Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR019Wna 1ON28828814850.0
Ecym_3010na 1ON2872067921e-105
KLLA0C00396gsingletonON897941103e-05
TPHA0B016904.332ON465118731.0
Kwal_56.240986.224ON603123676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR019W
         (288 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR019W Chr3 (390552..391418) [867 bp, 288 aa] {ON} NOHBY317; No...   576   0.0  
Ecym_3010 Chr3 complement(21352..22215) [864 bp, 287 aa] {ON} si...   309   e-105
KLLA0C00396g Chr3 complement(26146..28839) [2694 bp, 897 aa] {ON...    47   3e-05
TPHA0B01690 Chr2 (378052..379449) [1398 bp, 465 aa] {ON} Anc_4.3...    33   1.0  
Kwal_56.24098 s56 (848743..850554) [1812 bp, 603 aa] {ON} YPL210...    30   6.5  

>ACR019W Chr3 (390552..391418) [867 bp, 288 aa] {ON} NOHBY317; No
           homolog in Saccharomyces cerevisiae
          Length = 288

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/288 (96%), Positives = 279/288 (96%)

Query: 1   MQEHMRSSGTERMTEVERAGQAIQLSGSRAHESPEVGDKTLDXXXXXXXXXGEKVRGLPL 60
           MQEHMRSSGTERMTEVERAGQAIQLSGSRAHESPEVGDKTLD         GEKVRGLPL
Sbjct: 1   MQEHMRSSGTERMTEVERAGQAIQLSGSRAHESPEVGDKTLDVAAVAAVVAGEKVRGLPL 60

Query: 61  MAGDLLGEDGSLGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRKRDNAYRARKRAT 120
           MAGDLLGEDGSLGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRKRDNAYRARKRAT
Sbjct: 61  MAGDLLGEDGSLGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRKRDNAYRARKRAT 120

Query: 121 ELTVDPELRQLFMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDS 180
           ELTVDPELRQLFMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDS
Sbjct: 121 ELTVDPELRQLFMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDS 180

Query: 181 FIECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLK 240
           FIECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLK
Sbjct: 181 FIECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLK 240

Query: 241 QYHCQSYMRVNYSFKTQVLSIKFRHIQHGDSPLLIGSDSNHPSCFDEK 288
           QYHCQSYMRVNYSFKTQVLSIKFRHIQHGDSPLLIGSDSNHPSCFDEK
Sbjct: 241 QYHCQSYMRVNYSFKTQVLSIKFRHIQHGDSPLLIGSDSNHPSCFDEK 288

>Ecym_3010 Chr3 complement(21352..22215) [864 bp, 287 aa] {ON}
           similar to Ashbya gossypii ACR019W
          Length = 287

 Score =  309 bits (792), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/206 (76%), Positives = 178/206 (86%)

Query: 72  LGHDMHALGKRQRILKDQLQSMSPQERLERQRAMRRKRDNAYRARKRATELTVDPELRQL 131
           L  ++ +LGKRQRILK QLQSMSPQERLERQRAMRR+RDNAYRARKRATELTVDP+L QL
Sbjct: 79  LDSEILSLGKRQRILKGQLQSMSPQERLERQRAMRRRRDNAYRARKRATELTVDPDLEQL 138

Query: 132 FMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDSFIECLRNKIRS 191
           F  LD +K+FHSIS KYDAA+L+ EFFPRVLL K+ETDD A YKAPFDSFIE LRNKI++
Sbjct: 139 FTTLDTSKQFHSISVKYDAASLSQEFFPRVLLNKSETDDPAPYKAPFDSFIEGLRNKIKN 198

Query: 192 FSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLKQYHCQSYMRVN 251
             G KLSKERTSVH+TSVSCVLYCSQDKSHQRL+Q+K+ +K+ NLDN KQY CQSYMRVN
Sbjct: 199 VCGIKLSKERTSVHITSVSCVLYCSQDKSHQRLIQSKDIQKSHNLDNAKQYQCQSYMRVN 258

Query: 252 YSFKTQVLSIKFRHIQHGDSPLLIGS 277
           YSFKT VLSIKFRH +H +  +L  S
Sbjct: 259 YSFKTHVLSIKFRHTKHNEQAILPSS 284

>KLLA0C00396g Chr3 complement(26146..28839) [2694 bp, 897 aa] {ON}
           uniprot|Q9HDS6 Kluyveromyces lactis HMLALPHA3 Mating-
           type protein ALPHA3
          Length = 897

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 183 ECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLKQY 242
           E L   IR  +G    +  T   V ++    +C QDK HQ L      KK+ + DNLKQ+
Sbjct: 149 ERLLELIREGTGYIFVRGWTGYRVNTIILKCHCKQDKCHQILKPRCNVKKHHDPDNLKQF 208

Query: 243 HCQSYMRVNYSFKTQVLSIKFRH-IQHGDSPLLI 275
           +C S   V+++ K   + I F H  +H   P+ I
Sbjct: 209 NCFSSFSVHFNVKLNTIKICFCHKSKHETLPITI 242

>TPHA0B01690 Chr2 (378052..379449) [1398 bp, 465 aa] {ON} Anc_4.332
           YML068W
          Length = 465

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 42/118 (35%), Gaps = 15/118 (12%)

Query: 126 PELRQLFMALDKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDSFIECL 185
           PE +   + LD  K +  +       A+  EFF RVL  +  T                 
Sbjct: 230 PECKYEEIVLDSFKDYTLLKETLFTPAIPFEFFDRVLSEELCTK---------------Y 274

Query: 186 RNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLKQYH 243
           R    S+  TKLSK  TS  +    C  +C +D     ++  K        + L  +H
Sbjct: 275 RELFHSYCATKLSKHSTSACIPCRRCNTWCVKDNLDDAMISCKTCSFVFCFNCLHSWH 332

>Kwal_56.24098 s56 (848743..850554) [1812 bp, 603 aa] {ON} YPL210C
           (SRP72) - component of signal recognition particle
           [contig 166] FULL
          Length = 603

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 52/123 (42%), Gaps = 13/123 (10%)

Query: 125 DPELRQLFMAL---DKNKKFHSISAKYDAAALTPEFFPRVLLTKAETDDAALYKAPFDSF 181
           +P LRQ  +AL   D+ K+  S+  KY+A  L+  F+   L          LYK      
Sbjct: 39  NPILRQWIIALIKSDQYKQCQSLLKKYEAE-LSGVFYLEKLYV--------LYKLGHVKQ 89

Query: 182 IECLRNKIRSFSGTKLSKERTSVHVTSVSCVLYCSQDKSHQRLLQTKETKKNSNLDNLKQ 241
            E L  + +S    K S +R  +HV +  C     + +   R+ Q   T    NLDN  +
Sbjct: 90  FESLYQESQSIETPKQSSDRGLLHVRAQFC-FKNGKFEEASRIYQVLATHNEQNLDNETE 148

Query: 242 YHC 244
             C
Sbjct: 149 LAC 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,029,629
Number of extensions: 1106587
Number of successful extensions: 3893
Number of sequences better than 10.0: 20
Number of HSP's gapped: 4071
Number of HSP's successfully gapped: 20
Length of query: 288
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 180
Effective length of database: 41,097,471
Effective search space: 7397544780
Effective search space used: 7397544780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)