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDMEDY----LFNLLKRYRFNFI 799

Query: 652 SIAHRLSTIRRSENIVVLGND 672
           SI+ R + I+  E ++ +G +
Sbjct: 800 SISQRPTLIKYHEMLLEIGEN 820

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 63.9 bits (154), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 104/245 (42%), Gaps = 52/245 (21%)

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I+ +DVSF +   P+  + K + L +   S + IVG +G GK+T+  +L+          
Sbjct: 532 IQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILM---------- 579

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
                       + LR   G V + P L          +   +  SMD + A A     +
Sbjct: 580 ------------EQLRPLQGYVSRNPRLRVAY------FTQHHVDSMD-LNASAVDWMSN 620

Query: 577 NFITKFPDGYDTVIGPRG----------ALLSGGQRQRIAIARALIKKPKILILDEATSA 626
            F  +  + Y   +G  G           LLSGGQ+ R+A A   +  P IL+LDE ++ 
Sbjct: 621 TFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 627 LDVESEGAI-----NYTLGRLMRSKEITIVS-IAHRL-----STIRRSENIVVLGNDGSV 675
           LD     A+      +T G LM S +I+++  + + +      T+RR E  +    +  +
Sbjct: 681 LDTAGLDALMDALKKFTGGVLMVSHDISVIDGVCNEIWVSENGTVRRFEGTIFDYKNYII 740

Query: 676 IEAGK 680
             AGK
Sbjct: 741 ASAGK 745

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH 655
            SGG R R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +++   T+V ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSH 422

>CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011c ADP1
           ATP-dependent permease
          Length = 1055

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 119/243 (48%), Gaps = 21/243 (8%)

Query: 453 RDGRIEFKDVSFSYPTRPTSQIFKKLRLT------ITPGSNVCIVGPSGRGKSTIASLLL 506
           +   + F+++++       S+  +K R+       + PG  + I+G SG GK+T+  +L 
Sbjct: 365 KSATLTFENINYYVAASANSRSDEKQRVLNDISGLVKPGEILSIMGGSGAGKTTLLDILA 424

Query: 507 --RFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLM-SGTIRDNI-TYGLSYTPS 562
             R     SG+I ++G+ +S+   K   K +G V Q+  L+ + T+ + +    L   P 
Sbjct: 425 MKRKTGDVSGSIRVNGKVVSR---KDYTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPR 481

Query: 563 MDEIRAVAKKCFCHNFITKFPDGYDTVIG---PRGALLSGGQRQRIAIARALIKKPKILI 619
                A   + F      +  D  D ++G    RG  +SGG+++R++IA  L+  P +L 
Sbjct: 482 TMSFEAKQARVFHVLEELRIMDIKDRIVGNDFERG--ISGGEKRRVSIACELVTSPLVLF 539

Query: 620 LDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDGSVIE 677
           LDE TS LD  +   +   L RL R+ + T+V   H  R +   R + +V+L   G ++ 
Sbjct: 540 LDEPTSGLDANNANNVIECLVRLARNYDRTLVMSIHQPRSNIFYRFDKLVLLSR-GELVY 598

Query: 678 AGK 680
           +G+
Sbjct: 599 SGE 601

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 92/197 (46%), Gaps = 20/197 (10%)

Query: 485 GSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVL 544
            S++ I+GP+G GKS+I  ++   +   +   L+   D S +        L + Q+    
Sbjct: 640 ASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSL--------LCIPQKPYFT 691

Query: 545 MSGTIRDNITYGLSYTPSMDE------IRAVAKKCFCHNFITKFPD-GYDTVIGPRGALL 597
             GT RD I Y +S     D       +  +  +      + + P   Y   +     +L
Sbjct: 692 RGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWKDVL 751

Query: 598 SGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRL 657
           SGG++QR+  AR L  KPK ++LDEAT+A+  + E      L  +++    + ++I+ R 
Sbjct: 752 SGGEKQRMNFARILFHKPKFIVLDEATNAISADMEDY----LFNMLKKFRFSFITISQRP 807

Query: 658 STIRRSENIVVLGN-DG 673
           S I+  + ++ + + DG
Sbjct: 808 SLIKYHDMLLEIADRDG 824

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 101/240 (42%), Gaps = 48/240 (20%)

Query: 457 IEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTI 516
           I+ +DVSF Y    +  + K + L +   S + +VG +G GK+T+               
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLL-------------- 576

Query: 517 LIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCH 576
                   KV  + LR   G V + P L  G       +   +  SMD + A A      
Sbjct: 577 --------KVMMEQLRPITGHVSRNPRLRIGY------FTQHHIDSMD-LNASAVDWMSK 621

Query: 577 NFITKFPDGYDTVIGPRG----------ALLSGGQRQRIAIARALIKKPKILILDEATSA 626
            F  K  + Y   +G  G           LLSGGQ+ R+A A   +  P ILILDE ++ 
Sbjct: 622 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNH 681

Query: 627 LDVESEGAI-----NYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKF 681
           LD     A+     N++ G LM S +I+++        I  SE+  V   DG++ +  K+
Sbjct: 682 LDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 11/97 (11%)

Query: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHR 656
            SGG R R+++ARAL  +P +L+LDE ++ LDV S   I Y L   +++   T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 657 LSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELF 693
            S +      ++  ++  +       D YR +D + F
Sbjct: 425 RSFLNEVATDIIYQHNERL-------DYYRGQDFDSF 454

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 112/235 (47%), Gaps = 18/235 (7%)

Query: 455  GRIEFKDVSFSYPTR-PTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLL-RFYDAN 512
            G   +K+V+F+ P +  T ++   +     PGS   ++G SG GK+T+ + L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 513  SGTILIDGQDISKVSAKSLRKHLGVVQQEPV-LMSGTIRDNITYGL-----SYTPSMDEI 566
            +G +L++G+ I      S  +  G VQQ+ V +   T+R++  +          P  +++
Sbjct: 903  TGDMLVNGKPID----ASFERRTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKL 958

Query: 567  RAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILI-LDEATS 625
              V K       I    D  + +IG  G  L+  QR++++I   L  KP +L+ LDE TS
Sbjct: 959  AYVEKII----EILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTS 1014

Query: 626  ALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTI-RRSENIVVLGNDGSVIEAG 679
             LD +S  AI   + RL  + +  + +I    +T+    + +++L   G  +  G
Sbjct: 1015 GLDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1069

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 92/230 (40%), Gaps = 25/230 (10%)

Query: 468 TRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLL---LRFYDANSGTILIDGQDIS 524
            R    I +   L   PG  V ++G  G G S+    +    R ++   G+I  DG    
Sbjct: 160 NRGNRDIVRNASLLARPGDMVLVLGRPGAGCSSFLKTIAGETRNFEEVRGSISYDGIPQE 219

Query: 525 KVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPD 584
           ++  K     +   + +      T++  + + LS T     +   ++      +IT   +
Sbjct: 220 EMMKKYKTDVIYNGEMDVHFPHLTVQQTLDFALSCTTPRVRLDGASRS----EYITAMRE 275

Query: 585 GYDTVIGPRGAL-----------LSGGQRQRIAIARALIKKPKILILDEATSALD----V 629
            Y T+ G R              +SGG+R+R++IA AL  +  I   D AT  LD    +
Sbjct: 276 LYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTAL 335

Query: 630 ESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAG 679
           E   AI  T+  L +S  I +V+I      I    + V +  DG  I  G
Sbjct: 336 EFAQAIR-TMTNLQKS--IALVTIYQASENIYECFDKVTVLYDGRQIFFG 382

>Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {ON}
           YOL075C (REAL)
          Length = 1302

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 108/237 (45%), Gaps = 35/237 (14%)

Query: 459 FKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTI---------ASLLLRFY 509
           FK+   S     T +I + +     PG    I+GPSG GKS++         +SL  +F 
Sbjct: 702 FKNWKESKLHHETKEILQSVNAVFKPGMINAIMGPSGSGKSSLLNLISGRLKSSLFAKF- 760

Query: 510 DANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSY---------- 559
              SGTI+ +   +S++  K++  ++     + +L + T+++ + Y  +           
Sbjct: 761 -DTSGTIMFNDIQVSELMFKNVCSYVSQ-DDDHLLATLTVKETLKYAAALRLHHLNEAER 818

Query: 560 TPSMDE-IRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKIL 618
           T   D  IR++  K  C N I     G + V G     +SGG+++R+ +   L+  P IL
Sbjct: 819 TERTDNLIRSLGLK-HCENNII----GNEFVKG-----ISGGEKRRVTMGVQLLSDPPIL 868

Query: 619 ILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAH--RLSTIRRSENIVVLGNDG 673
           +LDE TS LD  +   I   L  L +    T++   H  R    +R  N+++L   G
Sbjct: 869 LLDEPTSGLDSFTSATILEILENLCKEHGKTVIITIHQPRSELFKRFGNVLLLAKSG 925

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 584 DGYDTVIGP---RGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 640