Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR018C6.8ON47847824960.0
Ecym_30116.8ON50947810031e-131
SAKL0E00792g6.8ON5114888591e-109
TDEL0G046306.8ON5034736606e-80
NDAI0G00860singletonON5234936556e-79
Skud_16.56.8ON5154586162e-73
Kpol_1045.796.8ON5084775996e-71
Suva_16.336.8ON5184575937e-70
YPL272C6.8ON5174585867e-69
TPHA0J002606.8ON5154755858e-69
Smik_6.4806.8ON5164665666e-66
CAGL0A01089g6.8ON5354775624e-65
KAFR0B065106.8ON5084855508e-64
KNAG0E027706.8ON5084875492e-63
TPHA0M001806.8ON5035195306e-61
KLTH0C11572g6.8ON5184805062e-57
Kwal_56.223416.8ON5194524872e-54
NCAS0D021806.8ON5154794415e-48
TBLA0A072206.8ON5094954092e-43
Kpol_1032.1singletonON2462152678e-26
CAGL0K00737g5.119ON457127910.013
TDEL0E051105.119ON469144910.017
KNAG0J013207.368ON572104696.4
NOTE: 1 genes in the same pillar as ACR018C were not hit in these BLAST results
LIST: Kpol_191.1

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR018C
         (478 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   966   0.0  
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   390   e-131
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   335   e-109
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   258   6e-80
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              256   6e-79
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   241   2e-73
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   235   6e-71
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   233   7e-70
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   230   7e-69
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   229   8e-69
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   222   6e-66
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   221   4e-65
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   216   8e-64
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   216   2e-63
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   208   6e-61
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   199   2e-57
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   192   2e-54
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      174   5e-48
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   162   2e-43
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   107   8e-26
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    40   0.013
TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.1...    40   0.017
KNAG0J01320 Chr10 complement(238704..240422) [1719 bp, 572 aa] {...    31   6.4  

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  966 bits (2496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/478 (97%), Positives = 465/478 (97%)

Query: 1   MRRCVQGCAMGRFLRSLNGFDRREQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVE 60
           MRRCVQGCAMGRFLRSLNGFDRREQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVE
Sbjct: 1   MRRCVQGCAMGRFLRSLNGFDRREQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVE 60

Query: 61  MCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAGK 120
           MCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAGK
Sbjct: 61  MCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAGK 120

Query: 121 PLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQ 180
           PLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQ
Sbjct: 121 PLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQ 180

Query: 181 LPIDPDACSLPGVDVPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKP 240
           LPIDPDACSLPGVDVPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKP
Sbjct: 181 LPIDPDACSLPGVDVPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKP 240

Query: 241 FLLTLDKESLYGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGS 300
           FLLTLDKESLYGTTVSGYLN             EEVCVRSFLCAITLLSLKPLIRNFDGS
Sbjct: 241 FLLTLDKESLYGTTVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGS 300

Query: 301 IAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSP 360
           IAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSP
Sbjct: 301 IAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSP 360

Query: 361 KFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKIIEINVVDMGTSPSA 420
           KFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKIIEINVVDMGTSPSA
Sbjct: 361 KFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKIIEINVVDMGTSPSA 420

Query: 421 RFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDELS 478
           RFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDELS
Sbjct: 421 RFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDELS 478

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  390 bits (1003), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 288/478 (60%), Gaps = 35/478 (7%)

Query: 24  EQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVV 83
           E E WSD  TL + R   L + QIS+AL +MI+ENVE+CVT+TD  KFAP   I YDDVV
Sbjct: 42  ESERWSDDITLSNLRDSRLFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVV 101

Query: 84  RVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAGKPLWEVYIADGSMVIFHCHNVLFD 143
             IEF+TYKDE I C +GIPPY+ R+IL  +KFE G+PLWE+ I D +MVI HCH V+FD
Sbjct: 102 IHIEFKTYKDELIECQNGIPPYILRNILENNKFEFGRPLWELIIVDYTMVILHCHEVMFD 161

Query: 144 LFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPF 203
           LFAA NFH++FQ+AL +  K+    + LFVYEG  LQL    +   +  + V    S P 
Sbjct: 162 LFAAANFHLKFQKALSQFPKDTHALDILFVYEGNELQLS-KTNFDGMSQISVSPVQSLPL 220

Query: 204 VSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDK------------ESLY 251
                  C   LK  GA  + V  SL + R +      + T +              +L 
Sbjct: 221 ------QCISVLK--GAYRTTVKKSLNVIRRNFVANNQITTYESSKSDVFKSMFNPNTLC 272

Query: 252 GTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRT 311
           GTTVSG LN             E VC+ S LCAITLLSLKPLIR F+GSI F +P+D+R 
Sbjct: 273 GTTVSGSLNAERLASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIR- 331

Query: 312 ESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQF 371
           E  +    G     ++V+CPL+ I+D+ F+   +  + +   K+D NSP + E LLEYQF
Sbjct: 332 EKLEIFDLGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQF 391

Query: 372 KRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKI-----------IEINVVDMGTSPSA 420
           K++T+HVM SL  +    W  KR++    L+ KK+           IEIN+VDMG +   
Sbjct: 392 KQLTSHVMNSLKEKKQA-WQ-KRRFDMSSLKGKKLRRSNKIIRGKFIEINLVDMGEAQDG 449

Query: 421 RFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDELS 478
           +F  KN+NFT SLGS+  +S+SCA++RGVGMN+ MHY E + MD FV+CFQ  L++L+
Sbjct: 450 QFHTKNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLEDLA 507

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  335 bits (859), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/488 (40%), Positives = 276/488 (56%), Gaps = 46/488 (9%)

Query: 20  FDRREQETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEY 79
           FD+  +ETWSD++TL++ +   L    +S AL+ +I  NVE+  T+ D  +F PV  I +
Sbjct: 39  FDK--EETWSDNATLLTVKDQRLSNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMF 96

Query: 80  DDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHC 137
           DDVV+ +EF +YKDE + CHDG+PPY+ RHI +K+KFE    KPLW++ I D +MVIFH 
Sbjct: 97  DDVVQKVEFDSYKDELVNCHDGVPPYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHG 156

Query: 138 HNVLFDLFAAGNFHVRFQQALQRCEKNEPHNETLF------------VYEGGPLQLP-ID 184
           H+VLFD+FAA NFH  FQQAL +  K+ P  E LF            +YE   L+LP I 
Sbjct: 157 HDVLFDIFAAANFHKLFQQALNQLPKDGPTLECLFKNDSKASFFPKSIYENHKLRLPAIA 216

Query: 185 PDACSLPGVDVPYPASSPFVSFVKNVCRYAL-KPFGALASAVTPSLRLNRSSLGRKPFLL 243
            D   L              SF K+V  + + KP   + +     L+  +S        +
Sbjct: 217 TDLFQLQT-----------QSFFKSVYNWTIKKPLDFINTNPNSGLKYYQSCYTD----I 261

Query: 244 TLDKESLYGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAF 303
            L   +L GTTV G ++             E +C+ SF+CAI LL LKPL+ NF  S+ F
Sbjct: 262 LLGANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTF 321

Query: 304 SIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESL-FNRPSKQRKTKLDKNSPKF 362
           SIP+DLR+   + + FG   K +LV+CPL LIDD+VF+ L        R TK     P +
Sbjct: 322 SIPVDLRSTIPQASRFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNY 381

Query: 363 SEGLLEYQFKRVTTHVMKSLTA-----QTSG---DWTGKRKYSKC-QLRKKKIIEINVV- 412
            E LLEYQF+   THV  +L       + SG   D   + K+ K  Q + K+IIE+N V 
Sbjct: 382 EESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVT 441

Query: 413 --DMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCF 470
                   +A F IK++ FT S   ETFMSLSCA     G+N+C+HY +  +MD+FV+CF
Sbjct: 442 EFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECF 501

Query: 471 QTFLDELS 478
           Q+F++ELS
Sbjct: 502 QSFMEELS 509

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  258 bits (660), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 161/473 (34%), Positives = 253/473 (53%), Gaps = 28/473 (5%)

Query: 26  ETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRV 85
           E WSD +TL++ +   L    +S  L  MI ++VE+  T+ +  +FAPV  I+ ++V+  
Sbjct: 36  EEWSDDATLLTYKDSRLNLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINA 95

Query: 86  IEFQTYKDEAIACHDGIPPYVARHILNKSKFE--AGKPLWEVYIADGSMVIFHCHNVLFD 143
           + F +YKDE + C  G PPY+ RHI N++ F+  +G  LW++Y+ D ++V+FH H+VLFD
Sbjct: 96  VTFGSYKDEFVNCRFGAPPYLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFD 155

Query: 144 LFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPF 203
           +F+A NFH  F Q L    K+     T+F  E   L  P          + +P  A+  F
Sbjct: 156 IFSAANFHKIFLQTLNSISKSGSKLSTIFKLEKAVLP-PFPKSIYDNAKLRLPAKAADLF 214

Query: 204 ----VSFVKNVCRYALK-PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGY 258
                SF K++   A+K P   + S     L+  R+   R   +L  D  +L GTT+ G 
Sbjct: 215 NLQTQSFFKSLYFNAVKKPLDYINSNPPQQLKEYRT---RYADILRTDN-NLCGTTIFGR 270

Query: 259 LNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTP 318
           +              + +C++SF+C IT+L LKP+++N+ GSI F +P+DLR+    ++ 
Sbjct: 271 ILPKRLESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSLEASSE 330

Query: 319 FGFQSKRILVDCPLALIDDRVFESL-FNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTH 377
           FG   K I V+CPL+LIDD+ F SL           K+ +  P + E LLEYQFK+VT H
Sbjct: 331 FGMFYKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDH 390

Query: 378 VMKSLTAQTSG--------DWTGKRKY-SKCQLRKKKIIEIN-----VVDMGTSPSARFQ 423
           V+ +L  +           D   + K+ S       K+I+IN      VD     S +F 
Sbjct: 391 VVAALRQRMKAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFH 450

Query: 424 IKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDE 476
           ++ +N T SL     MSLS       G+++C+HY +  +M+ FV+CFQ+F+++
Sbjct: 451 MRELNMTQSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECFQSFIED 502

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  256 bits (655), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 161/493 (32%), Positives = 253/493 (51%), Gaps = 54/493 (10%)

Query: 27  TWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVI 86
           T SD++TL++++   L    ++  L  +I++++E+  T+ +  +F  +++I+ +DV+ VI
Sbjct: 42  TLSDAATLLATKDIRLNIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVI 101

Query: 87  EFQTYKDEAIACHDGIPPYVARHILNKSKFEAGKPLWEVYIADGSMVIFHCHNVLFDLFA 146
            F TYKDE I CH G PPY+ RHI NK KFE  KPLW++YI D +M+IFH  ++LFD+F+
Sbjct: 102 TFDTYKDEQINCHSGAPPYLLRHIFNKEKFELNKPLWKLYIIDETMIIFHGFDMLFDIFS 161

Query: 147 AGNFHVRFQQALQR-----------------------CEKNEPHNETLF---VYEGGPLQ 180
           A NFH  F   L                          +KN   N   F   +++   L 
Sbjct: 162 AANFHKLFFDELNDYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLH 221

Query: 181 LP-IDPDACSLPGVDVPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRK 239
           LP + PD  +L          S F +   N  +  +  F    S     +          
Sbjct: 222 LPAMTPDLFNLQ-------TKSFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTH 274

Query: 240 PFLLTLD-KESLYGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFD 298
            +L  L    SL GTTV G ++             +E+C+RSF+C I ++ LKP I+N+ 
Sbjct: 275 NYLDMLGITSSLCGTTVFGTVSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYS 334

Query: 299 GSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKN 358
           G+I FSIP++LR        FG   K + +DCPL+LIDDR F+        +  +  D+N
Sbjct: 335 GNIIFSIPINLRNYIDGAKNFGLFYKDVKIDCPLSLIDDRNFK----YNGYKDSSIPDEN 390

Query: 359 SPKFSEGLLEYQFKRVTTHVMKSLTAQT--------SGDWTGKRKYSKCQL--RKKKIIE 408
             +F+E LLEYQFK+VT  +   +  +         + D   + K+   ++  +  KII+
Sbjct: 391 DLEFNEKLLEYQFKQVTEFIENVILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQ 450

Query: 409 IN-----VVDMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSM 463
           IN     ++    + +  F + N NFT +L    FMS+S A+    G+N+C+HY +  SM
Sbjct: 451 INDTTEIMLGENDNNNKAFTLTNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSM 510

Query: 464 DMFVDCFQTFLDE 476
           + FV+CFQTF++E
Sbjct: 511 ETFVECFQTFIEE 523

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  241 bits (616), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 151/458 (32%), Positives = 248/458 (54%), Gaps = 38/458 (8%)

Query: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105
           I++ L+ +I+    +  TV +  +F P+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 67  IAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPY 126

Query: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163
           + RH  NK++F  G  KPLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 127 LLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNNISL 186

Query: 164 NEPHNETLFVYEGGPLQLP-IDPDACSLPGVDVPYPASSPFV------SFVKNVCRYALK 216
            E H++   +++   + +  ++          +  PA +P +      SF K++    LK
Sbjct: 187 -EAHSDDRVLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSIFYNTLK 245

Query: 217 -PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNXXXXXXXXXXXXXEE 275
            PFG L +  +     + + L +   +L     SL GTTV G +N             E 
Sbjct: 246 RPFGYLTNQTSLGPSTSTTQLKKYNDILNA-HSSLCGTTVFGIVNNQRFNYLKSIVNQEH 304

Query: 276 VCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALI 335
           +C+RSF+C I ++ LKPL+++F G+I FSIP+DLR         G   K + ++CPL+LI
Sbjct: 305 ICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLRKNLDLGESLGLFFKELRIECPLSLI 364

Query: 336 DDRVF--ESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQT------- 386
           DD +   E L NR  K+       +  +F+E L+EYQF +VT HV   + A+        
Sbjct: 365 DDELSADEFLANRNDKE-------DDDEFNEKLMEYQFNKVTKHVSDFIMAKLKSWEKNG 417

Query: 387 -SGDWTGKRKYSK--CQLR--KKKIIEIN-VVDMGTS---PSARFQIKNMNFTDSLGSET 437
            + D   + KY    C ++  K K+I+IN V D+  S       F+I +  FT S+   T
Sbjct: 418 FNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAFKIISSGFTSSINRPT 477

Query: 438 FMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
            MSLS      +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 478 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  235 bits (599), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 252/477 (52%), Gaps = 36/477 (7%)

Query: 25  QETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVR 84
           Q+  +D +TL+++    L + ++ +AL+ M+ ++ E+  TV +  +F  V  I+  D++ 
Sbjct: 37  QDGLTDDATLLTNSEPLLLDSRLVNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIIT 96

Query: 85  VIEFQTYKDEAIACHDGIPPYVARHILNKSKFE--AGKPLWEVYIADGSMVIFHCHNVLF 142
            ++F + KDE + CH G PPY+ RHI N++KF   +GKPLWE+ + D S+V+FH  +VLF
Sbjct: 97  SVKFDSLKDEFVNCHLGAPPYLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLF 156

Query: 143 DLFAAGNFHVRFQQALQRCEKNEPHN-ETLFVYEGG--------PLQLPIDPDACSLPG- 192
           D+FAA NFH  F + L   +     + E ++ Y+          P  +  +P    +PG 
Sbjct: 157 DIFAAANFHKLFLETLNSMDDEHITDLEYIYRYDATKSNRSISFPRTIYENP-KLRIPGK 215

Query: 193 -VD-VPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESL 250
            +D V     S F SF  N  +   KP   +     P   +  + +         +  +L
Sbjct: 216 TIDLVNLQTQSFFKSFYVNAIK---KPLDIITFNSEPMKYIKPNEID-----FMNEASAL 267

Query: 251 YGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLR 310
            GTTV G++              E VC+RSF+C I LL LK +I++F GSI FSIP++LR
Sbjct: 268 CGTTVFGHITTDRFEYLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSIPVNLR 327

Query: 311 TESHKTTPFGFQSKRILVDCPLALIDDRVFESL-FNRPSKQRKTKLDKNSPKFSEGLLEY 369
                 + FG   K ILV+CPL+LIDD+V+ ++           K+ +  P F E  LEY
Sbjct: 328 ESIEGPSDFGLFYKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEY 387

Query: 370 QFKRVTTHVMKSLTAQT--------SGDWTGKRKY-SKCQLRKKKIIEINVVD---MGTS 417
           QFK+++  V  ++  +         + D   K K+ S  +    KII+IN V    + +S
Sbjct: 388 QFKQISDLVSTTMKERMRAWRRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFKINSS 447

Query: 418 PSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFL 474
            S++  IK +NFT S+ +  FMSLS    +  G N+C+HY +   M+ FV+ FQ+F+
Sbjct: 448 KSSKVSIKELNFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFV 504

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  233 bits (593), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 157/457 (34%), Positives = 242/457 (52%), Gaps = 33/457 (7%)

Query: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105
           I++ L+ +I+    +  TV +  ++AP+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 67  IATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVPPPY 126

Query: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163
           + RH  NK++F  G  KPLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 127 LLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNSITS 186

Query: 164 -NEPHNETLFVYEG---GPLQLP---IDPDACSLPGVDVPYPASSPFVSFVKNVCRYALK 216
            +   +  LF         L  P    D     LP +  P        SF K++    LK
Sbjct: 187 VSRSDDRVLFDINDVNFAELSFPKSIYDSAKLRLPAM-TPQILHKQTQSFFKSIFYNTLK 245

Query: 217 -PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNXXXXXXXXXXXXXEE 275
            PFG L +  + S     S L R   +L  +  SL GTTV G +N             E 
Sbjct: 246 RPFGYLTNQTSFSSPAPTSQLKRYNDILNTN-SSLCGTTVFGIVNNQRFSYLKSIVNQEH 304

Query: 276 VCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALI 335
           +C+RSF+C I ++ LKPL+++F G+I FSIP+DLR   +     G   K + ++CPL+LI
Sbjct: 305 ICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNLGESLGLFFKELRIECPLSLI 364

Query: 336 DDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHV-------MKSLTAQTSG 388
           DD   E   N          + ++ +F+E L+EYQF +VT HV       +KS       
Sbjct: 365 DD---ELSINEFLVNSNDNENNDNDEFNEKLMEYQFNKVTKHVSNYIMTKLKSWERNGFN 421

Query: 389 DWTGKR-KYSK-----CQLRKKKIIEIN-VVDMGTSPS---ARFQIKNMNFTDSLGSETF 438
           D   +R KY        Q  K K+I+IN V D+  S S     F+I +  FT+S+   T 
Sbjct: 422 DDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMSNDDKSFKIVSSGFTNSINRPTL 481

Query: 439 MSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
           MSLS      +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 482 MSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  230 bits (586), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 148/458 (32%), Positives = 242/458 (52%), Gaps = 36/458 (7%)

Query: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105
           I++ L+ +I+    +  TV +  +F P+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 67  IATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVPPPY 126

Query: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163
           + RH  NK++F  G  KPLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 127 LLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKELNEIS- 185

Query: 164 NEPHNETLFVYEGGPLQLP--------IDPDACSLPGVDVPYPASSPFVSFVKNVCRYAL 215
              H+E   +++   + L          D     LP +  P        SF K++    L
Sbjct: 186 TVTHSEDRILFDVNDINLSELKFPKSIYDSAKLHLPAM-TPQIFHKQTQSFFKSIYYNTL 244

Query: 216 K-PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNXXXXXXXXXXXXXE 274
           K PFG L +  + S  ++ + L +   +L     SL GTTV G +N             E
Sbjct: 245 KRPFGYLTNQTSLSSSVSATQLKKYNDILNA-HTSLCGTTVFGIVNNQRFNYLKSIVNQE 303

Query: 275 EVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLAL 334
            +C+RSF+C I ++ LKPL+++F G+I F+IP++LR         G   K + V+CPL+L
Sbjct: 304 HICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLRNHLGLGGSLGLFFKELRVECPLSL 363

Query: 335 IDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQT-------- 386
           IDD +  + F   S   +   D+ + +    L+EYQF +VT HV   + A+         
Sbjct: 364 IDDELSANEFLTNSNDNEDNDDEFNER----LMEYQFNKVTKHVSGFIMAKLRSWEKNGF 419

Query: 387 SGDWTGKRKYSK-----CQLRKKKIIEIN-VVDMGTSPSA---RFQIKNMNFTDSLGSET 437
           + D   + KY        Q  + K+I+IN V D+  S +     F+I +  FT S+   T
Sbjct: 420 NDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDDKSFKIVSTGFTSSINRPT 479

Query: 438 FMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
            MSLS      +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 480 LMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  229 bits (585), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 242/475 (50%), Gaps = 35/475 (7%)

Query: 30  DSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQ 89
           D++TL++         +  +AL ++I EN E+  T+    +F P++ I+ DDV+  I+F 
Sbjct: 43  DAATLLTQNEENNMFSRFINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFN 102

Query: 90  TYKDEAIACHDGIPPYVARHILNKSKF--EAGKPLWEVYIADGSMVIFHCHNVLFDLFAA 147
           + KDE + C +G PPY+ RHI NK KF   +GKPLW +YI D S+VIFH  +VLFD+++A
Sbjct: 103 STKDEFVNCKNGAPPYLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSA 162

Query: 148 GNFHVRFQQALQRCEKNEPHNETLFVYEG---GPLQLPIDPDACSLPGVDVPYPASSPFV 204
            +FH +F  AL+          T+F         L  P        P + +P   +   V
Sbjct: 163 ASFHRKFFAALEGATPTSEKLTTIFRLSDLSKSALTYPFPKSIYDSPLLMLP-AKTIDLV 221

Query: 205 S-----FVKNVC-RYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGY 258
           S     F+K+V  +  +KP   +     P     +S     P  +     SL GTTV G 
Sbjct: 222 SLQTRFFLKSVVSKTIVKPLNIIMFNDEPM----KSFTNSDPMDILEKTSSLCGTTVFGN 277

Query: 259 LNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTP 318
           ++             E VC +S +C IT+L LKPLI++F  +I FSI ++LR    ++T 
Sbjct: 278 ISNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSIEESTE 337

Query: 319 FGFQSKRILVDCPLALIDDRVF--ESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTT 376
           FG   K + ++ PL+ IDD VF  ++ +N       + + + +P + E L+ YQF ++ T
Sbjct: 338 FGLFYKNVRIEVPLSFIDDNVFKLKTSYNG-YDASNSNIKETNPNYEEQLIAYQFNQIAT 396

Query: 377 HVMKSLTAQ---------TSGDWTGKRKYSKCQLRKKKIIEIN-VVDMGTSPSAR----- 421
            + ++L  +            D    +  SK +    KII+IN + D+   P  +     
Sbjct: 397 FISRNLKQRMRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSFCPMNKNGELN 456

Query: 422 -FQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
              +K+++FT SL  + FMSLS    +  G N+C+H+ E   +++FV+ FQ F+D
Sbjct: 457 SVSLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFID 511

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  222 bits (566), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 146/466 (31%), Positives = 242/466 (51%), Gaps = 53/466 (11%)

Query: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPP-Y 105
           I++ L+ +I+    +  T+ +  +F P+ +++  D+V VIEF+T KD+ + CH G+PP Y
Sbjct: 67  IATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVPPPY 126

Query: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEK 163
           + RH  NK++F  G  +PLW +Y+ D ++++FH H+VLFD+F+A NFH  F + L     
Sbjct: 127 LLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKELNNIS- 185

Query: 164 NEPHNETLFVYEGGPLQLPIDPDACSLPGVDVP----------YPASSPFV------SFV 207
                 ++  YE    ++  D +  S+  ++ P           PA +P +      SF 
Sbjct: 186 ------SVTHYED---RILFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFF 236

Query: 208 KNVCRYALK-PFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNXXXXXX 266
           K++    LK PFG L +  + S   + + L +   +L     SL GTTV G ++      
Sbjct: 237 KSIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNA-HSSLCGTTVFGIVSNQRFNY 295

Query: 267 XXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRI 326
                  E +C+RSF+C I ++ LKPL+++F G+I FSIP+DLR         G   K +
Sbjct: 296 LKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGLGESLGLFFKEL 355

Query: 327 LVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQT 386
            + CPL+LIDD +  + F   S   +   +       E L+EYQF  VT HV   + A+ 
Sbjct: 356 RIACPLSLIDDELSVNEFLANSNDNEEDEEF-----DEKLMEYQFNNVTKHVSSFIMAKL 410

Query: 387 --------SGDWTGKRKYSK-----CQLRKKKIIEIN-VVDMGTS---PSARFQIKNMNF 429
                   + D   + KY        Q  K K+++IN V D+  S       F+I +  F
Sbjct: 411 KSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDKSFKIVSSGF 470

Query: 430 TDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
           T S+   T +SLS    + +G+N+C+HY +  +++ FV+CF++F++
Sbjct: 471 TSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  221 bits (562), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 154/477 (32%), Positives = 250/477 (52%), Gaps = 61/477 (12%)

Query: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDG-IPPY 105
           ++ AL+S+I +N EM  TV D  +FAP+  I   DV+ V+ F   KDE + CH G  PPY
Sbjct: 72  VTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVNCHSGGPPPY 131

Query: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRF-QQALQRCE 162
           + RHIL    F+ G  KPLW +Y+ D S ++FHC ++LFD+F+A NFH  F ++ +  C 
Sbjct: 132 LIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLFLKELIAVCR 191

Query: 163 KNEPHNETL-FVYEGGPLQLPIDPDACSLP-----GVDVPYPASSPFV------SFVKNV 210
             + + + L ++++   LQ   + +  S+P      + +  PA+ P +      SF K++
Sbjct: 192 PQQSYEKPLEYLFK---LQKSFE-NNYSVPKSIYDNLKLHLPATRPELLNLQTQSFFKSI 247

Query: 211 -CRYALKPFGALA---------------SAVTPSLRLNRSSLGRKPFLLTL-DKESLYGT 253
            C    KP   +                S    S   N+  L R  +   L    S  G 
Sbjct: 248 FCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTSATSNCGH 307

Query: 254 TVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTES 313
           T+ G ++             E++C+RSF+ AIT+L LKP++++F+G++ FS+P++LR   
Sbjct: 308 TIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMNLRDSM 367

Query: 314 HKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKR 373
           ++   FG   K I V+CPL++IDD+          +     L+++ P+++E LLE QF++
Sbjct: 368 NEKRDFGLVYKDIRVECPLSMIDDK----------QCSVPGLNESDPEYNEKLLEIQFQQ 417

Query: 374 VTTHVMKSLTAQTS-------GDWTGKR----KYSKCQLRKKKIIEINVVDMGT--SPSA 420
           + T+V +S+  + S        D   KR    KY +      ++I+IN V   +      
Sbjct: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFDDNDI 477

Query: 421 RF-QIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDE 476
           RF  IK+  FT SL   T MSLS       G+N+C+HY +  +M+ FVDCF++F++E
Sbjct: 478 RFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFMEE 534

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  216 bits (550), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 153/485 (31%), Positives = 243/485 (50%), Gaps = 47/485 (9%)

Query: 26  ETWSDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRV 85
           E W D +TL++ +        ++ A++ +I  +VE+  T+ +  +F  +  I+ DD++ +
Sbjct: 36  EEWGDDTTLLTLKDSRPTIAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNI 95

Query: 86  IEFQTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFD 143
           +EF +YKDE I CH+G PPY+ RHI + ++F  G  KPLW ++I D S+VIFH  ++LFD
Sbjct: 96  LEFDSYKDEKINCHNGCPPYLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFD 155

Query: 144 LFAAGNFHVRFQQALQRCEKNEP----HNETLFVYEGGPLQLPIDPDACSLPGVDVP--- 196
           +F+A NFH +          NEP     ++ +F  E    +  I+    S    D P   
Sbjct: 156 IFSAANFH-KLLLKETNIVANEPLDSSESDIIFSLENSIKK--INNLKLSKSIYDNPRIH 212

Query: 197 YPASSPFV------SFVKNVCRYAL-KPFGALAS-----AVTPSLRLNRSSLGRKPFLLT 244
            PA+SP +      SF K+V    + KP   L +      VT    L+R +  +K   + 
Sbjct: 213 LPATSPDLFNLQTQSFFKSVFHSTVKKPIHYLVANVRTKEVTSDNTLSRVTTVQKYTDIF 272

Query: 245 LDKESLYGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFS 304
               +L  TTV G +              + +C +SF+  I +L LKP I NF+GS+ FS
Sbjct: 273 DYNTTLNNTTVFGKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFS 332

Query: 305 IPLDLR---TESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPK 361
           I ++LR    ES+    FG   K +L+D PL+LIDD       N            N P 
Sbjct: 333 IVINLRPFLKESN--IEFGLFYKDVLIDVPLSLIDD-------NAVMLSGYRDFSDNDPD 383

Query: 362 FSEGLLEYQFKRVTT--------HVMKSLTAQTSGDWTGKRKYSKCQLRKK--KIIEINV 411
            +E +LE+QFKRVT+         + K  T   + D   + KY K     K  ++ + + 
Sbjct: 384 LTEKILEFQFKRVTSLVKDLIERRISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSE 443

Query: 412 VDMGTSP-SARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCF 470
           V +G+     ++ + N NFT SL    F S+S  L    G+N+C+ + +   M+ FV+CF
Sbjct: 444 VSLGSGKRDGKYILHNTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECF 503

Query: 471 QTFLD 475
           Q+F++
Sbjct: 504 QSFIE 508

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  216 bits (549), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/487 (31%), Positives = 242/487 (49%), Gaps = 51/487 (10%)

Query: 25  QETWSDS-STLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVV 83
           +E WSD  +TL++ +   L    ++ AL ++I++++E+ +T+ +  +F  + +I+  DV+
Sbjct: 36  KEGWSDEEATLLTVKDSRLCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVI 95

Query: 84  RVIEFQTYKDEAIACHDGIPPYVARHILNKSKF--EAGKPLWEVYIADGSMVIFHCHNVL 141
             I+F ++KDE I C  G PPY+ RHI N  +F   +GKPLW++Y+ D S+  FH  + L
Sbjct: 96  STIQFDSFKDEKINCQLGAPPYLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCL 155

Query: 142 FDLFAAGNFH-VRFQQALQRCEKNEPHNETLFVYEGGP------LQLP---IDPDACSLP 191
           FD+F+  NFH +  ++      + +   +  +V++ GP       QLP    D     +P
Sbjct: 156 FDVFSTANFHRLLLKEVNLLSSRPQKWKKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIP 215

Query: 192 GVDVPYPASSPFVSFVKNV-CRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESL 250
            ++ P   +    SF K++      KP   L +     L LN S++     L    K  L
Sbjct: 216 TLN-PDLFNLQTQSFFKSIYVNTVKKPIEFLTNTDVSFLSLN-SNMKYNDILDINSK--L 271

Query: 251 YGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLR 310
            G TV G ++             E +C++SF+  I +L LKP+++N  G++ FSIP+DLR
Sbjct: 272 CGNTVFGCVSNERFKYLNTIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLR 331

Query: 311 TESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQ 370
           +   +   FG   K I V+CPL+LIDD          SK        +   F E L+EYQ
Sbjct: 332 SFVDEPRDFGLYYKDIRVECPLSLIDD--------DKSKDCMKGASVSEEDFDEKLMEYQ 383

Query: 371 FKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKKIIE---------------------I 409
           FK +T  V   L  + +     K  ++   +R+ K  +                     I
Sbjct: 384 FKNITGFVRNHLEQRLTR--FSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLI 441

Query: 410 NVVDMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDC 469
           NV + G   S  F I+  N T SL SE  MSLS       G+N+C+HY E   M+ FV+C
Sbjct: 442 NVNEFGEPNS--FMIRACNLTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVEC 499

Query: 470 FQTFLDE 476
           FQ+FL+E
Sbjct: 500 FQSFLEE 506

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  208 bits (530), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 159/519 (30%), Positives = 251/519 (48%), Gaps = 74/519 (14%)

Query: 1   MRRCVQGCAMGRFLRSLNGFDRREQETWSDSSTLMSSRCGCLREHQISS----ALRSMIR 56
           + + ++G   G    S   F+++  E   D++TL + R   + E  + S    AL+++I 
Sbjct: 14  LAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYTGRS--VNEVSLKSVLCAALQNIIC 71

Query: 57  ENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKF 116
            +VE+  T+ D   F PV +IE +DV++ I +   KD+A+   D I   + RHI NK  F
Sbjct: 72  NHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKALM-KDQISDKLLRHIFNKCDF 130

Query: 117 E--AGKPLWEVYIADGSMVIFHCHNVLFDLFAAGNFH---------------------VR 153
           +   GKPLW+  IA+ S +IFH H+VLFD+F+  NF                        
Sbjct: 131 KPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNSNQKLKTVKTL 190

Query: 154 FQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPFVSFVKNVCRY 213
           F+   +R   N P +    +YE   L LP      +L    +     S F +  +N  + 
Sbjct: 191 FKFDAERSLTNYPRS----IYENPKLHLP------ALTSDLLNLQTQSFFKTIYQNTLK- 239

Query: 214 ALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDKESLYGTTVSGYLNXXXXXXXXXXXXX 273
             KP   + SA + +         R   +L+    SL G TV G ++             
Sbjct: 240 --KPIDLITSANSNNNNQLSEYRTRNTDILS-GANSLCGRTVLGEISLERYQHLKMLVEQ 296

Query: 274 EEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLA 333
           E + +RSF+ AIT++ LKP+++NFDGSI FSIP++LR+    ++ FG   K I V+CPL 
Sbjct: 297 ENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSLIADSSDFGLFYKNIKVECPLE 356

Query: 334 LIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGK 393
           LI+D   E  +  P      +        +  LLE QF+R++ HV   + +Q    W  K
Sbjct: 357 LIND---EKYYTNPEVLHSMQ--------NNSLLEIQFERISRHV-SDVISQRMKAWE-K 403

Query: 394 RKYSKCQLRKKK-----------IIEINVV-----DMGT-SPSARFQIKNMNFTDSLGSE 436
             ++   +++ K           II+IN V     D G  + S  F + N+NFT SL   
Sbjct: 404 FGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNFTKSLSCN 463

Query: 437 TFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
            FMSL  +     G+N+C+HY +  +M+ FV+CFQ+F++
Sbjct: 464 EFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIE 502

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  199 bits (506), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 152/480 (31%), Positives = 235/480 (48%), Gaps = 47/480 (9%)

Query: 29  SDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEF 88
           SD+ TL S     L +  I  AL  +I+E+ E+   V+   +F PV +I+++DVVR IEF
Sbjct: 46  SDNETLRSDMNQRLSDSMIWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEF 105

Query: 89  QTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFA 146
             Y DE + C++G+PPY+ RHI +K  F  G  +PLW++++ DG+MV+FH H+VLFD FA
Sbjct: 106 DCYADEQVNCYNGVPPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFA 165

Query: 147 AGNFHVRFQQAL----QRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGVDVPYPASS- 201
           A NFH  F QAL    + C    P      V++GG + LP  P A  L     P  ASS 
Sbjct: 166 AANFHKLFLQALNSLSESCTSPRP------VFKGGKI-LPTLPRA--LFQKQEPQAASSI 216

Query: 202 --PFVSFVKNVCR--YAL---KPFGALASAVTPSLRLNRSSLGRKPFLLTLD-KESLYGT 253
              F S  + + R  Y L   KP   + S      R+  S+         L+    L GT
Sbjct: 217 TDAFYSQSQAILRSLYNLAIKKPLRFIESG-----RIEHSTEQHSGTPEPLNYPNHLCGT 271

Query: 254 TVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTES 313
            V G ++              ++ +++F+ + TL  L+P++ + +  I FS+P++LR   
Sbjct: 272 VVFGTISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLI 331

Query: 314 HKTTPFGFQSKRILVDCPLALI---DDRVFESLFNRPSKQRKTKL-DKNSPKFSEGLLEY 369
             ++P G   + +L++CPL       +    S  + P       L D N     +   E 
Sbjct: 332 PWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPES 391

Query: 370 QFKRVTTHVMKSLTAQTSGDWTGKRK---YSKCQLRKK--------KIIEIN---VVDMG 415
            F+R  THV   L        TGK K     K +   K        KIIEIN    +D+ 
Sbjct: 392 LFERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLS 451

Query: 416 TSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
               +++ ++++  T S  + TFMS+S +     G+N+ +HY E   M+ FV+ F+ FL+
Sbjct: 452 NVNPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLE 511

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  192 bits (487), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 135/452 (29%), Positives = 220/452 (48%), Gaps = 32/452 (7%)

Query: 50  ALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARH 109
           AL  +I+EN E+  ++    +F  +  I +DDVVR IEF    DE ++C++G+PPY+ RH
Sbjct: 67  ALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRH 126

Query: 110 ILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRFQQALQRCEKNEPH 167
           I +K  F  G  KPLW+V++ D SMV+FH H+VLFD FAA  FH  F +AL    +N   
Sbjct: 127 IFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNSF-RNVKG 185

Query: 168 NETLFVYEGGPLQLPIDPDACSLPGVDVPYPASSPFVSF----VKNVCRYAL-KPFGALA 222
            ++  +++     +P+     +   V +        +++    +KN+   A+ KP   + 
Sbjct: 186 QKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTYSQTALKNLYSLAIKKPLRFIE 245

Query: 223 SAVTPSLRLNRSSL-GRKPFLLTLDKESLYGTTVSGYLNXXXXXXXXXXXXXEEVCVRSF 281
           S      RL  S +    P+ L      L GT V G +N              ++  RSF
Sbjct: 246 SG-----RLEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSF 300

Query: 282 LCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALIDDRVFE 341
           + ++T+  L P++   +  I FS+P++LR      +  G     +L +CPL LI   +  
Sbjct: 301 IISVTMFCLLPVLEPSEEKIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEP 360

Query: 342 ----SLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKRVTTHVMKSL--------TAQTSGD 389
               S FN+   +  T  D       +   +  F+R+ THV   L         + +SG+
Sbjct: 361 CSGISTFNQEFLEGSTLTDVGGVNEDQNDPQTVFRRILTHVTTELELAAMRLEKSHSSGE 420

Query: 390 WTGKRKYSK---CQLRKKKIIEIN---VVDMGTSPSARFQIKNMNFTDSLGSETFMSLSC 443
              K +          + KI+EIN    VD+ +   +R++I ++  T S  S+TFMS+S 
Sbjct: 421 DLIKAEREARYFAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISY 480

Query: 444 ALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
                 G+N+ +HY E  +M+ FV+ F+ FLD
Sbjct: 481 CSSEISGLNLGIHYSEGFNMEYFVESFEGFLD 512

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  174 bits (441), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 134/479 (27%), Positives = 224/479 (46%), Gaps = 45/479 (9%)

Query: 33  TLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYK 92
           TL+S +   L    I+  L+ +I +++E+   +++  +++ V+ I   DV+ +I F + K
Sbjct: 47  TLVSLKDRRLTLSVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEK 106

Query: 93  DEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNF 150
           DE I CH G PPY+ RHI NKS F+ G  KPLW++YI D + +IFH  ++LFD F+A  F
Sbjct: 107 DERINCHLGPPPYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYF 166

Query: 151 HVRFQQALQRCEKNEPHNETLFVYEGGPL----QLPIDPDACSLPGVDVPYPA----SSP 202
           H  F       E N   +  +   +  PL    QL    D   +   ++P       SSP
Sbjct: 167 HKCF-----LAEVNSYMSSIVSSKQKKPLDYLFQLSSSADLIKIYD-EIPRSIYDYDSSP 220

Query: 203 FVSFVKNVCRYALKPFGA---LASAVTPSLRLNRSSLGRKPFLLTLDKE----------- 248
           F      +     K F     L +   P   +  +S   K +    + E           
Sbjct: 221 FAPLTAVMFNDQTKSFFKSLYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIH 280

Query: 249 -SLYGTTVSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPL 307
            SL G T+ G ++             E++ ++S +C + ++SLKP + +F  ++ FSI +
Sbjct: 281 RSLCGNTIFGTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRV 340

Query: 308 DLRTESHKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLL 367
           +LR +  K+  FG   + I+++CPL+LIDDR  +    R        +     +  E + 
Sbjct: 341 NLRDDVSKSKTFGLYYRDIIIECPLSLIDDRAIQFSGYRD----HVGITAQELETYEKVY 396

Query: 368 EYQFKRVTTHVMKSLTA-----QTSGDWTGKRKYSKCQLRKKKIIEIN---VVDMGTSPS 419
           E QFK VTT++   +       +T  D    +        K +II+IN    +D+  + S
Sbjct: 397 EQQFKDVTTYIQNVMNEKIGYWKTDNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLS 456

Query: 420 AR--FQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDE 476
               + +K+ +   SL  +   S+S       G+ + +H  +  SM+ FV+ FQ FLDE
Sbjct: 457 QNDPYCVKSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLDE 515

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  162 bits (409), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 134/495 (27%), Positives = 226/495 (45%), Gaps = 83/495 (16%)

Query: 29  SDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEF 88
           SD +TL+SS+   L    +S AL+ +I  ++EM  T+    +F  + +I   DV+  I F
Sbjct: 49  SDDATLLSSKDKPLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICF 108

Query: 89  QTYKDEAIACHDGIPPYVARHILNKSKFE--AGKPLWEVYIADGSMVIFHCHNVLFDLFA 146
           +  KDE + CH G PPY+  +I +   F+  + KPLW+++I + S+V+F+  + LFD+FA
Sbjct: 109 ENKKDELVNCHSGAPPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFA 168

Query: 147 AGNFHVRFQQALQRC--EKNEPHNETLF----------------VYEGGPLQLP-IDPDA 187
             NF     + +     E  E  ++ +F                +Y+   L LP   P+ 
Sbjct: 169 VANFIKLLFEIINSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPEL 228

Query: 188 CSLPGVDVPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDK 247
            +L          S F S   N  +   K F  L       + L R+    K +   L  
Sbjct: 229 FNL-------QTQSFFKSIYLNTFK---KSFDYLNFTQQTPIILARNHNISKNYNEILHL 278

Query: 248 ESLYGTT-VSGYLNXXXXXXXXXXXXXEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIP 306
            S+  +  V+G ++             E++ ++SF C+I ++ LK +I  FDGSI F IP
Sbjct: 279 NSIVKSELVTGNVSMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIP 338

Query: 307 LDLRT-------ESHKTTP--------FGFQSKRILVDCPLALIDDRVFESLFNRPSKQR 351
            +LR+       E+H ++          G   K I V+ PL LI     E + N      
Sbjct: 339 YNLRSMQNLRDKENHNSSSGPEDSANELGIIYKDIYVEVPLKLI-----EKIGN------ 387

Query: 352 KTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKK------ 405
                       E ++E QFK V  ++ +S+  +    W  K  ++   +++ K      
Sbjct: 388 ------------EDVVEEQFKIVCNYINESIQKRIKA-WE-KNGFNDDDIKRMKFGYEQV 433

Query: 406 --IIEIN---VVDMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLER 460
             IIE+N    +D+  S  + F I++++ T +L     +SLS A     G+N+C++Y   
Sbjct: 434 GNIIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTE 493

Query: 461 DSMDMFVDCFQTFLD 475
             M  F+DCFQ+F++
Sbjct: 494 YKMKDFIDCFQSFME 508

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  107 bits (267), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 110/215 (51%), Gaps = 30/215 (13%)

Query: 276 VCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTESHKTTPFGFQSKRILVDCPLALI 335
           +C+RS +C I +L  KP I+NFDG+I FSI +D++     ++ FG   K I+VDCPL LI
Sbjct: 46  ICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPIVDDSSQFGILKKNIIVDCPLKLI 105

Query: 336 DDRVFESLFNRPSKQRKTKLDKNSPKFSEG-LLEYQFKRVTTHVMKSLTAQTSGDWTGKR 394
           DD+ ++              D +S     G +LE QF++VT  V + L+ +         
Sbjct: 106 DDKHYK--------------DTDSESIKNGDILEIQFRKVTDFVTEELSNKLQS-MAKHF 150

Query: 395 KYSKC---------QLRKKKIIEIN-VVDMGTSPSAR----FQIKNMNFTDSLGSETFMS 440
           K + C         Q+   K+I+IN + D+  + + +    +   ++  T+ L     MS
Sbjct: 151 KRNNCPFNFSSINSQISDSKVIQINDLTDIPFTTTEQNPNGYSFHDLKVTEGLSPNESMS 210

Query: 441 LSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLD 475
           LS        M++ +HY E   MD FV+CF+TF++
Sbjct: 211 LSYITNSNSAMSISIHYTETKYMDSFVECFRTFIE 245

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 56/127 (44%), Gaps = 17/127 (13%)

Query: 77  IEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFEAG--KPLWEVYIA-DGSMV 133
           I++DDVV  +++ TY +E I             +  K  FE G  KPLW+V +    + +
Sbjct: 73  IKFDDVVDYMDWDTYGEEEI-----------NSVFRKYNFEYGVDKPLWKVIVVPKANKM 121

Query: 134 IFHCHNVLFDLFAAGNFHVRFQQALQRCEKNEPHNETLFVYEGGPLQLPIDPDACSLPGV 193
           IF   ++ FD  A   F     ++L+  +++   +    +Y  G     I  D C  P  
Sbjct: 122 IFATDHLFFDGIATVLFWTELLKSLEELKQDNDLDVDEIIYRPGGSTDSI--DQCH-PYE 178

Query: 194 DVPYPAS 200
            +P P S
Sbjct: 179 KLPIPFS 185

>TDEL0E05110 Chr5 (941876..943285) [1410 bp, 469 aa] {ON} Anc_5.119
           YGR212W
          Length = 469

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 62/144 (43%), Gaps = 21/144 (14%)

Query: 44  EHQISSALRSMIRENVEMCVTVTDGPK-----FAPVSRIEYDDVVRVIEFQTYKDEAIAC 98
           +HQI+ ALRS I  + ++   V   P+        V  I++DDVV  + +  + D  I  
Sbjct: 38  KHQIAHALRSTIANHPKLHQNVAIDPEDNIPYIKNVDTIKFDDVVEYVSWDGFDDNTIC- 96

Query: 99  HDGIPPYVARHILNKSKF--EAGKPLWEVYI-ADGSMVIFHCHNVLFDLFAAGNFHVRFQ 155
                     HI     F     KPLW+V + A  + ++    + LFD  +A  F   F 
Sbjct: 97  ----------HIFQTYNFPYNIEKPLWKVLVYAKENRLLLLLDHALFDGMSAVIFWKSFM 146

Query: 156 QALQRCEKNEPHNETLFVYEGGPL 179
            +L    +++   + L+   G P+
Sbjct: 147 SSLSSDARDD--FDLLYELTGDPM 168

>KNAG0J01320 Chr10 complement(238704..240422) [1719 bp, 572 aa] {ON}
           Anc_7.368 YER087W
          Length = 572

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 19/104 (18%)

Query: 18  NGFDRREQETWSDSSTLMSSRCGCLREHQISSALRSMIREN----VEMCVTVTDGPKFAP 73
           NG D R  +   + S   S R   +++   SS L S I+ +    + +C+ +  G K  P
Sbjct: 452 NGTDERVLKVVENLSQSKSLRDDIMQDFSNSSGLGSKIQTSHALGIPLCIII--GSKSWP 509

Query: 74  VSRIEYDDVVRVIEFQTYKDEAIACHDGIPPYVARHILNKSKFE 117
              IE    VR   +         C DG P ++  H  NKSKF+
Sbjct: 510 RVEIE----VRGKRW---------CEDGEPAWIQEHERNKSKFD 540

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,214,948
Number of extensions: 2015881
Number of successful extensions: 4394
Number of sequences better than 10.0: 26
Number of HSP's gapped: 4432
Number of HSP's successfully gapped: 30
Length of query: 478
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 365
Effective length of database: 40,524,141
Effective search space: 14791311465
Effective search space used: 14791311465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)