Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR020C6.7ON1002100247130.0
Ecym_30096.7ON1027103025720.0
KLLA0D00792g6.7ON1020103420440.0
Kwal_56.223346.7ON1008101919780.0
NCAS0F001806.7ON1018105019030.0
KAFR0L003306.7ON1028105218870.0
KLTH0C11594g6.7ON1006101418770.0
YEL055C (POL5)6.7ON1022104318480.0
Skud_5.346.7ON1019104418370.0
TDEL0G046406.7ON1017104818300.0
KNAG0E009706.7ON1004102918060.0
Smik_5.326.7ON1020104018050.0
Suva_5.136.7ON1023104517570.0
TPHA0J002506.7ON1024106217080.0
SAKL0E00770g6.7ON104771016480.0
TBLA0A072106.7ON1041106214890.0
Kpol_1045.806.7ON101971114460.0
NDAI0K029106.7ON106374513901e-175
ZYRO0F00440g6.7ON103972713821e-174
CAGL0B03553g6.7ON102171611901e-146
Kpol_1037.593.247ON56583781.4
TPHA0K013804.151ON31876752.6
TPHA0E036901.45ON817167744.0
ZYRO0A01144g2.225ON46094727.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR020C
         (1002 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...  1820   0.0  
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   995   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   791   0.0  
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   766   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   737   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   731   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   727   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   716   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   712   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   709   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   700   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   699   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   681   0.0  
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   662   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   639   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   578   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   561   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   540   e-175
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   536   e-174
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   462   e-146
Kpol_1037.59 s1037 complement(145104..146801) [1698 bp, 565 aa] ...    35   1.4  
TPHA0K01380 Chr11 (286554..287510) [957 bp, 318 aa] {ON} Anc_4.1...    33   2.6  
TPHA0E03690 Chr5 (781473..783926) [2454 bp, 817 aa] {ON} Anc_1.4...    33   4.0  
ZYRO0A01144g Chr1 (82681..84063) [1383 bp, 460 aa] {ON} similar ...    32   7.6  

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score = 1820 bits (4713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 924/1002 (92%), Positives = 924/1002 (92%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61   SARLGFSLCLTEVAAAALENGHIGSXXXXXXXXXXXXPVDKVKNGKEERGQLFGRMFGLQ 120
            SARLGFSLCLTEVAAAALENGHIGS            PVDKVKNGKEERGQLFGRMFGLQ
Sbjct: 61   SARLGFSLCLTEVAAAALENGHIGSAEEYLERLEAALPVDKVKNGKEERGQLFGRMFGLQ 120

Query: 121  AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA 180
            AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA
Sbjct: 121  AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA 180

Query: 181  TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD 240
            TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD
Sbjct: 181  TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD 240

Query: 241  NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHI 300
            NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHI
Sbjct: 241  NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHI 300

Query: 301  AKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSL 360
            AKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSL
Sbjct: 301  AKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSL 360

Query: 361  VQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGT 420
            VQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGT
Sbjct: 361  VQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGT 420

Query: 421  INFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDISKIKFILDTLLHVIRA 480
            INFDKLTKSKTTDSLVTAKS                  HENTDISKIKFILDTLLHVIRA
Sbjct: 421  INFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEHENTDISKIKFILDTLLHVIRA 480

Query: 481  HKWKAHLSWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLFSVLGELIPLSKHDMG 540
            HKWKAHLSWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLFSVLGELIPLSKHDMG
Sbjct: 481  HKWKAHLSWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLFSVLGELIPLSKHDMG 540

Query: 541  APSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPNENPQLFGL 600
            APSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPNENPQLFGL
Sbjct: 541  APSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPNENPQLFGL 600

Query: 601  ELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKKSMLRK 660
            ELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKKSMLRK
Sbjct: 601  ELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKKSMLRK 660

Query: 661  LTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEELGSDEAGTXXXXXX 720
            LTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEELGSDEAGT      
Sbjct: 661  LTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEELGSDEAGTDNEDQS 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXAKIDKEATSALAHALRLPDNILDEDGNVGFXXXXXXXX 780
                                  AKIDKEATSALAHALRLPDNILDEDGNVGF        
Sbjct: 721  SESNEDSSDEVSDQEDYSDEDVAKIDKEATSALAHALRLPDNILDEDGNVGFEEMDDEEE 780

Query: 781  XXXXXXXXXXXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLE 840
                        LDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLE
Sbjct: 781  EEESMDDEAMMELDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLE 840

Query: 841  IYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKP 900
            IYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKP
Sbjct: 841  IYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKP 900

Query: 901  AAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDP 960
            AAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDP
Sbjct: 901  AAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDP 960

Query: 961  STSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSKN 1002
            STSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSKN
Sbjct: 961  STSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSKN 1002

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
            Ashbya gossypii ACR020C
          Length = 1027

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1030 (50%), Positives = 698/1030 (67%), Gaps = 34/1030 (3%)

Query: 3    RQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSA 62
            +QVNRDLFY+L SD+ +ERV++A+ ++ EL+E+  ++N +EW+YVLGRL++GLAS+ + A
Sbjct: 2    KQVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGA 61

Query: 63   RLGFSLCLTEVAAAALENGHIGSXXXXXXXXXXXXPVDKVKNGKEERGQLFGRMFGLQAM 122
            RLGFS+CL+EV    LE G + S                VKNGKEERG +FG++FGLQA+
Sbjct: 62   RLGFSMCLSEVVTLGLEKGRLESVEVYIGQLFEKLADGHVKNGKEERGLVFGKLFGLQAL 121

Query: 123  LNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRATD 182
            LNEPLF R+F+ G   I   F   FM  LV+LAL+K WLR+PCLFTLYQ+IE+L+ + T+
Sbjct: 122  LNEPLFGRIFMDGK-VIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQLIEKLSSKFTE 180

Query: 183  TEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKADNP 242
               L A+  LLD H LT T+EGLAIYL L  +C E K +L ++KI   + L   WK ++P
Sbjct: 181  VGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKITLRSCWKNNDP 240

Query: 243  LAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHIAK 302
            L+KGN   L+SVLKD   +E +  KQKG W PRLHFVWD+L+P+L  ++  P    H+ K
Sbjct: 241  LSKGNVTILSSVLKDIIPVEDNVMKQKGSWAPRLHFVWDILIPILCRQQEIPGAAEHVPK 300

Query: 303  KHKTGKKPKSAE-SGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSLV 361
            K KT KK K  +    LSF EFWQVVVDESFF+ KASSERKYLG+LI+EKA++ VPSS V
Sbjct: 301  KRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYLGLLIIEKAMQCVPSSYV 360

Query: 362  QDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGTI 421
              IFSKN +RTLINQSSE+TR+LHK+S N LK IVS CE+D +KV+PV+ ++WFGPNG+I
Sbjct: 361  PSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPTKVLPVVNSLWFGPNGSI 420

Query: 422  NFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDISKIKFILDTLLHVIRAH 481
            NFD LTKSKT DS++  +                    E++ +SK++++LD LLH+++AH
Sbjct: 421  NFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSPVSKVRYLLDILLHIVQAH 480

Query: 482  KWKAHLSWTNPLLLALVRYAFFS------------APSHLSEQSEEIITLSRERLFSVLG 529
            K KA + WT PLL ++V+ +FF+            A +    +S++I  LSRERLFS+LG
Sbjct: 481  KLKADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADADAESKKIPVLSRERLFSILG 540

Query: 530  ELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTK 589
            +LIP SK ++  P+W Y TL++++ E+ +  L  +LD EL+    +ALK +  I  KS +
Sbjct: 541  QLIPTSKQNVDGPTWPYVTLQIVIAEEHRRSLIFKLDEELQQTKEHALKAINDIRKKSQE 600

Query: 590  SPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLS 649
            SP  +    GLELLL V+ILQ+++GD +SAS LEEL +FY+S      NGLVGITEILLS
Sbjct: 601  SPQASELC-GLELLLGVTILQMYSGDAESASILEELTTFYKS-IDTKPNGLVGITEILLS 658

Query: 650  LVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEELGS 709
            +VAQKK++LR+LTL+VWES IDK+  +EL LL + LS RENK GFA LFE ADEY E+  
Sbjct: 659  MVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVRENKQGFAALFEAADEYVEVDD 718

Query: 710  DEAGTXXXXXXXXXXXXXXXXXXXXXXX--------------XXXXXAKIDKEATSALAH 755
            DE                                              KI+KE TSALA 
Sbjct: 719  DEINEDVDISHENCDSSDHNDSHSSSYFEECGSNEEDSGNNGYNEYIDKINKETTSALAD 778

Query: 756  ALRLPDNILDEDGNVGF---XXXXXXXXXXXXXXXXXXXXLDGQLSEIFKRRKDALNKIP 812
            AL+LP+N++DE+G+VGF                       LDGQLSEIFKRRK+AL+K+P
Sbjct: 779  ALKLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEAMMELDGQLSEIFKRRKEALSKVP 838

Query: 813  TGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMV 872
            TGN+RK+E +ESR+SVI+FKHRV+DMLEIYCK V R   K+++  A+   N+ SM +P++
Sbjct: 839  TGNKRKLEVRESRESVISFKHRVLDMLEIYCKYVVRLAGKSQQCEASKLLNIHSMIDPLL 898

Query: 873  KAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHATILSPKPG 932
            K IQQT+DRPLAEK +KLLKN +CK+K   +K    E++ E +  SLEN+H ++L+ KPG
Sbjct: 899  KCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVS-EIVFLSLENIHNSMLAKKPG 957

Query: 933  QFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKHWNVSGKFGPNFFIDFI 992
            QF QL+F ACS++SLFL K+L+  K D  T  ++I IYS ++K+W V GKFGPNFFIDFI
Sbjct: 958  QFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFI 1017

Query: 993  NWLASKKSKN 1002
            NWLASK+SKN
Sbjct: 1018 NWLASKRSKN 1027

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1034 (44%), Positives = 631/1034 (61%), Gaps = 60/1034 (5%)

Query: 4    QVNRDLFYKLTSDLSDERVQSAIALITELNELAV---EENGKEWEYVLGRLVRGLASSNK 60
            +VNRDLF+K+ S+L  ER+++AI LI E++ +     E+  +EWEYV+GRLV+GLAS+  
Sbjct: 9    RVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASNRG 68

Query: 61   SARLGFSLCLTEVAAAALENGHI-GSXXXXXXXXXXXXPVDKV-KNGKEERGQLFGRMFG 118
             ARLGFS+CLTEV A ALE   I  S            P     KNGKEERG LFG+MF 
Sbjct: 69   GARLGFSMCLTEVIALALERRDILPSIYAFLNQLEQTLPAGTAFKNGKEERGVLFGQMFA 128

Query: 119  LQAMLNEPLFSRVFVA-GDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLA 177
            LQ++LNEP+FS++F++  D  I   F   ++ +L+QLAL+K WLR+PCL+++YQ I++  
Sbjct: 129  LQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLYSVYQTIQKCE 188

Query: 178  PRA-TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKR 236
             R   D   +  +L LLDE  LT T+EGL+IYL    +         +T     +     
Sbjct: 189  TRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQ--------RDTYSSSLVIHNSG 240

Query: 237  WKADNPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEE-KVSPD 295
            WK ++PL+KGN + LASVLKD   +E    KQKG W PRLH+VWD+LLPLL ++      
Sbjct: 241  WKNNDPLSKGNVQLLASVLKDVVPVEKSDLKQKGTWAPRLHYVWDILLPLLEDDGSFGQS 300

Query: 296  THVHIAKKHKTGKKPKSAE-SGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVR 354
               HI+KK K      S+E +G + F +FWQ VVDESFF+EK+S+ERKYLG LI+E+A++
Sbjct: 301  MESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNERKYLGFLILEEAIK 360

Query: 355  SVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIW 414
                 L+Q + S+N LR +INQS ++ R L+K+S   LK+IV+ CE   +KVVP++   W
Sbjct: 361  VCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECERSPAKVVPLVEVFW 420

Query: 415  FGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENT---DISKIKFIL 471
            FG NG+INFDKL KSK  +SL++  S                   + +     +  +FI 
Sbjct: 421  FGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQDQSTKDSFNLTRFIF 480

Query: 472  DTLLHVIRAHKWKAHLSWTNPLLLALVRYAFF--SAPSHLSEQSEEIITLSRERLFSVLG 529
            DT LH+ RAHK +    W  PLL A+++ AFF  S  S LSE       L++ERL+S+LG
Sbjct: 481  DTFLHITRAHKTRLESHWVKPLLSAIIKAAFFNESDNSKLSE-------LAKERLYSILG 533

Query: 530  ELIP-LSKHDMGAPSWAYATLELLLQ-EKEKHPLALQLDAELETVTSNALKILRKIINKS 587
            ELI   SK      +W Y  L+++L+ E     L++ LD +LE+V  +A+K L++  N S
Sbjct: 534  ELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIKSLKQ--NHS 591

Query: 588  TKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEIL 647
                N NP+L GLELLLSV+ILQ++AGD +S S L++L SFYE   + + + LVGITEIL
Sbjct: 592  DNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECDKESTD-LVGITEIL 650

Query: 648  LSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEEL 707
            LSLVAQ+KS+L+KL+L+VWESF+  +G+ EL +LL TL+ARENK GFA LFEG +E ++ 
Sbjct: 651  LSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLFEGDEEEDDE 710

Query: 708  GSDEAGTXXXXXXXXXX-------XXXXXXXXXXXXXXXXXXAKIDKEATSALAHALRLP 760
             + E GT                                    KI+KEATSALA AL LP
Sbjct: 711  DAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAALEKIEKEATSALAKALNLP 770

Query: 761  DNILDEDGNVGFXXXXXXXXXX------------XXXXXXXXXXLDGQLSEIFKRRKDAL 808
            D+I+ E G+V                                  LD QLSEIFKRRK+AL
Sbjct: 771  DSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQLDDQLSEIFKRRKEAL 830

Query: 809  NKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSA--NMLS 866
              +PTGN+RK+E +ESR++VI+FKHRVVDMLEIY K+ +R+V +N     T+    N+ S
Sbjct: 831  GSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRAVARNNTSIITVEEWNNLSS 890

Query: 867  MAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHATI 926
            +  P++K +Q TLD+ LA+K +KL+K  +CK+K    KE  +  +E  I   LE VH  I
Sbjct: 891  IILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKEEKTVTSE--IFHLLEKVHKLI 948

Query: 927  LSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKHWNVSGKFGPN 986
            ++ KPGQF QLFFS CS  SLFLSK+ ++      + E +I +Y+ T K W   GK   N
Sbjct: 949  MTAKPGQFQQLFFSTCSLASLFLSKLYLS---SGGSHENLIDLYADTSKAWMKDGKCTVN 1005

Query: 987  FFIDFINWLASKKS 1000
            FFIDF NWL +K++
Sbjct: 1006 FFIDFSNWLQTKRA 1019

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
            (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1019 (42%), Positives = 605/1019 (59%), Gaps = 37/1019 (3%)

Query: 4    QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSAR 63
            ++NRDLFYKL SDLS+ER+Q+ I L+T+L++L  E++  EW+YVL RL++GL+SS   AR
Sbjct: 5    EINRDLFYKLASDLSEERLQATIDLVTQLSKL--EKDSSEWQYVLDRLIKGLSSSRNGAR 62

Query: 64   LGFSLCLTEVAAAALENGHIGSXXXXXXXXXXXXPVDKVKNGKEERGQLFGRMFGLQAML 123
            LGFSLCLTEV A ALE G +                + VKNGKEERG LFG++FGLQ +L
Sbjct: 63   LGFSLCLTEVVALALEKGVLARVDQYMHLLISALSKENVKNGKEERGLLFGKLFGLQVLL 122

Query: 124  NEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRATDT 183
            NEPLFS+VF   + Q+       +M  L+ +AL K W+R+  LFTL+Q +E+LAP     
Sbjct: 123  NEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQAVEKLAPLLGSR 182

Query: 184  EFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKADNPL 243
            + L+AVL LLD   LT TSEGLAIYLFL ++C     +L +    D L L   WK ++PL
Sbjct: 183  QPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHTGPVLRKKGFLDELNLKNPWKNNDPL 242

Query: 244  AKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHIAKK 303
             +GN  A+++ LKD    +     QKGVW PRLHF WD++L           T +H    
Sbjct: 243  KRGNLPAISNALKDSGARDDPSLTQKGVWAPRLHFAWDIVL----------QTLLHAENS 292

Query: 304  HKTGKKPKS------AESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVP 357
              T  +P S       +   + F EFW+ VVDESFF+EK+SSERKYLG+L+ EK  +  P
Sbjct: 293  EITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFEKTFQLSP 352

Query: 358  SSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGP 417
               +  +FSKN +R LINQ     R+LHK+S   L TIV  C+    K  P    + FG 
Sbjct: 353  PRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQPEKTAPSFVGLSFGE 412

Query: 418  NGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDISKIKFILDTLLHV 477
             GTINFD LTK+KT +SL++ KS                      ++S+ +FILD +LH+
Sbjct: 413  YGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKELSRARFILDAILHL 472

Query: 478  IRAHKWKAHLSWTNPLLLALVRYAFF--SAPSHLSEQSEEIITLS---RERLFSVLGELI 532
            +RAHK  A   W  P+L ALV   FF  S    + +  E   +LS    ERLFS+L +L+
Sbjct: 473  VRAHKAHADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSSIASERLFSILADLL 532

Query: 533  PLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPN 592
             + + D  +  W +  ++LL  +  +  L   +D EL  +  +++ +L  I  K+ ++  
Sbjct: 533  TV-EQDTYSVCWPFIAVQLLKTDTNQKTLLQSMDEELGDILDSSMTVLSSISQKANEA-- 589

Query: 593  ENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNG-LVGITEILLSLV 651
               Q  GL+LL SV+ILQ +AG+V+S S LE+L SF      GA +  L G  EILLSL 
Sbjct: 590  NLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAKSAPLAGFIEILLSLA 649

Query: 652  AQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEELGSDE 711
            AQKK++ RK +L+ WESF+  V +++L +LLN L  RENK GF+ LFEG  E E    ++
Sbjct: 650  AQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSNLFEGGSESEGDSEED 709

Query: 712  AGTXXXXXXXXXXX-----XXXXXXXXXXXXXXXXXAKIDKEATSALAHALRLPDNILDE 766
                                                 KIDKEATSALA AL LPD+I+D+
Sbjct: 710  EEMNDEEEPEKDASDDEIEESDNNVSEDDSSSDDDMGKIDKEATSALAKALNLPDSIVDD 769

Query: 767  DGNVGF----XXXXXXXXXXXXXXXXXXXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAK 822
             G V F                        LDGQLSEIFKRRK+AL+KIPTGN+RK E K
Sbjct: 770  KGEVRFEDLGDTDEEEEESEEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVK 829

Query: 823  ESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRP 882
            ESR++VIAFKHRVVDMLEI  + +E  + K+  +  ++   + ++  P++  I+ TLD+P
Sbjct: 830  ESRENVIAFKHRVVDMLEILVRWIESKMKKDGHIEKSVLDKVFAIILPLLDCIRTTLDKP 889

Query: 883  LAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSAC 942
            LAEKI+KLLKN +CK+KP ++   T +++++++L+ L +VH  +L  K GQF  L+FS C
Sbjct: 890  LAEKIAKLLKNKICKLKP-SFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGC 948

Query: 943  SSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSK 1001
            S+TS+FL+++++    +  T E++ GIY  T+  W V+GKFG + F++F+NWL+ KK++
Sbjct: 949  STTSMFLARLVVDTFPELETYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNWLSVKKTQ 1007

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1050 (43%), Positives = 622/1050 (59%), Gaps = 83/1050 (7%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRDLFYKL SDL +ER Q+AI+L+ EL  L + +  +EW YV+ RL++GLAS   
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   SARLGFSLCLTEVAAAAL---ENGHIG-----------SXXXXXXXXXXXXPVDKVKNGK 106
            SARLGFSLCLTEV   AL   EN   G           S               K K G+
Sbjct: 61   SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120

Query: 107  EERGQLFGRMFGLQAMLNEPLFSRVFVAG-DGQIQ-QAFAHQFMQRLVQLALTKAWLRQP 164
            +ERG LFG+MFGLQA+ NEP+FS VF+   DG+ +   FA +FM  +V LAL K W+++ 
Sbjct: 121  DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180

Query: 165  CLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYL-FLQNKCPEIKRILD 223
            CLFTL+Q I++L P A    +L ++L+LLD HNL+ TSEGLA+YL  L     + K  LD
Sbjct: 181  CLFTLFQTIQKLLPYANKDTYL-SILSLLDSHNLSLTSEGLAVYLTILYGDTNDNK--LD 237

Query: 224  ETKIFDALPLVKRWKADNPLAKGNAKALASVLKDDALI------EGDGPKQKGVWTPRLH 277
             + I    P    WK ++PL++GN   L  VL+D ++       E    +    W PRLH
Sbjct: 238  TSSIEFKNP---GWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLH 294

Query: 278  FVWDLLLPLLAEEKVSPDTHV-HIAKKHKTGKK--PKSAESGMLSFGEFWQVVVDESFFS 334
            FVWD+LLP+L   K +  ++  HI+KK K      PK  E     F EFWQ+VVDESFF+
Sbjct: 295  FVWDILLPILISGKHTTASNTQHISKKRKKNNNELPKHIE-----FPEFWQMVVDESFFN 349

Query: 335  EKASSERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKT 394
            EKASSERKYLG LI  K ++ V  + + + FS N +R+LINQS+++ R LHK+S N L T
Sbjct: 350  EKASSERKYLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNT 409

Query: 395  IVSACETDAS-KVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXX 453
            I+  C+ D+S K+V  + A+ FGP+G+INFDKLTKSKT   L++                
Sbjct: 410  IIEVCQEDSSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLF 469

Query: 454  XXXXXHENTDISKIKFILDTLLHVIRAHKWK-AHLSWTNPLLLALVRYAFFSAPSHLSEQ 512
                  ++ +  K +++LDTLLH++R HK    + +   PLL  L+++AFF+      ++
Sbjct: 470  TSNISEKSENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFA------KE 523

Query: 513  SEEIITLSRERLFSVLGEL---IPLSKHDMGAPSWAYATLELLLQEKE--KHPLALQLDA 567
            +E +  L++ER  S+L EL   IP   H     SW Y  L+++L+++   K  L  +LD 
Sbjct: 524  NEPLNELAKERFSSILAELTSVIPKEPHH----SWQYYALDIILKKERTGKFELVNKLDE 579

Query: 568  ELETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELAS 627
             L  + ++A  ++ KII    KSP ++PQL GLE LLS+ +LQ+ +G+ +S ST+EEL  
Sbjct: 580  NLGKIKNDACDVIVKII----KSP-QSPQLNGLESLLSMCLLQLFSGETESLSTIEELIE 634

Query: 628  FY-ESATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLS 686
            FY E         LVGITEILLSL+AQKK++LRKL+L+VWE FI  VGKEEL +LL+ L 
Sbjct: 635  FYKEHKGDTESTSLVGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLK 694

Query: 687  ARENKAGFAQLFEGAD------EYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXXXXXX 740
            ARENK GFA LFEGAD      + +E  S+++                            
Sbjct: 695  ARENKQGFAHLFEGADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDEDDSLDTA 754

Query: 741  XXAKIDKEATSALAHALRLPDNILDEDGNVGFXXXXX----------XXXXXXXXXXXXX 790
                IDKEATSALA AL LP+NI+++ G V                              
Sbjct: 755  EVNNIDKEATSALAKALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKM 814

Query: 791  XXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSV 850
              LD QLSEIFKRRK+AL+   TGNQRKIEAKESR++VIAFK RVVD+L +Y K VE+  
Sbjct: 815  MLLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQ 874

Query: 851  TKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEI 910
            T +    +    N++S  EPMV  +Q+TLD+ LA+K+SKLLK  + K+K + +K   +  
Sbjct: 875  TAD---HSQKFVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFK---NSA 928

Query: 911  NEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTS-EQVIGI 969
            N   +L  L+ +H  +L+ KPGQ PQL+++  SS SLF SK+ +A   D + +  ++I  
Sbjct: 929  NPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQ 988

Query: 970  YSTTMKHWNVSGKFGPNFFIDFINWLASKK 999
            YS T K W    KFGPNFF DF NWLAS+K
Sbjct: 989  YSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1052 (43%), Positives = 642/1052 (61%), Gaps = 81/1052 (7%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M+ +VNRDLFYKL S+L +ER+Q+A+++I EL+ L + ++ +EW YVLGRL++GL+S   
Sbjct: 4    MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61   SARLGFSLCLTEV-------AAAALENGHIGSXXXXXXXXXXXXPVD-------KVKNGK 106
             ARLGFSLCLTEV       A   +E   + +             +D       K   GK
Sbjct: 64   GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 107  EERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCL 166
            +ERG LFG+MFGL+A+LNEPLFS+ F+  + ++   F  +FM  L+ LA  K W+R+PCL
Sbjct: 124  DERGLLFGKMFGLKALLNEPLFSKTFLP-NKKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 167  FTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEI-KRILDET 225
            FTL+Q +E+L P A D EF++ VL LLD+H  T T+EGLAIYL L +K PE  K   D+ 
Sbjct: 183  FTLFQTVEKLLPFA-DFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKI 241

Query: 226  KIFDALPLVKR--WKADNPLAKGNAKALASVLKDDALIEGDGPKQKGV------WTPRLH 277
            K+     ++K   WK ++PLA+GN   L  VL++ +L      ++K V      W PRLH
Sbjct: 242  KLL----VLKNSSWKLNDPLARGNLPRLTQVLRESSL----ASEEKKVEVMSANWQPRLH 293

Query: 278  FVWDLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKA 337
            FVWD+LLP ++  + + D   H++K+ K  K P++  +  + F EFWQ+ VDESFF+EKA
Sbjct: 294  FVWDILLPTVSTIESNSDEK-HMSKRRKKNKGPET--NTYIRFPEFWQMTVDESFFNEKA 350

Query: 338  SSERKYLGVLIMEKAVRSVPSSL-VQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIV 396
            SSERKYLG  I E+A+  V + L  +  FS+N +R+LINQSS+ +R LHK+S   + TIV
Sbjct: 351  SSERKYLGFSIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIV 410

Query: 397  SACE-TDASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXX-XXXXX 454
             ACE + ++K++PV+ +I F  NG+ NFDKLTKSKT   L++                  
Sbjct: 411  KACEESPSTKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTS 470

Query: 455  XXXXHENTDISKIKFILDTLLHVIRAHKWKAHLSWTNPL---------LLALVRYAFFSA 505
                  + D  K +FILD+LLH++R+HK     S T            +  LVR AFF+ 
Sbjct: 471  QIKVGTSEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQ 530

Query: 506  PSHLSEQSE---EIITLSRERLFSVLGELIPLSKHDMGAPSWAYATLELLLQEKEKHPLA 562
                 ++ E   ++  L++ERLFSVL EL   +   +   SW Y TL  ++  + ++P +
Sbjct: 531  TDIAKKEDESDNQVDELAKERLFSVLSELTTTTNKQLH--SWQYYTLLEIIDRENENPNS 588

Query: 563  L--QLDAELETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSAS 620
            L  ++D +L+TV  NA+K+++ I +K+ K+ +   +  GLE LLS+ +LQ+++GD DS +
Sbjct: 589  LINKMDDDLKTVRDNAIKVIKGIASKNEKTTSSGER--GLESLLSMCLLQLYSGDADSVA 646

Query: 621  TLEELASFYESATQGAD-NGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELE 679
            T+EEL +FY ++    +   +VGITEILLSL+AQKK++L+KL+L+VWE F+ ++ ++ L 
Sbjct: 647  TIEELITFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLN 706

Query: 680  LLLNTLSARENKAGFAQLFEGADEYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXXXXX 739
            LLL+ L ARENK GFA+LFE ADEYEE   +E                            
Sbjct: 707  LLLDVLPARENKQGFAELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDE 766

Query: 740  ------XXXAKIDKEATSALAHALRLPDNILDEDGNVGFXXXXXXXXXXXXXXX---XXX 790
                     AKIDKEATSALA AL LPD+I++E+G V F                     
Sbjct: 767  GAEGGNEAIAKIDKEATSALAKALNLPDDIINENGEVNFDDLSDGSDISSDEESLDDEKM 826

Query: 791  XXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSV 850
              LD QL+EIFKRRK+AL+ + TGNQRKIE KESR+SVIAFKHRV D+L IY K+ E S 
Sbjct: 827  MELDDQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAEDS- 885

Query: 851  TKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEI 910
                +L A  +   +   EPM+K +QQTLD+ LA+KISKLLK  V K+K    +E T+  
Sbjct: 886  ----ELPAKYA---ILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNMEEITA-- 936

Query: 911  NEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSE-QVIGI 969
              E +   + +VH T+L+ KPGQ+   F+S CSSTS+FLSK+L+ + +D   +  +++ I
Sbjct: 937  --EQVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKEEAYGKIVDI 994

Query: 970  YSTTMKHWNV-SGKFGPNFFIDFINWLASKKS 1000
            YS T K W +   KFG N FIDF NWL+SKKS
Sbjct: 995  YSETTKKWVLKDSKFGSNIFIDFYNWLSSKKS 1026

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1014 (41%), Positives = 601/1014 (59%), Gaps = 23/1014 (2%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            +A +V+RDLFYKL SDLS+ER+Q+ I L+T+L++  VE+  +EWEYVL RL++GL+SS  
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSK--VEKESREWEYVLNRLIKGLSSSRN 59

Query: 61   SARLGFSLCLTEVAAAALENGHIGSXXXXXXXXXXXXPVDKVKNGKEERGQLFGRMFGLQ 120
             ARLG+ LCLTEV A+ALE   +                + +KNGKEERG LFG++FGLQ
Sbjct: 60   GARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIKNGKEERGILFGKLFGLQ 119

Query: 121  AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA 180
             +LNEPLFS+VF A D +I   F   ++  L+ +AL K W+R+  +FTLYQ IE+L+P  
Sbjct: 120  VLLNEPLFSQVFKAED-EINLEFMLTYVGTLIDVALAKTWIRESSMFTLYQAIEKLSPVM 178

Query: 181  TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD 240
               + L+A+LTLLD   LT TSEGLA+YL+L +K       L +  + + L L   WK +
Sbjct: 179  GSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKGLLEDLKLNSPWKNN 238

Query: 241  NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEEKVSPDTHVHI 300
            +PL+KGN  A+A+ LK+    E    KQKG+W PRLHFVWD++L    E     D     
Sbjct: 239  DPLSKGNLPAIANALKEINSSEDLSVKQKGIWMPRLHFVWDIILTSFFEGGEYEDKASEP 298

Query: 301  AKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVPSSL 360
            AKK +     +  +   + F EFW+ VVDESFF+EK+SSERKYLG L+ EKA    P S 
Sbjct: 299  AKKKRKKSSEERHQ--QIKFPEFWKSVVDESFFNEKSSSERKYLGFLVFEKAFSLAPVSY 356

Query: 361  VQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGPNGT 420
               + SKN  R LINQ   + R+LHK+S   L TIV  C+    K  P    +    +G+
Sbjct: 357  THTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVCKNQPEKTAPSFETLALKEHGS 416

Query: 421  INFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDISKIKFILDTLLHVIRA 480
            I+FD+LTKSKT + L++ KS                      D S+++F+LD +LH++RA
Sbjct: 417  ISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLRDHSRVRFLLDAMLHLVRA 476

Query: 481  HKWKAHLSWTNPLLLALVRYAFFSAPSH--LSEQSEEIITLSR---ERLFSVLGELIPLS 535
            HK  A   W  PLL +LV+  FF    +    E  +E  T+S+   ERL+S+L +LI  +
Sbjct: 477  HKSAADKVWLAPLLDSLVQQGFFELDENDRQPEVGDETFTVSKLAVERLYSILADLIS-A 535

Query: 536  KHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTKSPNENP 595
             +      W   T+E+L+ + +K+ L   +D EL  + ++++K  + I +++ K   +  
Sbjct: 536  DYKSEKVCWPRFTVEILMSKLKKNKLLNPMDEELTEILNSSIKTFKTICSEAEKG-GKQM 594

Query: 596  QLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKK 655
            Q  G +L+ SV+ILQ ++G+ DS   L++L SF+++  +       G  EILLSL AQKK
Sbjct: 595  QARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEENKSGSYAGFIEILLSLAAQKK 654

Query: 656  SMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGADEYEELGSDEAGTX 715
            ++LRK +L+VWE F+ +  ++++ +LL  L ARENK GF++LFEG DE    GSDE    
Sbjct: 655  ALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFSKLFEGDDEG---GSDEEEIS 711

Query: 716  XXXXXXXXXXXXXXXXXXXXXXXXXXXA----KIDKEATSALAHALRLPDNILDEDGNVG 771
                                            +IDKEATSAL  AL LP++I++++G V 
Sbjct: 712  DELFAEEGASGDNTEEEESGPDSDDQDGEDTEQIDKEATSALVKALNLPESIVNDNGEVH 771

Query: 772  FXXXXXXXXXXXXXX---XXXXXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSV 828
            F                       LDGQLSEIFKRRK+AL+KIPTGN+RK E KESR++V
Sbjct: 772  FEDLEDTEDEEISDEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENV 831

Query: 829  IAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKIS 888
            IAFKHRVVDMLEI+ +  E  + +  +   ++++ ++S+  P++  ++ TLD+PLAEK++
Sbjct: 832  IAFKHRVVDMLEIFVRWAESELKQGGRPEKSVTSKIISIILPLISCVRTTLDKPLAEKVT 891

Query: 889  KLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLF 948
            KLLKN +CK+K          + E     SL++VH  +L  K GQF  L+FSACS+ S+F
Sbjct: 892  KLLKNKICKLKITTDTSLDG-LEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMF 950

Query: 949  LSKVLIAMKDDPSTSEQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSKN 1002
            L+K+ +     P T   +  +Y  T+  W V GKF  N FI+F+NWL+ KK +N
Sbjct: 951  LAKLFVHRSPRPETYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNWLSIKKQQN 1004

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1043 (41%), Positives = 608/1043 (58%), Gaps = 72/1043 (6%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L + ++ +EW YVL RL++GL+S   
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVAAAALE------------NGHIGSXXXXXXXXXXXXPVDKVKNGKEE 108
            SARLGFSLCLTEV   A+                  S               K   GK+E
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120

Query: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168
            RG LFG++FGL+++LNEPLFS +FV    +    F  +F ++L+ LAL K W+++PC FT
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228
            L+Q ++ L P   D      +L + D+++LT T+EGL+ YL L+ +        DE+ I 
Sbjct: 181  LFQTMKMLLP-FMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEG-------DESLIP 232

Query: 229  DALPLVK-RWKADNPLAKGNAKALASVLKDDALI-EGDG-----PKQKGV-WTPRLHFVW 280
              L L    WK ++PLA+GN   L  VL++ ++I + +G      KQK   W PRLHFVW
Sbjct: 233  SVLDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVW 292

Query: 281  DLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSE 340
             +LLPL    K+   +H+   +K    KK +++    + F EFW++ VDESFF+EKASSE
Sbjct: 293  SVLLPLFGNGKLENTSHISKKRKKTNNKKVQNS----IQFPEFWKMAVDESFFNEKASSE 348

Query: 341  RKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACE 400
            RKYLG LI++ A ++VP S +   FS+N +RTLINQS ++ R L+K+S   L +IV ACE
Sbjct: 349  RKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACE 408

Query: 401  TD-ASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXH 459
             D A+++VP L A+ FGP+G+INFDKLTKS T   L+  K                    
Sbjct: 409  EDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQD 468

Query: 460  ENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEIIT 518
            +   +S   F LD++LH++RAHK + + +    P+L  +V  AFF   S    + E++  
Sbjct: 469  KKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSD-DLKLEQLHE 527

Query: 519  LSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLLQEKEKH--PLALQLDAELETVT 573
            L++ERL+S+LGEL     +   D    SW Y TL+L+L  +  H   L   LD  LE + 
Sbjct: 528  LAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIK 587

Query: 574  SNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESAT 633
            + A+  L K+    T       Q +GL  LLS+ ++Q++AGD DS S +EEL  F    +
Sbjct: 588  NEAISCLSKVCRSRT------AQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEF----S 637

Query: 634  QGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAG 693
            +  +N +VGITEILLSL+AQKK++LRKL+L++W+ FI++VG EEL++LL+ L ARENK G
Sbjct: 638  KHENNSMVGITEILLSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQG 697

Query: 694  FAQLF------EGADEYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKIDK 747
            FAQLF      E   E  +   DE+ T                              IDK
Sbjct: 698  FAQLFEGEEEFEEIKEENDASEDESKTGSESESESESDSDDADEKDEEDEANEDILNIDK 757

Query: 748  EATSALAHALRLPDNILDEDGNV------GFXXXXXXXXXXXXXXXXXXXXLDGQLSEIF 801
            EATSAL  AL LPDNI+++ G V      G                     LD QLSEIF
Sbjct: 758  EATSALVKALNLPDNIVNDKGEVDLDQLEGLSDDGGDDEDEESMDDEKMMELDDQLSEIF 817

Query: 802  KRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNK-----KL 856
            KRRK+AL+ I TGNQRK E K+SR++VI+FKHRVVDML +Y K  E+    NK      L
Sbjct: 818  KRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNL 877

Query: 857  SATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESIL 916
              ++S  ++    PM+K + +TLDRPLA+KISKLLK  + K+K  A+K+   +I    ++
Sbjct: 878  GGSLSK-LVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDI---ELM 933

Query: 917  TSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKH 976
              L+  H  +L+ KPGQ   +F+S CS++SLFLSK+ + +  +    E +I +Y+ T K 
Sbjct: 934  DLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKLDE-LIDLYTATTKE 992

Query: 977  WNVSGKFGPNFFIDFINWLASKK 999
            W   GK GPN FIDFINWL+SKK
Sbjct: 993  WMQKGKCGPNIFIDFINWLSSKK 1015

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1044 (41%), Positives = 615/1044 (58%), Gaps = 77/1044 (7%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L +  + +EW YVL RL++GLAS   
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVA-----------AAALENGH-----IGSXXXXXXXXXXXXPVDKVKN 104
            SARLGFSLCLTEV               LE+ +     + S            PV     
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPV----K 116

Query: 105  GKEERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQP 164
            GK+ERG LFG++FGL+++LNEPLFS +FV    +    F  +FM++L+ LAL K W+R+P
Sbjct: 117  GKDERGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREP 176

Query: 165  CLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDE 224
            CLF+L+Q I+ L P   ++  ++ +L + D+++LT T+EGL+ YL L+ +        DE
Sbjct: 177  CLFSLFQTIKMLLPFMNESTAVK-ILLIYDKYDLTLTNEGLSTYLVLKYES-------DE 228

Query: 225  TKIFDALPLVKR-WKADNPLAKGNAKALASVLKDDALIEG------DGPKQKGV-WTPRL 276
            + I   L L    WK ++PLA+GN   L  VL+D +++        D  KQK   W PRL
Sbjct: 229  SLIPSTLDLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRL 288

Query: 277  HFVWDLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEK 336
            HFVWD+LLPL    K+    H+   +K  +GKK +++    + F EFW++ VDESFF+EK
Sbjct: 289  HFVWDVLLPLFGSGKLENTEHITKKRKKTSGKKVQNS----IQFPEFWKMAVDESFFNEK 344

Query: 337  ASSERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIV 396
            ASSERKYLG LI++   ++VP S +   FS+N +RTLINQS ++ R L+K++   L++IV
Sbjct: 345  ASSERKYLGFLIIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIV 404

Query: 397  SACETDA-SKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXX 455
             ACE D   K+VP L A+ FGP+G+INFDKLTKS     L+  K                
Sbjct: 405  KACEEDPIKKLVPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLL 464

Query: 456  XXXHENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSE 514
                +  D+    FILD+LLH+IRAHK + + +    P+L  ++  AFF   +   ++ E
Sbjct: 465  QLQEKRGDLPHTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATD-EQEFE 523

Query: 515  EIITLSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLL--QEKEKHPLALQLDAEL 569
            ++  L++ERL+S+LGEL     ++  D    SW Y TL L+L  ++  K  L   LD  L
Sbjct: 524  QLHELAKERLYSILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESL 583

Query: 570  ETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFY 629
            E + + A+  L +I      S +   Q +GL  LLS+ ++Q++AG+ DS S +EEL  F 
Sbjct: 584  EKIKNEAISSLAEI------SKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF- 636

Query: 630  ESATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARE 689
               T+  +N +VGITEILLS +AQKK++LRKL+L++W+ FI+ VG EEL++LL+ L ARE
Sbjct: 637  ---TKHDNNSMVGITEILLSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARE 693

Query: 690  NKAGFAQLFEGADEYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXX----XXXXXXAKI 745
            NK GFAQLFEG  E+EE+  +E                                     I
Sbjct: 694  NKQGFAQLFEGEGEFEEINEEENANEGDSKSESESESESDSDESNEKDEEDEANEDVVNI 753

Query: 746  DKEATSALAHALRLPDNILDEDGNV-----GFXXXXXXXXXXXXXXXXXXXXLDGQLSEI 800
            DKEAT AL  AL LPDNI+++ G V     G                     LD QLSEI
Sbjct: 754  DKEATGALIKALHLPDNIVNDKGEVDMNQLGGLSDDDDDEDEESMDDEKMMELDDQLSEI 813

Query: 801  FKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNK-----K 855
            FKRRK+AL+ I TGNQRK+E KESR++VI+FKHR+VDML +Y K  E+    NK      
Sbjct: 814  FKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSN 873

Query: 856  LSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESI 915
            L   +S  ++    PM+K I++TLD+PLA+KISKLLK  + K+K   +K     I    +
Sbjct: 874  LEGPLSK-LVYFIVPMLKCIRETLDKPLADKISKLLKGKIFKIKANTFKILDKNI---EL 929

Query: 916  LTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMK 975
            +  L++ H  +L+ KPGQ   +FFSACS++SLFLSK+   +  + +  E +I +Y+ T K
Sbjct: 930  MNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGNNALDE-LIDLYAATTK 988

Query: 976  HWNVSGKFGPNFFIDFINWLASKK 999
             W + GKF  N FIDF NWL+SKK
Sbjct: 989  EWMLKGKFSTNVFIDFTNWLSSKK 1012

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1017

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1048 (41%), Positives = 600/1048 (57%), Gaps = 80/1048 (7%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRD FYKL SDL +ERVQ+A+ALI EL+ L + +   EW YVL RL+ GL+SS  
Sbjct: 1    MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61   SARLGFSLCLTEVAAAAL--------ENGHIGSXXXXXXXXXXXXP----VDKVKNGKEE 108
            SARLGFSLCLTEV   AL        E   I +            P      K   GK+E
Sbjct: 61   SARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKDE 120

Query: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168
            RG LFG+MFGLQA+L+EPLF +VF++ +  I   FA +FM  L QLA+ K+WLR+PCLFT
Sbjct: 121  RGLLFGKMFGLQALLSEPLFEKVFISKEKGISD-FALRFMDELCQLAVFKSWLREPCLFT 179

Query: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228
            L+Q  ER+ P A D E  + VL LLD++ LT T+EGLAIYL L  K P        + I 
Sbjct: 180  LFQAYERILPLA-DIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDY----SSSIL 234

Query: 229  DALPLVKRWKADNPLAKGNAKALASVLKDDALIEGD--GPKQKGVWTPRLHFVWDLLLPL 286
                  K WK+++PLA+GN   L+ VL+D ++   D   PK    WTPRLHFVWD+LLP+
Sbjct: 235  QMDFESKSWKSNDPLARGNLPLLSQVLRDSSVATEDESSPKASN-WTPRLHFVWDILLPI 293

Query: 287  LAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGV 346
            + ++    ++      +    KK K  ++  + F EFWQ+ VDES F+EKAS+ERK+LG+
Sbjct: 294  ITQDNSRRESE----DRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGL 349

Query: 347  LIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDA-SK 405
            +I +KA+   P  LV   FS+N +RTLIN +S++ R L K+S+  L +IV  C+     K
Sbjct: 350  VIFQKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEK 409

Query: 406  VVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHEN-TDI 464
            +VP L+AI FGP+G+INFDKLTKSKT  +L+                        +  + 
Sbjct: 410  LVPCLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQ 469

Query: 465  SKIKFILDTLLHVIRAHKWKAHLS-WTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRER 523
               +FILDT+LH +R+HK + +       +L  ++  AFF+       + E    L++ER
Sbjct: 470  KNQQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFTV------KDEHTSNLAKER 523

Query: 524  LFSVLGELIPLSKHDMGAPSWAYATLELLLQE-KEKHPLALQLDAELETVTSNALKILRK 582
             +S+L E+  L+      PS+    L+++  E      L  +LD  LE V S AL+ L+ 
Sbjct: 524  FYSILSEITHLNNE---GPSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSEALRTLQA 580

Query: 583  IINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVG 642
            I N       +NPQL GLE+L+S+ +LQ+++G+ ++ S +EEL +FY+   + +   LVG
Sbjct: 581  ISNNE-----KNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDENS-TSLVG 634

Query: 643  ITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFEGAD 702
            ITEILLSL+AQKK++LRKL+L  W+ F+ ++G+ EL+ LL+ L ARENK GF+QLFEG D
Sbjct: 635  ITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLFEGED 694

Query: 703  EYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKIDKE-----------ATS 751
            ++EE   +                                 +   E           ATS
Sbjct: 695  DFEEAEEEFDEDAEKDNEEDNEEESEEDEESEEDDLSSSTGEDSNENQDDVAKIDKEATS 754

Query: 752  ALAHALRLPDNILDEDGNVGF-------------------XXXXXXXXXXXXXXXXXXXX 792
            ALA AL LPDNI+++ G V                                         
Sbjct: 755  ALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDEDSMDDEKMME 814

Query: 793  LDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTK 852
            LD QLS+IFKRRKDAL+ I TGNQRK EAKESR+ VIAFK RV+DMLEIY K VE+   K
Sbjct: 815  LDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIYVKFVEKQSLK 874

Query: 853  NKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINE 912
             +  S   S   L + EPM+K IQQT D+ LA +I+KLL+  V K+K +A   F    ++
Sbjct: 875  EENYSKISSC--LLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKLKTSA---FCGSCDQ 929

Query: 913  ESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTS-EQVIGIYS 971
            + ++  L   H  I + KPGQ   +++S CS+ SLFL+K++I   D    +   +I +Y+
Sbjct: 930  DELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKDAAVHDIIDLYA 989

Query: 972  TTMKHWNVSGKFGPNFFIDFINWLASKK 999
             TMK W  +GKFGPN FIDF NWL+S+K
Sbjct: 990  ETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1029 (40%), Positives = 598/1029 (58%), Gaps = 54/1029 (5%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRD FYKL SDL +ER+Q+A++LI EL+ L +  +  EW YV+ RL++GL+S   
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVAAAAL---------ENGHIGSXXXXXXXXXXXXPVDKVKNGKEERGQ 111
             ARLGFSLCLTEV   A+         E   + S            P D+ K  K +  +
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKEER 120

Query: 112  --LFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTL 169
              +FG++F LQA+LNEPLFS +F+  DG+I + F  +F+  LV LA  K W++QPCLFTL
Sbjct: 121  GLMFGKLFALQALLNEPLFSDIFIK-DGKITK-FTTKFIDELVNLASRKNWIKQPCLFTL 178

Query: 170  YQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFD 229
            YQ IERL P + D+ F++ V+T+LD +  T T+EGLAIYL   +K          + +  
Sbjct: 179  YQTIERLLPYSDDS-FVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYS-------SALLS 230

Query: 230  ALPLVKRWKADNPLAKGNAKALASVLKDDALIEGDGPKQ--KGVWTPRLHFVWDLLLPLL 287
                 K WK +NPL KGN   ++ V+++ A++  D   +     W P+LHFVWD+LLP+L
Sbjct: 231  INVTNKGWKYNNPLLKGNLSLVSEVVRESAVVVDDNETKTNNANWHPKLHFVWDILLPIL 290

Query: 288  AEEKVSPDTHVHIAKKHKTGK-KPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGV 346
              +    +  +   KKH  G  K KS   G + F EFW+ +VDE++FS+KASSERK+LG+
Sbjct: 291  YND--PREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGL 348

Query: 347  LIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETD-ASK 405
            LI  KA+ +VPS  +   FS+N +R LINQ S++ RHLHK++   L +IV  CE D   K
Sbjct: 349  LIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHK 408

Query: 406  VVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDIS 465
            +VPV+ A+ FG NG+INFD+LTKSKT   L+  K                    +  + +
Sbjct: 409  LVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNE-A 467

Query: 466  KIKFILDTLLHVIRAHKWK---AHLS-W-TNPLLLALVRYAFFSAPSHLSEQSEEIITLS 520
             + FILDTLLH++R+HK      H+S W  + LLL LV+  FF A     E    +  ++
Sbjct: 468  VLHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKINVSEIA 527

Query: 521  RERLFSVLGELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKIL 580
            RER++S+L EL  +   D  A SW +  L  L   + +  L   LD +L TV    L ++
Sbjct: 528  RERIYSILSELSSVPTGD--AHSWQFHILNELTTVENELTLTNALDEDLTTVKDTGLSVI 585

Query: 581  RKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFY-ESATQGADNG 639
              +  K+ KS        G+E LL++ +LQ+++G+ DS +T++E+  +  E  +      
Sbjct: 586  HSLSVKNDKSSR------GIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSIS 639

Query: 640  LVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFE 699
            LVGITEILL L+AQKK++L K +L+VWE  I+ VG +EL L+L+ LSARENK GF+ LFE
Sbjct: 640  LVGITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFE 699

Query: 700  GADEYEELGSDE--AGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKIDKEATSALAHAL 757
            GA+EYE++  DE                                   ID++   ALA AL
Sbjct: 700  GAEEYEKVSGDENEVAPEEESASSDTSDSSSDSDDESEEADNKDVTNIDRQTACALAKAL 759

Query: 758  RLPDNILDEDGNVGFXX---XXXXXXXXXXXXXXXXXXLDGQLSEIFKRRKDALNKIPTG 814
            +LP+N+++EDG V F                       LDGQL++IFKRRKDAL+ +PTG
Sbjct: 760  KLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEAMMALDGQLADIFKRRKDALSHVPTG 819

Query: 815  NQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSANMLSMAEPMVKA 874
            N RKIE ++SR+SVI FK R++DML IY K VE+   ++K +       + +  EPM+K 
Sbjct: 820  NMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDKDVMKEKLQTVSTFVEPMLKC 879

Query: 875  IQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSLENVHAT-ILSPKPGQ 933
            +Q+TLDRPLA+KI KLLK  + K+K     E     + E  + SL+ +H T +L+ K GQ
Sbjct: 880  VQRTLDRPLADKIFKLLKAKIFKVKIPVSAE-----DGERFVESLQRIHGTYLLAEKSGQ 934

Query: 934  FPQLFFSACSSTSLFLSKVLIAMKDDPSTSE-QVIGIYSTTMKHWNVSGKFGPNFFIDFI 992
            +  +++S CSS S+F  K+LI  +D+   +  +VI IY+ T K W    KF  + F DF 
Sbjct: 935  YQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTSVFFDFY 994

Query: 993  NWLASKKSK 1001
            NWL+SK+ +
Sbjct: 995  NWLSSKRQQ 1003

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1040 (42%), Positives = 612/1040 (58%), Gaps = 68/1040 (6%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L +  + +EW YVL RLV+GLAS   
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61   SARLGFSLCLTEVAAAALE-------------NGHIGSXXXXXXXXXXXXPVDKVKNGKE 107
            SARLGFSLCLTEV   A+              N  + +                VK GK+
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVK-GKD 119

Query: 108  ERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLF 167
            ERG LFG++FGL+++LNEPLFS +F+         F  +F + L+ LAL K W+++PC F
Sbjct: 120  ERGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFF 179

Query: 168  TLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKI 227
            TL+Q I+ L P   D      +L + D++N+T T+EGL+ YL L  K    K ++  T  
Sbjct: 180  TLFQTIKMLLP-FIDESIAAKILLIYDKYNMTLTNEGLSTYLLL--KYGGDKNLIPSTLD 236

Query: 228  FDALPLVKRWKADNPLAKGNAKALASVLKDDALIEG------DGPKQKGV-WTPRLHFVW 280
               L     WK+D+PLA+GN   L  VL+D ++I        D  KQK   W PRLHFVW
Sbjct: 237  LKNLG----WKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVW 292

Query: 281  DLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSE 340
            D+LLPL    K+    HV   +K  + KK +++    + F EFW++ +DESFF+EKASSE
Sbjct: 293  DILLPLFGSGKLENTEHVSKKRKKTSTKKVQNS----IQFPEFWKMAIDESFFNEKASSE 348

Query: 341  RKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACE 400
            RKYLG LI++ A ++VP S +   FS+N +RTLINQS ++ R L+K++   L +IV ACE
Sbjct: 349  RKYLGFLIIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACE 408

Query: 401  TD-ASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXH 459
             D  +K+VP L ++ FGP+G++NFDKLTKS T   L+  K                    
Sbjct: 409  EDLTNKLVPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQ 468

Query: 460  ENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEIIT 518
               D++   FILD++LH+IRAHK +   +    P+L  ++  AFF   +   ++ E++  
Sbjct: 469  SKRDLTHTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATD-DQELEQLHE 527

Query: 519  LSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLLQEKEKHP--LALQLDAELETVT 573
            L++ERLFS+LGEL     +   D    SW + TL+L+L  ++ H   L   LD  LE   
Sbjct: 528  LAKERLFSILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTK 587

Query: 574  SNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESAT 633
              A+  L +I   ST       Q +GL  LLS+ ++Q++AG+ DS S +EEL  F    +
Sbjct: 588  EEAISSLAEISRSST------AQAWGLSTLLSMCLIQLYAGETDSISVIEELCEF----S 637

Query: 634  QGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAG 693
            +  +N +VGITEILLSL+AQKK++L+KL+L++W+ FI+ VG EEL++LL+ L ARENK G
Sbjct: 638  KDKNNSMVGITEILLSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQG 697

Query: 694  FAQLFEGADEYEELGSDEAGTXXXXX----XXXXXXXXXXXXXXXXXXXXXXXAKIDKEA 749
            FAQLFEG  E+EE+  +E+ +                                  IDKEA
Sbjct: 698  FAQLFEGEGEFEEIKEEESASEDESKSEGDSESESNSDDADEKDEEDDANEEVVNIDKEA 757

Query: 750  TSALAHALRLPDNILDEDGNV------GFXXXXXXXXXXXXXXXXXXXXLDGQLSEIFKR 803
            TSAL  AL LPDNI+++ G V      G                     LDGQLSEIFKR
Sbjct: 758  TSALVKALNLPDNIVNDKGEVDIDQLEGLSDDDEDDEDEESMDDEKMMELDGQLSEIFKR 817

Query: 804  RKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKKLSATMSAN 863
            RK+AL+ I TGNQRK+E KESR++VI+FKHR+VDML +Y K  E+    NK   ++   +
Sbjct: 818  RKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIGS 877

Query: 864  MLS----MAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESILTSL 919
             LS       P++K I +TLDRPLA+KISKLLK  + K+K  A+KE    I    ++  L
Sbjct: 878  PLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFKIKVNAFKEMDKNI---EVMDLL 934

Query: 920  ENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMKHWNV 979
            ++ H  +L+ KPGQ P +F+SACS++SLFLSK+ + +  +    E +I +Y+ T K W  
Sbjct: 935  KSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGNDKLDE-LIDLYAATTKEWTN 993

Query: 980  SGKFGPNFFIDFINWLASKK 999
             GKFG N FIDFINWL+SKK
Sbjct: 994  RGKFGANVFIDFINWLSSKK 1013

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1045 (41%), Positives = 617/1045 (59%), Gaps = 74/1045 (7%)

Query: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L +  + +EW YVL RL++GLAS   
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVAAAALE-------------NGHIGSXXXXXXXXXXXXPVDKVKNGKE 107
            SARLGFSLCLTEV   A+              N  + +                VK GK+
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVK-GKD 119

Query: 108  ERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLF 167
            ERG LFG++FGL+++LNEPLFS +FV    +    F  +FM++L+ LAL K W+++PCL+
Sbjct: 120  ERGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLY 179

Query: 168  TLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKI 227
            +L+Q I+ L P   ++     +LT  D+++LT T+EGL+ YL L+ +        D+  +
Sbjct: 180  SLFQTIKMLLPTMNESTAAEILLTY-DKYDLTLTNEGLSTYLLLKYES-------DKDLV 231

Query: 228  FDALPLVK-RWKADNPLAKGNAKALASVLKDDALI-------EGDGPKQKGV-WTPRLHF 278
               L L    WK ++PLA+GN   L  VL+D A+        + +  KQK   W PRLHF
Sbjct: 232  PSTLGLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHF 291

Query: 279  VWDLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKAS 338
            VW++LLPL    K+    H+   +K  + KK  S+    + F EFWQ+ VDESFF+EKAS
Sbjct: 292  VWNILLPLFGSGKLENAEHISKKRKKTSNKKVPSS----IQFPEFWQMAVDESFFNEKAS 347

Query: 339  SERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSA 398
            SERKYLG LI++   ++VP S +   FS+N +RTLINQS ++ R L+K++   L +I+ A
Sbjct: 348  SERKYLGFLIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKA 407

Query: 399  CETD-ASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXX 457
            CE D  +K+VP L+A+ FGP+G+INFDKLTK+  T  L+  K                  
Sbjct: 408  CEEDPVNKLVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQL 467

Query: 458  XHENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEI 516
              +  D+    F+LD+LLH+IRAHK + + +    P+L  +V  AFF   +   ++SE++
Sbjct: 468  QEKKDDLPHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATD-DKESEQL 526

Query: 517  ITLSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLLQEKEKHP--LALQLDAELET 571
              L++ERL+S+LGEL     +   D    SW + TL L+L  ++ H   L   LD  LE 
Sbjct: 527  HELAKERLYSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEK 586

Query: 572  VTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYES 631
              + A+  L +I      S +   Q +GL  LLS+ ++Q++AG+ DS S +EEL  F   
Sbjct: 587  TKNEAISSLTEI------SKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEF--- 637

Query: 632  ATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENK 691
              +  ++ +VGITEILLSL+AQKK++L+KL+L++W+ FI  VG +EL++LL+ L  RENK
Sbjct: 638  -AKDENSSMVGITEILLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENK 696

Query: 692  AGFAQLFEGADEYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXXXXXXX----XAKIDK 747
             GFA LFEG  E+EE+  +E+                                    IDK
Sbjct: 697  QGFALLFEGEGEFEEVDEEESAVEDESKSESESDSDSESNDDEERDEEDEANEDVVNIDK 756

Query: 748  EATSALAHALRLPDNILDEDGNVGFXX---------XXXXXXXXXXXXXXXXXXLDGQLS 798
            EATSAL  AL LPDNI+++ G V                               LD QLS
Sbjct: 757  EATSALIKALNLPDNIVNDKGEVDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDDQLS 816

Query: 799  EIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNK-KLS 857
            EIFKRRK+AL+ I TGNQRK+E KESR++VIAFKHR+VDML IY K+ E+    NK +LS
Sbjct: 817  EIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELS 876

Query: 858  ATMS---ANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEES 914
              +    +N++    PM+K I++TLDRPLA+KISKLLK  + K++ +A+K+    I    
Sbjct: 877  IEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTI---E 933

Query: 915  ILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTM 974
            +L  L++ H  +L+ KPGQ   +FFSACS++SLFLSK+ + +  +    + +I +Y++T 
Sbjct: 934  LLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGN-DKFDDLIDLYASTT 992

Query: 975  KHWNVSGKFGPNFFIDFINWLASKK 999
            K W   GKFG N FIDFINWL+SKK
Sbjct: 993  KQWTQKGKFGANIFIDFINWLSSKK 1017

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
            YEL055C
          Length = 1024

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1062 (38%), Positives = 587/1062 (55%), Gaps = 105/1062 (9%)

Query: 4    QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENG-KEWEYVLGRLVRGLASSNKSA 62
            +V+RDLFYKL SD+ +ER+ S + ++  L +L+V + G KEW YV+ RLV+GL S+  SA
Sbjct: 2    RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63   RLGFSLCLTEVAAAALENGHIGSXXXXXXXXXXXXPVDK--------------VKNGKEE 108
            RLGFS+CLTE     L                    VD                  GK+E
Sbjct: 62   RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168
            RG LFGR+F  + +LNEPLFS +F        Q F  +F +R++QL   K WL +PC F+
Sbjct: 122  RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174

Query: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228
            LYQ IE+L P   D E+ +A +  +DEH LT T+EGL++YL L  K       L+ +   
Sbjct: 175  LYQAIEKLLP-GLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLAKKFTLSDFTLENSA-- 231

Query: 229  DALPLVKRWKADNPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLL- 287
                    WKA++PL KGN   +A V+ D   ++G        W PRLH++WD++L    
Sbjct: 232  --------WKANDPLQKGNLSVMAKVMLDTN-VDGANSNTNKNWAPRLHYIWDIILREFF 282

Query: 288  -AEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGV 346
              E+  S   HV+  KKH   K P+  E     F  FWQ VVDESFF++KAS ERKY G 
Sbjct: 283  DNEQHGSDAKHVYQKKKHDKSKNPQRVE-----FKSFWQAVVDESFFNDKASPERKYQGY 337

Query: 347  LIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKV 406
            LI +KAV SVP+S V+  F++N +R++INQ+S++ R L+KLS   L T+VS CE++ +K+
Sbjct: 338  LIFQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPAKL 397

Query: 407  VPVLTAIWFGPNGTINFDKLTKSKTTDSLV-TAKSXXXXXXXXXXXXXXXXXXHENTD-- 463
             PVLTA+ F   G++NFD LTKSKT   L+ T +S                   + T   
Sbjct: 398  TPVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPEL 457

Query: 464  ---ISKIKFILDTLLHVIRAHK--WKAHLSWTNPLLLALVRYAFFSAPSHLSEQSEEIIT 518
                 ++KFILD+LL++IR+ K   +        +L + ++ AFF       + +E I  
Sbjct: 458  EELNPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQ------KDNEYINN 511

Query: 519  LSRERLFSVLGELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALK 578
            +++ERL S+L ELI L   D    SW Y  LE+++ +++   L   LD  L  V + +L 
Sbjct: 512  IAKERLSSMLAELIVLPSTD---GSWPYLALEIIVTKEKSETLIDSLDDSLVAVKAESLD 568

Query: 579  ILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADN 638
            IL+KI    +KS     QL G+E L+S++++Q+++GD +S   +E+L +FY   +     
Sbjct: 569  ILKKISELKSKSS----QLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETA 624

Query: 639  GLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698
               G+TEILLSL+AQ+KS+LRKL+L+VWE FID++GKEE+ LLLN L ARENK GF+ LF
Sbjct: 625  NFTGVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLF 684

Query: 699  EGADEYEELGSDEAGTXXXXXXXXXXXXXXXXXXXXXXXXX----------------XXX 742
            E   +YE + S+                                                
Sbjct: 685  ENEGDYEVVDSENDAEGEEDDENNEKDNDDSDEDSDDDVSDDDDASLSSSDTDNADDEKI 744

Query: 743  AKIDKEATSALAHALRLPDNILDEDGNVGFXX-----------XXXXXXXXXXXXXXXXX 791
            ++IDKE TSALA AL LPDNI++E+G V                                
Sbjct: 745  SQIDKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKMM 804

Query: 792  XLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVER--- 848
             LD QLSEIFKRRKDAL+ + TGNQRK++ KESR++VIAFKHR++DMLEIY K++E+   
Sbjct: 805  ELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSL 864

Query: 849  ------SVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAA 902
                   V   +K   T+ A ML++ +     +QQTLD+PL EKI KL K    K++   
Sbjct: 865  NRADGGKVVTTEKTEQTL-AIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTL 923

Query: 903  YKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPST 962
            +++  +      I+ SLE +H  + + KPGQF   ++  CSSTSL+L + LI    +   
Sbjct: 924  FEDIETST---EIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEK 980

Query: 963  S---EQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKSK 1001
            +   E+++ +Y+ T K W   GK+G   F+DF NWLASKK +
Sbjct: 981  TKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQR 1022

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/710 (47%), Positives = 469/710 (66%), Gaps = 18/710 (2%)

Query: 1   MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
           M  ++NRDLFYKL SDL +ERVQ+AI+LI EL  L  E N  EWEYVL RL++GL+S+  
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASL--ENNDSEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLTEVAAAALENGHIGSXXXXXXXXXXXXPVDKVKNGKEERGQLFGRMFGLQ 120
           SARLGFSLCLTEV + ALE G++ S              + VKNGKEERG LFGRMFGLQ
Sbjct: 59  SARLGFSLCLTEVLSVALEKGYLNSIEEYIQLLQSTLLKETVKNGKEERGLLFGRMFGLQ 118

Query: 121 AMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIERLAPRA 180
           A+LNEPL S++F+   G +   F   FM  LVQ+AL+K W+R+PCLFTL+QV+E+L+P  
Sbjct: 119 ALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTLFQVVEKLSPFL 178

Query: 181 TDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALPLVKRWKAD 240
            DT  + ++  LLD++ L+ T+EGLAIYLFL + CP   + + ++ +   L L  +WK +
Sbjct: 179 NDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSGLLKNLELNSQWKNN 238

Query: 241 NPLAKGNAKALASVLKDDALIEGDGPKQKGVWTPRLHFVWDLLLPLLAEE---KVSPDTH 297
           +PL KGN   L++VLKD + +E  G KQKG W PRLHFVW+++LP+LA +   + S D H
Sbjct: 239 DPLTKGNLPTLSAVLKDVSPVEDSGLKQKGSWAPRLHFVWNIILPILARDDQNEGSSDEH 298

Query: 298 VHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIMEKAVRSVP 357
           +   +K +     K  +  M+ F EFW+ VVDESFF+EK+S ERKYLG LI+E A + VP
Sbjct: 299 ITKKRKKEKA---KDVQVKMIEFPEFWKAVVDESFFNEKSSGERKYLGFLILEAAFKQVP 355

Query: 358 SSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPVLTAIWFGP 417
            SLV  +FSKN +RTLINQSS++ R LHK+S   L +I+  CE+   K VP + A+ F  
Sbjct: 356 LSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHPDKTVPSIQAMLFSE 415

Query: 418 NGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHE-NTDISKIKFILDTLLH 476
           NGTINFDKLTK+KT D LV   S                   + N + +  +F+LD++LH
Sbjct: 416 NGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLPDDPNEEAALTRFLLDSMLH 475

Query: 477 VIRAHKWKAHLSWTNPLLLALVRYAFF-SAPSHLSEQSEE------IITLSRERLFSVLG 529
           V+R HK  +  +W  PL+ +++   FF ++P+ + +++++          +RERL+S+L 
Sbjct: 476 VVRTHKTVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDDHTDGFEFQARERLYSILA 535

Query: 530 ELIPLSKHDMGAPSWAYATLELLLQEKEKHPLALQLDAELETVTSNALKILRKIINKSTK 589
           +LIPLSK  + + SW Y TL++LL +++   L   LD  L  +  +AL  L  I  +   
Sbjct: 536 DLIPLSKQSIHSASWPYITLQVLLSQEQSKELIHPLDDGLNKIKLDALNDLEGIRRELEN 595

Query: 590 SPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGA-DNGLVGITEILL 648
            P+ + Q +GLELLLS+++LQ++ GD +S S LE+L +FY S    + +N L+G+ EILL
Sbjct: 596 DPSAS-QFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHSMRDSSEENSLIGVIEILL 654

Query: 649 SLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698
           +L+AQKK++LR+L+L+VWE F+DKVG  ELE+L + LSARENK GF  LF
Sbjct: 655 ALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSARENKEGFTALF 704

 Score =  248 bits (632), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 177/264 (67%), Gaps = 10/264 (3%)

Query: 744  KIDKEATSALAHALRLPDNILDEDGNVGFX--------XXXXXXXXXXXXXXXXXXXLDG 795
            KIDKE TSALA AL LPD I++E+G V F                            LD 
Sbjct: 781  KIDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMELDD 840

Query: 796  QLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNKK 855
            QLS+IF+RRK+AL+KI TGN+RK+EAKESR++VIAFKH+VVDMLE++ K VER+ +KNK+
Sbjct: 841  QLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVERT-SKNKE 899

Query: 856  LSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESI 915
               T   ++ SM +P++K +QQT D+ LA+K+SKL+KN +CK+K       + +I EE  
Sbjct: 900  CGETELKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDI-EELT 958

Query: 916  LTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTMK 975
            +++L  VH  +L+ K GQFP L+FS CS  SLFLSK+L+    + S  +++I IY +TMK
Sbjct: 959  ISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIYLSTMK 1018

Query: 976  HWNVSGKFGPNFFIDFINWLASKK 999
             W   GKFG +FF DFINWLASKK
Sbjct: 1019 KWFSKGKFGTSFFFDFINWLASKK 1042

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1062 (35%), Positives = 578/1062 (54%), Gaps = 96/1062 (9%)

Query: 5    VNRDLFYKLTSDLSDERVQSAIALITELNELAV---EENG----KEWEYVLGRLVRGLAS 57
            VNRD+FY+L SDL +ER+QS + L+ EL+EL     +EN     KEW YV+ RL+ GLAS
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58   SNKSARLGFSLCLTEVAAAALENG----------------HIGSXXXXXXXXXXXXPVDK 101
            + K ARLGFSLCLTEV   AL                   H+ S            P  K
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEP-RK 122

Query: 102  VKNGKEERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWL 161
            +  GK+ERG LFG++F LQ++LN+P+F ++F     +  +A   +F+  L+ L+  K W+
Sbjct: 123  LLKGKDERGLLFGKLFALQSLLNDPIFGKIF----NKDNKAILFEFIYELIALSNLKNWI 178

Query: 162  RQPCLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRI 221
            ++P LFTL+  I+++      ++ ++ +L +L  +NLT T+EGL+IY++L    P I   
Sbjct: 179  KEPTLFTLFNFIQKIIEFLDRSDIVQ-LLNILASNNLTLTNEGLSIYIYLIYTNPHISP- 236

Query: 222  LDETKIFDALPLVKRWKADNPLAKGNAKALASVLKD-DALIEGDGPKQKGVWTPRLHFVW 280
              E    D          D P  K N   L+ VL +  A  + +       WTPRLH+VW
Sbjct: 237  --EDIQIDNNNNNTWKNND-PFLKSNIVLLSKVLLNTSAASQSEKHTSNANWTPRLHYVW 293

Query: 281  DLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSE 340
            D++LP+L   K S D  ++     K G K +      + F EFW+ V+DESFF+EKAS E
Sbjct: 294  DVILPILLNPK-SSDKLLN-----KNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHE 347

Query: 341  RKYLGVLIMEKAVRSV-PSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSAC 399
            RKYLG LI++K    +  ++ ++ IF+ N +R++INQ +++ R+L+K+S   +  IVS C
Sbjct: 348  RKYLGFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQC 407

Query: 400  ETDAS-KVVPVLTAIWFGP--NGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXX 456
            ++++  +++PVL    F    + +INFDKLTK+KT   L+  +                 
Sbjct: 408  QSNSELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSK 467

Query: 457  XXHENTDISKIKFILDTLLHVIRAHKWKAHLS--WTNPLLLALVRYAFFSAPSHLSEQSE 514
                 T  ++++F+LD++LH+IR+HK +  +S  + +P+L  ++   FF   + +S    
Sbjct: 468  LDSFTT-TTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETADVS---- 522

Query: 515  EIITLSRERLFSVLGELIPLSKHDMGAPSWAYATLELL--LQEKEKHPLALQLDAELETV 572
             I  + ++RL S+L +L  + ++   + S  Y TL L+  L E  K+ L  + D  L  V
Sbjct: 523  -ISNILKDRLISILNDLTTVGEN---SSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEV 578

Query: 573  TSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESA 632
              +A+  L++ I  S +    + +L  L  LLS+S++Q++  D+DS +T+++L  FY+  
Sbjct: 579  KDSAITTLKRAIEHSKR----DSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRY 634

Query: 633  TQGA------DNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLS 686
                      +   +GI EILL+L AQKKS+L+KL L +WESFID +   E + + + L 
Sbjct: 635  KSNTIMKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLL 694

Query: 687  ARENKAGFAQLFEGADEYEELGS-------DEAGTXXXXXXXXXXXXXXXXXXXXXXXXX 739
             RENK GFA+LFEG DEYEE+ S       ++                            
Sbjct: 695  TRENKEGFARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESN 754

Query: 740  XXXAKIDKEATSALAHALRLPDNILDEDGNVGF--------------XXXXXXXXXXXXX 785
                +IDKEATSALA AL+LPDNI+++ G V                             
Sbjct: 755  DDINRIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESM 814

Query: 786  XXXXXXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKN 845
                   LDGQLS+IF RRK+AL+ I TGN+RK++ KESR++VIAFKHR+VDM+E+Y K+
Sbjct: 815  DDEQMMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKH 874

Query: 846  VERSVTKNKKLSATMSANMLSMAEPMVKA----IQQTLDRPLAEKISKLLKNSVCKMKPA 901
            +E     ++ +  T    +L+    ++K+    IQQTLDR LAEKISKLLKN + K+K  
Sbjct: 875  IEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLV 934

Query: 902  AYKEFTSEINEESILTSLENVHA-TILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDP 960
             +K+   ++  E+IL  +  +H   IL  K GQ+  L+F  CS +SLF  ++      + 
Sbjct: 935  EFKD-CGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNA 993

Query: 961  STSEQVIGIYSTTMKHW--NVSGKFGPNFFIDFINWLASKKS 1000
               + +I +Y  T K W  N   K     F DF NWL+SK+S
Sbjct: 994  DLYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKRS 1035

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/711 (44%), Positives = 456/711 (64%), Gaps = 47/711 (6%)

Query: 4   QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSAR 63
           +VNRD FYKL SDL +ERVQSA+ALI +L+ L   E  KE+EYVL RL+ GL+S+  SAR
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62

Query: 64  LGFSLCLTEVAAAALENGH-----IGSXXXXXXXXXXXXPVD------KVKNGKEERGQL 112
           LGFSLCLTEV   AL+        + S             +D      K+K GK+ERG +
Sbjct: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122

Query: 113 FGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQV 172
           FGRMF LQA+LNEPLF++VF+  +G+I + FA +F  +LV+LA+ K WLR+PCLFTLYQ 
Sbjct: 123 FGRMFALQALLNEPLFAKVFIDKNGKISK-FAIRFQTQLVELAVLKNWLREPCLFTLYQT 181

Query: 173 IERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDALP 232
           +E+  P   D+ ++ +++ LLD++ LT T+EGLAIYL L +         +  KI  +LP
Sbjct: 182 VEKFMP-YIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHT--------NGKKIASSLP 232

Query: 233 LVKR-WKADNPLAKGNAKALASVLKDDALIEGDGPKQKGV-WTPRLHFVWDLLLP-LLAE 289
           L  + WK ++PLAKGN   L  VL +  + + + P+     W+PRLHFVWD+LLP LL +
Sbjct: 233 LESQGWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGNAANWSPRLHFVWDILLPILLGQ 292

Query: 290 EKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVLIM 349
           +  + D HV  +KK K+    K+  S  + F  FW++VVDESFF+EK+SSERKYLG LI+
Sbjct: 293 DSTTNDEHV--SKKQKS----KTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLII 346

Query: 350 EKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKVVPV 409
           +K++  VP+ LV+ +F +N LR++INQS++T R LHK+S   L +I+ ACE D +K+ P+
Sbjct: 347 QKSLELVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTTKITPI 406

Query: 410 LTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDISKIKF 469
           +  I FG NG  NFDKLTK+KT + +++ K+                    +  I K +F
Sbjct: 407 VKVILFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQF 466

Query: 470 ILDTLLHVIRAHKWKAHL-SWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLFSVL 528
           +LDT+LHV+R HK + ++ +    LL  ++  AFF       +++E I  +++ER FS+L
Sbjct: 467 VLDTILHVVRNHKLEMNIGTIIIQLLTPVIDLAFF------LKENERISNIAKERFFSLL 520

Query: 529 GELIPLSKHDMGAPSWAYATLELLL-QEKEKHPLALQLDAELETVTSNALKILRKIINKS 587
            EL  ++       SW Y  LEL+  +E    PL  ++D +L  +    ++ L+++  KS
Sbjct: 521 SELAAIT---TSTRSWQYTALELISNKEASGSPLNQEMDQDLIAIKEKGIECLKEVTKKS 577

Query: 588 TKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGITEIL 647
                +  QL GLE LLS+S+LQ++AGDVDS S +E+L +FY+     +   LVGITEIL
Sbjct: 578 -----DTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDDS-VSLVGITEIL 631

Query: 648 LSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLF 698
           L+L+AQ+K++L+K+ LV WE F+  +G EE+++L++ L+ARENK GFAQLF
Sbjct: 632 LALLAQRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  214 bits (544), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 164/278 (58%), Gaps = 22/278 (7%)

Query: 744  KIDKEATSALAHALRLPDNILDEDGNVGFXX--------------XXXXXXXXXXXXXXX 789
            KI+KE TSALA AL LPDNI++E+G V                                 
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEK 797

Query: 790  XXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERS 849
               LD QLSEIFKRRK+AL+ + +GNQRK++ KESR++VIAFKHR++D+LE Y K VE+ 
Sbjct: 798  MMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKI 857

Query: 850  VTKNKKLSATMSANMLS----MAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKE 905
             ++  +        +L+    M   MV+ IQ TLDRPLA+KISKLLK  + K+    +  
Sbjct: 858  TSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDN 917

Query: 906  FTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTS-- 963
                 N+ES+LT L+ +H  +++ KPGQ   L+FS CS++SLFLSK+LI   +    S  
Sbjct: 918  GNVS-NQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYA 976

Query: 964  -EQVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKKS 1000
              Q+I IY    K W + G+FGP  F+DF NWL SKK+
Sbjct: 977  FSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKN 1014

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  540 bits (1390), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 333/745 (44%), Positives = 450/745 (60%), Gaps = 59/745 (7%)

Query: 1   MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
           MA +VNRDLFYKL SDL +ER+QSA++LI EL++L V ++ +EW YVL RL++GLAS   
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEVAAAALENGH-----IGSXXXXXXXXXXXXPVD------------KVK 103
           SARLGFSLCLTE    AL  G      + S            P+D            K K
Sbjct: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120

Query: 104 NGKEERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQ-IQQAFAHQFMQRLVQLALTKAWLR 162
            G++ERG LFG++F LQA+LNEPLFS +F++ D + I  +   +++  L  L   K W+R
Sbjct: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180

Query: 163 QPCLFTLYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRIL 222
           + C FTLYQ IE+L P A D EF + VLTLLD++ LT + EGLAIYL +  +    K++ 
Sbjct: 181 ESCFFTLYQTIEKLLPYA-DIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQL- 238

Query: 223 DETKIFDALPLVKRWKADNPLAKGNAKALASVLKDDALIE---GDGPKQK------GVWT 273
            E  + D       WK++NPLA+GN  AL ++L+D  + E    + P  K        W 
Sbjct: 239 -EKTLSDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWA 297

Query: 274 PRLHFVWDLLLPLLAEEKV----SPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVD 329
           PRLHFVWD+LLP+L         + D      K+ K  K   S E   + F EFWQ+ +D
Sbjct: 298 PRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNE--FIRFPEFWQMAID 355

Query: 330 ESFFSEKASSERKYLGVLIMEKAVRSV---PSSLVQDIFSKNALRTLINQSSETTRHLHK 386
           ESFF+EKASSERKYLG LI +K ++S+    + L+   F++N +R+LINQSS+  R LHK
Sbjct: 356 ESFFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHK 415

Query: 387 LSVNFLKTIVSACETDAS-KVVPVLTAIWFGPN--GTINFDKLTKSKTTDSLVTAK--SX 441
           +S   + TIV  CE D S K++P L A+ F  N  G+INFDKLTKSKT   L++ K  S 
Sbjct: 416 MSQIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSS 475

Query: 442 XXXXXXXXXXXXXXXXXHENTDISKI-KFILDTLLHVIRAHKWK-AHLSWTNPLLLALVR 499
                                +I+ + +F LDT+LHV+R+HK +  + S   PLL  LV+
Sbjct: 476 STLRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVK 535

Query: 500 YAFFSAPSHLSEQSEEIITLSRERLFSVLGELIPLS---KHDMGAPSWAYATLELLLQ-E 555
            AFFS      + +E +  L++ERL+S+L EL   +   K    A SW Y TL+L+L+ E
Sbjct: 536 LAFFS------KDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELE 589

Query: 556 KE-KHPLALQLDAELETVTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAG 614
           K     L  +LDA+LET+ +N LK+L +I   +T    +  +  GLELLLS+ ILQ+ +G
Sbjct: 590 KSGNQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSK--GLELLLSMCILQLFSG 647

Query: 615 DVDSASTLEELASFYESATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVG 674
           D +S ST+EEL  FY ++ Q     LVGITEILLSL+AQKK++LRKL+L VWE FI  +G
Sbjct: 648 DTESLSTIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIG 707

Query: 675 KEELELLLNTLSARENKAGFAQLFE 699
           K EL +LL  L  RENK GFA LFE
Sbjct: 708 KNELNVLLAVLPVRENKQGFAHLFE 732

 Score =  209 bits (533), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 117/275 (42%), Positives = 165/275 (60%), Gaps = 20/275 (7%)

Query: 743  AKIDKEATSALAHALRLPDNILDEDGNVGFXXXXXXXXXXXXXXXX-------------- 788
            A IDKEATSALA AL LP+NI++E G V                                
Sbjct: 788  ANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMDD 847

Query: 789  -XXXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVE 847
                 LD QLSEIFKRRK+AL+ I TGNQRKIE KESR++VIAFKHRV+DML IY K VE
Sbjct: 848  EKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYVE 907

Query: 848  RSVTKNKKLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFT 907
                  +  +     N+L   EPM+K ++QTLD+ LA+K+ KL+K  + K+K + ++  +
Sbjct: 908  GLTLTTE--NGEKFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSNFQIES 965

Query: 908  SEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMK--DDPSTSEQ 965
               +++ ++  L+  H ++L+ K GQFP L++S CS+ S+FL K+L+ ++  D      +
Sbjct: 966  LNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKEIAYGK 1025

Query: 966  VIGIYSTTMKHWNVS-GKFGPNFFIDFINWLASKK 999
            +I +Y  T K W +S GKFG N F DF NWL+S++
Sbjct: 1026 LIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQR 1060

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  536 bits (1382), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 324/727 (44%), Positives = 445/727 (61%), Gaps = 49/727 (6%)

Query: 1   MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60
           M  +VNRD FY+L SDL DERV++A++LI EL+ L +    +EW YVL RL+ GLAS   
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61  SARLGFSLCLTEVAAAALENGHIGSXXXXX--------XXXXXXXPVDKVKN---GKEER 109
           SARLGFSLCL+EV   AL+ G +                       V K K    GK+ER
Sbjct: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120

Query: 110 GQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTL 169
           G LFG+MFGLQA+LNEPLF+ +F   +G++   FA +F Q L +LA+ K WLR+ CL+TL
Sbjct: 121 GILFGKMFGLQAILNEPLFTSIFFDQEGKVS-PFALRFAQELAELAVKKNWLRESCLYTL 179

Query: 170 YQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFD 229
           +Q ++RL P A ++E + ++L LLD++ LT T+EGLAIYL L +   + ++     K+  
Sbjct: 180 FQTVQRLVP-AMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHG--KARKNGKSFKVPS 236

Query: 230 ALPL-VKRWKADNPLAKGNAKALASVLKD-----DALIEGDGPKQKGVWTPRLHFVWDLL 283
           +L L    WK ++PL+KGN   L+ VL+D       + +G  PK    W PRLHFVWD+L
Sbjct: 237 SLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSAN-WNPRLHFVWDIL 295

Query: 284 LPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKY 343
           +P+LA  K   +     + K K     +  E     F EF+Q  VDE+FFSEKASSERKY
Sbjct: 296 IPILAPGKSDEEIPSKKSHKKKKKDTVEGIE-----FPEFFQAAVDETFFSEKASSERKY 350

Query: 344 LGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDA 403
           LG L+  +AV  V S  +Q  F++N +RTLINQSS++ R L+K+S   L  IV ACE DA
Sbjct: 351 LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410

Query: 404 S-KVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXX-XXXXXXXXXHEN 461
           S K+   L A+ FGP+GTI+FDKLTKSKT   LV  K                     E 
Sbjct: 411 SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470

Query: 462 TDISKIKFILDTLLHVIRAHKWKAHLSW-TNPLLLALVRYAFFSAPSHLSEQSEEIITLS 520
            +    +F+LDT+LH +R H+ +       +PLL ++V  AFF      S++ E+I  L+
Sbjct: 471 PNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFF------SKKGEDISDLA 524

Query: 521 RERLFSVLGELIPLSKHDMGAPSWAYATLELLL-QEKEKHPLALQLDAELETVTSNALKI 579
           RERLFS+L EL           SW + TL+L+L +E E +    +LD +L+ + + AL I
Sbjct: 525 RERLFSILSELTI----QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDI 580

Query: 580 LRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNG 639
           L+ I        +++PQ  GLE LLS  +LQ+++GD +S S +EEL  FY      + N 
Sbjct: 581 LQNI-------SSDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNES-NS 632

Query: 640 LVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFE 699
           LVGITEILLSL+AQKK++LRKL+LVVWE F+ +VG++EL++LL  L ARENK GFA+LFE
Sbjct: 633 LVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFE 692

Query: 700 GADEYEE 706
             D+Y+E
Sbjct: 693 NVDDYQE 699

 Score =  223 bits (568), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/282 (44%), Positives = 169/282 (59%), Gaps = 28/282 (9%)

Query: 743  AKIDKEATSALAHALRLPDNILDEDGNVGFXXXXXXXXXXXXXXXX-------------- 788
            AKID+EATSALA AL LP+NI+++ G V                                
Sbjct: 756  AKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEEE 815

Query: 789  ------XXXXLDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIY 842
                      LD QLS+IFKRRK+AL+ + TGN+RK+E KE+R++VI FKHR+VDMLE Y
Sbjct: 816  ESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEAY 875

Query: 843  CKNVERSVTKNKKLSATMS---ANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMK 899
             K+ +R   ++    A       N+    EPM++ +Q TLD+PLA+KISKLLK  + K+K
Sbjct: 876  IKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIK 935

Query: 900  PAAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMK-D 958
             +A+K     I+ + +L  LE  H  +L+ KPGQFP L+FS CS+TSLFL KVL+    +
Sbjct: 936  ISAFK---GAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSE 992

Query: 959  DPSTSE-QVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKK 999
            DP+ S  Q+I +Y+ T K W + GKFG N F DF NWL S+K
Sbjct: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  462 bits (1190), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 288/716 (40%), Positives = 425/716 (59%), Gaps = 45/716 (6%)

Query: 4   QVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNKSAR 63
           +VNRD FYKL SDL +ER+Q+A+ +I +L+ L V +  +EW Y + RLV+GL SS  SAR
Sbjct: 3   KVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSAR 62

Query: 64  LGFSLCLTEVAAAALENGH-----IGSXXXXXXXXXXXXPVD----KVKNGKEERGQLFG 114
           LGFS+CL+E    AL  G      + S              D    K + GK+ERG LFG
Sbjct: 63  LGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKRKGKDERGILFG 122

Query: 115 RMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTLYQVIE 174
           ++FGLQA+LNEPLFS VFV  DG     F   F+Q ++ L+  K W+R+P LF+LYQ +E
Sbjct: 123 KLFGLQALLNEPLFSNVFVTKDGI--SNFVPVFVQEMINLSKCKNWIREPALFSLYQTLE 180

Query: 175 RLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRI-LDETKIFDALPL 233
           +L  + + ++ +  +++ LDE+NLT T+EGLAIYL L ++  +I R  + E K+ +    
Sbjct: 181 KLISKVSKSD-ITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQN---- 235

Query: 234 VKRWKADNPLAKGNAKALASVLKDDALI----EGDGPKQKG--VWTPRLHFVWDLLLPLL 287
            + WK+++PLAKGN  +L  VL D+  +    + +  KQKG   W PRLHFVW+ LL  +
Sbjct: 236 -QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNEQRKQKGGANWNPRLHFVWEKLLSTI 294

Query: 288 AEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKYLGVL 347
               ++    +++  KH + K+ K+     + F EFWQ+VVDE++F++KASSERKYLG L
Sbjct: 295 ----INGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFL 350

Query: 348 IMEKAVRSVPS-SLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDASKV 406
           I ++A   + S   V D   +N +R+LINQ SE  RHL+K+++  ++ IV +CE D +K+
Sbjct: 351 IFQRAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTTKI 410

Query: 407 VPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSXXXXXXXXXXXXXXXXXXHENTDISK 466
           +PV   + FG +G+I FD+L+K+K    L+  KS                   ++ + S 
Sbjct: 411 LPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKSF 470

Query: 467 IKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSEQSEEIITLSRERLF 525
            +FILD++LH++R  K +   L  T  +L  +V+ AFF+        +E +  +S+ERLF
Sbjct: 471 SQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTG------DNETLQEMSKERLF 524

Query: 526 SVLGELIPLS-KHDMGAPSWAYATLELLLQEKEK-HPLALQLDAELETVTSNALKILRKI 583
           S+L EL  L        P   Y  ++L+ Q  E    +  +LD EL    S+AL+IL +I
Sbjct: 525 SILSELNSLHLSESQEIPQ--YVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEI 582

Query: 584 INKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNGLVGI 643
              + K     P L GL  L +  +LQ++ GD +S  TL+EL   YE      +  L  I
Sbjct: 583 AKATDK-----PYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLSSI 637

Query: 644 TEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFE 699
           TEILLSL+AQKK++L+K ++ VWE  +  V ++EL LLL+ L ARENK GFAQLFE
Sbjct: 638 TEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLFE 693

 Score =  213 bits (543), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 119/265 (44%), Positives = 163/265 (61%), Gaps = 15/265 (5%)

Query: 745  IDKEATSALAHALRLPDNILDEDGNVGFXX------XXXXXXXXXXXXXXXXXXLDGQLS 798
            IDKE TSALA AL LP +I++ +G V                            LD QLS
Sbjct: 756  IDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDDQLS 815

Query: 799  EIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTK---NKK 855
            EIFKRRK+AL+ IPTGN+RK E KESR+SVIAFKHR+VD+L +Y K+VE+ + +   ++ 
Sbjct: 816  EIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKMIQREDVDEN 875

Query: 856  LSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEESI 915
              A     +L+ A PM+K I+QTLD+ LAEK++KLLK  + K++    K  T+++ E+  
Sbjct: 876  SKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKLDTADVVED-- 933

Query: 916  LTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKD-DPSTSEQVIGIYSTTM 974
                + +H   L  KPGQFP L++S CSSTSL+ SK+L+   D      E ++  YSTT+
Sbjct: 934  ---FQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTTI 990

Query: 975  KHWNVSGKFGPNFFIDFINWLASKK 999
            K W    KF  + F+DF+NWLASKK
Sbjct: 991  KEWLKDTKFPHSIFLDFVNWLASKK 1015

>Kpol_1037.59 s1037 complement(145104..146801) [1698 bp, 565 aa]
           {ON} complement(145104..146801) [1698 nt, 566 aa]
          Length = 565

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 16/83 (19%)

Query: 172 VIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFDAL 231
           +++RL     D+E ++ +L  LD                 Q K  EI R++   K FD +
Sbjct: 175 IVDRLCADNKDSEIIKKILVSLD----------------YQLKSDEIVRVVRGNKTFDEI 218

Query: 232 PLVKRWKADNPLAKGNAKALASV 254
            + K WK  N +   N   L S+
Sbjct: 219 EVTKGWKFSNGILNSNEAYLRSL 241

>TPHA0K01380 Chr11 (286554..287510) [957 bp, 318 aa] {ON} Anc_4.151
           YGR015C
          Length = 318

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 5/76 (6%)

Query: 4   QVNRDLFYKLTSDLSDERVQSAI---ALITEL--NELAVEENGKEWEYVLGRLVRGLASS 58
            +N+ +   ++ + +DE VQ  I    LI ++   E+ +E+N K W+  + +L   + SS
Sbjct: 140 NLNKMIIIDISPNYTDELVQILIDNYNLIMQILNKEILIEKNSKNWKQKVTKLFNDIKSS 199

Query: 59  NKSARLGFSLCLTEVA 74
           + S  L FS   T  A
Sbjct: 200 DPSTSLYFSSGFTHYA 215

>TPHA0E03690 Chr5 (781473..783926) [2454 bp, 817 aa] {ON} Anc_1.45
           YCL030C
          Length = 817

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 77/167 (46%), Gaps = 20/167 (11%)

Query: 799 EIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCK-NVERSVTKNKKLS 857
           +I +RR DA  K     ++K+EAK   +  +  K   +++++   K +VE+++++     
Sbjct: 340 KITRRRGDAKPKFIQNKKQKVEAKVEGERDLTNKKIYLNVIKSSNKDDVEKAISR----P 395

Query: 858 ATMSANMLSMAEPMVKAIQQTLDRPLAEKIS-----KLLKNSVCKMKPAAYKEFTSEINE 912
              ++ ++ +  P+V+ +++  D+ L E        KL    +C   P  Y E  ++  +
Sbjct: 396 IQKTSEIMHLVNPIVQNVKEKGDKALLEYTEKFDGIKLSTPVLCAPFPKEYFEGLTQEMK 455

Query: 913 ESILTSLENV---HAT-------ILSPKPGQFPQLFFSACSSTSLFL 949
           ES+  S+ENV   HA        ++  +PG     F        L++
Sbjct: 456 ESLDLSMENVRKFHAAQLQTETMVVETQPGVVCSRFSRPIERVGLYI 502

>ZYRO0A01144g Chr1 (82681..84063) [1383 bp, 460 aa] {ON} similar to
           uniprot|P12695 Saccharomyces cerevisiae YNL071W LAT1
           Dihydrolipoamide acetyltransferase component (E2) of
           pyruvate dehydrogenase complex which catalyzes the
           oxidative decarboxylation of pyruvate to acetyl-CoA
          Length = 460

 Score = 32.3 bits (72), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 330 ESFFSEKASSERKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSV 389
           E++  E  S+ R  +G  ++E + +S+PS +V    S + L  L    + + +  +KLS+
Sbjct: 227 ETYEDEPISNMRSIIGRRLLE-STQSIPSYIVSSDISVSKLLKLRKSLNASAKDQYKLSI 285

Query: 390 N--FLKTIVSACETDASKVVPVLTAIWFGPNGTI 421
           N   +K I     T A++ VP   A W    G I
Sbjct: 286 NDILIKAI-----TVAARRVPDANAYWLQDQGII 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,290,093
Number of extensions: 3558478
Number of successful extensions: 11284
Number of sequences better than 10.0: 41
Number of HSP's gapped: 11292
Number of HSP's successfully gapped: 59
Length of query: 1002
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 882
Effective length of database: 39,721,479
Effective search space: 35034344478
Effective search space used: 35034344478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)