Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR021W6.6ON62622282e-26
Ecym_30086.6ON61621483e-14
Kthe_YGOB_Anc_6.66.6ON62611344e-12
Kwal_56.223336.6ON62621329e-12
Sklu_YGOB_Anc_6.66.6ON61621311e-11
Klac_YGOB_Anc_6.66.6ON61621301e-11
TDEL0G046506.6ON62621259e-11
Kpol_1045.826.6ON62621232e-10
TBLA0A072006.6ON65531214e-10
YPL271W (ATP15)6.6ON62621162e-09
KAFR0B064906.6ON66611111e-08
Smik_6.4796.6ON62621102e-08
Skud_16.66.6ON62621102e-08
CAGL0A01111g6.6ON69611051e-07
Suva_16.346.6ON62621005e-07
ZYRO0F00418g6.6ON62601006e-07
TPHA0J002306.6ON6254883e-05
NDAI0I027406.6ON6659884e-05
KNAG0E027906.6ON6563823e-04
NCAS0D022006.6ON8560824e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR021W
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    92   2e-26
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    62   3e-14
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    56   4e-12
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    55   9e-12
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    55   1e-11
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    55   1e-11
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    53   9e-11
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    52   2e-10
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    51   4e-10
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    49   2e-09
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    47   1e-08
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    47   2e-08
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       47   2e-08
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    45   1e-07
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    43   5e-07
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    43   6e-07
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    39   3e-05
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    39   4e-05
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    36   3e-04
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    36   4e-04

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 92.4 bits (228), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 48/62 (77%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAGLTYNSY              ELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

Query: 61 RK 62
          RK
Sbjct: 61 RK 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 61.6 bits (148), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAGL+YN+Y              EL++ AVL+RS TEAKVI+Y   G+A++AVPL
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKD-GAASDAVPL 59

Query: 61 RK 62
          +K
Sbjct: 60 KK 61

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 56.2 bits (134), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 34/61 (55%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAGLTYN+Y              +LQ+  VL RS TEA+ I Y      AEA PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 R 61
          +
Sbjct: 61 K 61

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 55.5 bits (132), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 37/62 (59%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAGLTYN+Y              E Q+  VL+RS TEA+ + Y +  + AE+ PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 RK 62
          ++
Sbjct: 61 KE 62

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 55.1 bits (131), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAGLTYN+Y              E Q+  VL+RS +EAK I + + G+ ++ +PL
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFEN-GTPSDPIPL 59

Query: 61 RK 62
          +K
Sbjct: 60 KK 61

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 54.7 bits (130), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 38/62 (61%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MS WRKAGLT+N+Y              ELQ+ +VL RS +EAK I + + G A+E VPL
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFEN-GVASEPVPL 59

Query: 61 RK 62
          +K
Sbjct: 60 KK 61

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 52.8 bits (125), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 37/62 (59%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          M+AWRKAGLTYN+Y              ELQ   VL RS T+A+ + Y    +A+++VPL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 RK 62
          ++
Sbjct: 61 QE 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 52.0 bits (123), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAG+TYN Y              EL++  VL RS TEAK + + +     E VP+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 RK 62
          ++
Sbjct: 61 QQ 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 51.2 bits (121), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGS 53
          MSAWRKAG+TYN+Y              ELQ+ AV++RS TEA+   Y +KGS
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKY-TKGS 52

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 49.3 bits (116), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAG++Y +Y              ELQ+ +VLNRS T+A    Y +  +A+E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 61 RK 62
           K
Sbjct: 61 TK 62

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 47.4 bits (111), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 33/61 (54%)

Query: 2  SAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLR 61
          S WRKAGLTY SY              E Q+ AV +RSVTEA V +Y +    ++  PL+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 K 62
          K
Sbjct: 63 K 63

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 47.0 bits (110), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAG++Y +Y              ELQ+ +VL+RS T+A    Y +  +A+E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 61 RK 62
           K
Sbjct: 61 TK 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 47.0 bits (110), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAG++Y +Y              ELQ+ +VL+RS T+A    Y +  +A+E  P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 61 RK 62
           K
Sbjct: 61 TK 62

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 45.1 bits (105), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%)

Query: 2  SAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLR 61
          +AWRKAGL+Y+S+              ELQ+PAV+ R  T+A    Y      ++ +PL+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 62 K 62
          +
Sbjct: 69 E 69

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 43.1 bits (100), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAG++Y +Y              ELQ+  VL+RS T+A    Y +  +A+E V +
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

Query: 61 RK 62
           K
Sbjct: 61 TK 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 43.1 bits (100), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60
          MSAWRKAGLTYN+Y              E Q+ AVL+R   ++K   +       E  PL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 38.5 bits (88), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 1  MSAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSA 54
          MS WRKAGLTY++Y              +L++ +VL+RS T+ K   +  KG+A
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIF-EKGTA 53

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 38.5 bits (88), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 29/59 (49%)

Query: 4  WRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLRK 62
          WRKAG+TY++Y              ELQ+  V+ RS T+A    Y     A+E   L+K
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 36.2 bits (82), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 1  MSA-WRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVP 59
          MSA W+KAG+TY +Y              ELQ+  VL+R  T+A    Y      A+  P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 LRK 62
          L++
Sbjct: 61 LQE 63

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 36.2 bits (82), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%)

Query: 2  SAWRKAGLTYNSYXXXXXXXXXXXXXXELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLR 61
          +  RKAG+TY  Y              ELQ+P V+ RS T+A    Y      A+  PL+
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.121    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,952,569
Number of extensions: 64068
Number of successful extensions: 98
Number of sequences better than 10.0: 20
Number of HSP's gapped: 98
Number of HSP's successfully gapped: 20
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)