Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR017W6.9ON42342322580.0
Ecym_30126.9ON39739313610.0
SAKL0E00814g6.9ON39838512451e-170
NDAI0K029006.9ON43838911871e-161
Kpol_1045.786.9ON39237811791e-160
ZYRO0F00462g6.9ON39337211521e-156
KLLA0D00814g6.9ON40840011531e-156
KLTH0C11550g6.9ON39838111491e-155
TDEL0G046206.9ON39236911461e-155
NCAS0F001906.9ON41137711401e-154
Suva_5.126.9ON40140011361e-153
Skud_5.336.9ON40138511231e-152
KNAG0E009806.9ON41438211151e-150
YEL056W (HAT2)6.9ON40139711131e-150
Smik_5.316.9ON42739811151e-150
Kwal_56.223456.9ON39638110911e-147
TPHA0M001906.9ON39138310611e-142
CAGL0B03575g6.9ON41937710631e-142
KAFR0L003206.9ON39138510181e-136
TBLA0A071206.9ON4073829821e-130
TBLA0H036508.548ON4194283564e-37
Kwal_27.120708.548ON4184073531e-36
KLTH0E12694g8.548ON4184103381e-34
AEL250C8.548ON4174103372e-34
SAKL0H09900g8.548ON4254073329e-34
Ecym_70428.548ON4144063283e-33
YBR195C (MSI1)8.548ON4224223231e-32
Smik_2.3358.548ON4224203232e-32
NDAI0C055108.548ON4194133203e-32
Kpol_1024.398.548ON4174093152e-31
Skud_2.3218.548ON4224223134e-31
KAFR0I008408.548ON4134103109e-31
ZYRO0A13068g8.548ON3974053072e-30
TPHA0L017208.548ON4194103063e-30
KLLA0E23541g8.548ON4174053038e-30
NCAS0B021708.548ON4144112922e-28
KNAG0A036708.548ON4264182932e-28
Suva_4.4498.548ON4244242923e-28
TDEL0B029808.548ON4124072871e-27
CAGL0M05291g8.548ON4194132871e-27
NCAS0G011206.276ON4941702076e-17
TDEL0A068906.276ON4472191933e-15
Suva_13.3112.401ON5103981891e-14
TDEL0G033402.401ON5143971854e-14
CAGL0K03861g2.401ON5133941836e-14
Skud_13.2912.401ON5093971836e-14
NDAI0F012406.276ON5241671837e-14
KAFR0A003802.401ON5164011837e-14
Kpol_1060.246.276ON4861941828e-14
CAGL0H00781g6.276ON5132651765e-13
Sklu_YGOB_Anc_2.4012.401ON5203981765e-13
TPHA0G026502.401ON5163971749e-13
TPHA0D035906.276ON5983331741e-12
Smik_13.3292.401ON5093971731e-12
ZYRO0A08690g2.401ON5164011712e-12
KLLA0F17237g2.401ON5233961712e-12
Kwal_47.178272.401ON5233961703e-12
Kpol_1041.202.401ON5153951703e-12
YMR131C (RRB1)2.401ON5114001693e-12
Ecym_21396.276ON4352681675e-12
ZYRO0E08184g6.276ON5061901669e-12
KLTH0E09394g2.401ON5223981661e-11
ADR242C2.401ON5213971651e-11
TBLA0B092502.401ON5263021641e-11
NDAI0H027502.401ON5124001642e-11
YPL247C6.276ON5231661642e-11
Smik_6.4516.276ON5231661632e-11
KAFR0F010606.276ON5531601623e-11
NCAS0F019702.401ON5113991604e-11
Skud_16.326.276ON5221671605e-11
KNAG0E021802.401ON5173971571e-10
Ecym_25236.363ON6462881571e-10
SAKL0A00660g6.363ON6603011543e-10
Kwal_23.63246.340ON5142641533e-10
Suva_16.606.276ON5261681533e-10
SAKL0A02970g6.276ON4152971524e-10
Ecym_60672.401ON5222381525e-10
KLLA0E08449g2.283ON4222461515e-10
Kwal_33.151365.201ON4731541516e-10
Ecym_24986.340ON5422761516e-10
KLTH0B03410g5.201ON4771261491e-09
KNAG0D007406.276ON5041601491e-09
KLTH0A06754g6.340ON5142761491e-09
ZYRO0D08206g6.340ON5152701481e-09
AFL157C6.276ON4382731481e-09
AAL157C5.201ON4791371472e-09
TPHA0E030805.201ON4881261472e-09
KLLA0F15598g5.201ON4781531472e-09
Kpol_1048.598.544ON8502031472e-09
YPL151C (PRP46)8.672ON4512141462e-09
KAFR0F043506.340ON5152641462e-09
TDEL0H003707.534ON4652181463e-09
Suva_16.1598.672ON4512131453e-09
TDEL0A075506.340ON5152701463e-09
TDEL0A061808.672ON4342011453e-09
TDEL0E042805.201ON4811271453e-09
Skud_16.1318.672ON4512131444e-09
TPHA0G016108.672ON4142011444e-09
NCAS0D046106.340ON5151821445e-09
YCR072C (RSA4)6.340ON5152731445e-09
SAKL0A01276g6.340ON5152721445e-09
CAGL0D05588g5.201ON4771261435e-09
Suva_3.1096.340ON5152761436e-09
TPHA0M018306.340ON5152651436e-09
ADR090W7.310ON12332561447e-09
KLTH0H02772g6.276ON4202531427e-09
KNAG0I028406.340ON5192771427e-09
Kpol_2002.995.201ON4871371428e-09
CAGL0J03476g6.340ON5172701428e-09
TDEL0C023607.310ON12643331439e-09
Smik_3.1726.340ON5152731411e-08
TBLA0F041306.340ON5142801411e-08
Ecym_8044na 1ON3111671381e-08
KLTH0H02134g7.310ON12992641421e-08
KAFR0J009805.201ON4801261401e-08
Skud_4.637.310ON12732161412e-08
Smik_6.3488.672ON4512101392e-08
SAKL0G12892g5.201ON4761531392e-08
TBLA0A023106.276ON5311901392e-08
NCAS0D027305.201ON4751261392e-08
YNL035C2.283ON3891841382e-08
Suva_10.645.201ON4901261392e-08
KLLA0F10263g6.363ON6822831392e-08
Kwal_23.64296.363ON7502951392e-08
TDEL0F044308.316ON3672791372e-08
Skud_3.1456.340ON5152731382e-08
Smik_12.525.201ON4891261383e-08
KLLA0F19734g8.288ON11331441393e-08
AER263C6.340ON5132701373e-08
KLLA0C08547g6.340ON5152761373e-08
KLTH0A07282g6.363ON7252891373e-08
Kwal_56.236858.288ON11021421384e-08
CAGL0M08646g5.631ON3372361344e-08
NDAI0I003506.340ON5151821365e-08
TPHA0C008608.316ON3782621355e-08
AGL190W8.316ON3702731346e-08
Suva_14.3112.283ON3891851346e-08
ZYRO0F07282g8.672ON4272011347e-08
KNAG0I009208.316ON3813161338e-08
Kpol_1028.416.340ON5122751348e-08
YLL011W (SOF1)5.201ON4891261348e-08
Skud_14.2982.283ON3891831339e-08
KLLA0E04093g8.316ON3722831329e-08
Skud_12.565.201ON4891261331e-07
Ecym_71055.201ON4841261321e-07
AEL269C7.534ON4551731321e-07
Suva_4.537.310ON12711891331e-07
Kpol_1019.307.310ON12522721331e-07
NDAI0I021805.201ON4791261311e-07
Smik_4.457.310ON12702161331e-07
KLTH0G12430g8.316ON3672941302e-07
NDAI0G038303.25ON5101481312e-07
ACR137W8.672ON4252141312e-07
ZYRO0B10450g5.201ON4821261312e-07
KLLA0E21187g5.429ON4291801312e-07
SAKL0H06666g8.672ON4412221312e-07
SAKL0H15708g8.316ON3682941302e-07
ADL184W3.25ON4491511302e-07
KAFR0H024508.672ON4172181293e-07
KAFR0E012303.259ON3691591293e-07
Kwal_56.243326.276ON4181801293e-07
Ecym_80617.310ON12282631303e-07
KNAG0J016808.672ON3982031283e-07
NDAI0G006302.283ON3971831283e-07
NCAS0C044503.25ON4612201284e-07
KAFR0L013207.310ON12401861294e-07
KAFR0H033402.283ON3671331274e-07
TBLA0H020005.201ON4731261284e-07
KLTH0G10296g2.283ON4261981284e-07
CAGL0M04081g3.25ON4551701284e-07
AAR078W7.356ON5621771284e-07
SAKL0F10010gna 1ON3341561264e-07
NCAS0B035508.316ON3752811274e-07
TBLA0F021407.310ON13002551295e-07
TPHA0C033702.283ON4131821275e-07
Kwal_56.238958.316ON3672931265e-07
ZYRO0F05808g7.310ON12822221286e-07
Kwal_55.220673.25ON4512231266e-07
KLLA0D07546g8.67ON6472781276e-07
NCAS0J011104.122ON5951941276e-07
CAGL0B01529g8.316ON3692711257e-07
TDEL0F022304.122ON5561941267e-07
YDL195W (SEC31)7.310ON12732171277e-07
KLTH0A00880g7.534ON4712031267e-07
NCAS0B036908.288ON11451291268e-07
Kwal_56.244787.310ON12962551269e-07
KNAG0M017505.201ON4851261259e-07
Ecym_42498.316ON3742481241e-06
Smik_13.2772.469ON5131811251e-06
Suva_5.178na 2ON3222351231e-06
TBLA0B087303.25ON4611481241e-06
TDEL0A077806.363ON6573031251e-06
Smik_14.2962.283ON3891831231e-06
Kwal_47.175674.122ON5901951241e-06
NDAI0E024008.672ON4342191231e-06
Ecym_20263.25ON4511511232e-06
Suva_4.997.322ON12012371242e-06
Kpol_1036.658.316ON3712441222e-06
KNAG0A012303.22ON13211941242e-06
TPHA0I018808.544ON10342261242e-06
Skud_4.1097.322ON12012371242e-06
Kwal_26.87768.672ON4331441222e-06
KAFR0L013907.322ON12062341232e-06
Smik_4.907.322ON12012611232e-06
Kpol_1028.236.363ON7442841232e-06
CAGL0M05335g8.544ON8062461232e-06
KNAG0I010508.288ON11591291232e-06
KLTH0H02508gna 1ON3091681202e-06
KNAG0B027207.322ON12042441223e-06
NDAI0J018504.122ON5752161213e-06
KLTH0F19294g3.25ON4512121203e-06
KLTH0G13068g8.288ON11011281213e-06
ZYRO0B02486g7.356ON5751601213e-06
NCAS0D047806.363ON6212461213e-06
Kwal_27.115502.283ON4071841204e-06
KAFR0C047406.363ON6652881214e-06
TBLA0G014904.122ON7322161214e-06
YDL145C (COP1)7.322ON12012611214e-06
Ecym_55285.429ON4711891204e-06
TBLA0B059202.283ON4031801194e-06
SAKL0F11506g7.356ON5681691204e-06
Kpol_1003.342.283ON388871195e-06
SAKL0H22396g4.122ON5551941195e-06
NDAI0A020907.322ON12002361205e-06
ZYRO0D17292g6.363ON7183241205e-06
SAKL0C13266g3.25ON4591501195e-06
NCAS0C016808.672ON4312011186e-06
SAKL0F10384g7.310ON12612711206e-06
NCAS0A151707.534ON4741731186e-06
KAFR0L015207.356ON5842091187e-06
TBLA0C018408.672ON4232011177e-06
Suva_14.223.25ON4692191177e-06
YMR093W (UTP15)2.469ON5131811178e-06
Ecym_33212.283ON4091941178e-06
KLLA0F11231g8.672ON4341441179e-06
Kwal_56.24399na 1ON3691661169e-06
CAGL0M02277g8.672ON4271441161e-05
CAGL0C03608g6.363ON6432661171e-05
Kpol_530.257.356ON5741671171e-05
Kpol_2001.657.322ON12062411171e-05
NCAS0A139407.322ON12052331171e-05
Kwal_56.245267.322ON12102491171e-05
KLLA0E07085g3.25ON4521631161e-05
NCAS0G043001.534ON7251671161e-05
NCAS0G036001.399ON3272431151e-05
ZYRO0G10472g4.122ON5601761161e-05
TDEL0G021402.283ON3921181151e-05
CAGL0A00605g4.122ON6402241161e-05
TDEL0A004403.25ON4512361151e-05
KLTH0E12606g8.544ON7552451152e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR017W
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   874   0.0  
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   528   0.0  
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   484   e-170
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     461   e-161
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   458   e-160
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   448   e-156
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   448   e-156
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   447   e-155
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   446   e-155
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   443   e-154
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   442   e-153
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   437   e-152
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   434   e-150
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   433   e-150
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   434   e-150
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   424   e-147
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   413   e-142
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   414   e-142
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   396   e-136
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   382   e-130
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   141   4e-37
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   140   1e-36
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   134   1e-34
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   134   2e-34
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   132   9e-34
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   130   3e-33
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   129   1e-32
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   129   2e-32
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   127   3e-32
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   125   2e-31
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   125   4e-31
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   124   9e-31
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   122   2e-30
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   122   3e-30
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   121   8e-30
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   117   2e-28
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   117   2e-28
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   117   3e-28
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   115   1e-27
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   115   1e-27
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    84   6e-17
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    79   3e-15
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    77   1e-14
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    76   4e-14
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    75   6e-14
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    75   6e-14
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    75   7e-14
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    75   7e-14
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    75   8e-14
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    72   5e-13
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    72   5e-13
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    72   9e-13
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    72   1e-12
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    71   1e-12
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    70   2e-12
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    70   2e-12
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    70   3e-12
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    70   3e-12
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    70   3e-12
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    69   5e-12
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    69   9e-12
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    69   1e-11
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    68   1e-11
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    68   1e-11
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    68   2e-11
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    68   2e-11
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    67   2e-11
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    67   3e-11
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    66   4e-11
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    66   5e-11
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    65   1e-10
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    65   1e-10
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    64   3e-10
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    64   3e-10
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    64   3e-10
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    63   4e-10
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    63   5e-10
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    63   5e-10
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    63   6e-10
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    63   6e-10
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    62   1e-09
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    62   1e-09
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    62   1e-09
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    62   1e-09
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    62   1e-09
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    61   2e-09
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    61   2e-09
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    61   2e-09
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    61   2e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    61   2e-09
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    61   2e-09
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    61   3e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    60   3e-09
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    61   3e-09
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    60   3e-09
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    60   3e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    60   4e-09
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    60   4e-09
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     60   5e-09
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    60   5e-09
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    60   5e-09
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    60   5e-09
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    60   6e-09
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    60   6e-09
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    60   7e-09
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    59   7e-09
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    59   7e-09
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    59   8e-09
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    59   8e-09
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    60   9e-09
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    59   1e-08
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    59   1e-08
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    58   1e-08
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    59   1e-08
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    59   1e-08
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    59   2e-08
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    58   2e-08
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    58   2e-08
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    58   2e-08
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     58   2e-08
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    58   2e-08
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    58   2e-08
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    58   2e-08
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    58   2e-08
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    57   2e-08
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    58   2e-08
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    58   3e-08
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    58   3e-08
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    57   3e-08
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    57   3e-08
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    57   3e-08
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    58   4e-08
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    56   4e-08
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       57   5e-08
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    57   5e-08
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    56   6e-08
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    56   6e-08
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    56   7e-08
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    56   8e-08
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    56   8e-08
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    56   8e-08
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    56   9e-08
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    55   9e-08
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    56   1e-07
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    55   1e-07
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    55   1e-07
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    56   1e-07
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    56   1e-07
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    55   1e-07
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    56   1e-07
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    55   2e-07
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      55   2e-07
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    55   2e-07
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    55   2e-07
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    55   2e-07
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    55   2e-07
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    55   2e-07
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    55   2e-07
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    54   3e-07
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    54   3e-07
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    54   3e-07
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    55   3e-07
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    54   3e-07
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    54   3e-07
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      54   4e-07
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    54   4e-07
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    54   4e-07
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    54   4e-07
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    54   4e-07
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    54   4e-07
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    54   4e-07
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    53   4e-07
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    54   4e-07
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    54   5e-07
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    54   5e-07
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    53   5e-07
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    54   6e-07
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    53   6e-07
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    54   6e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              54   6e-07
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    53   7e-07
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    53   7e-07
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    54   7e-07
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    53   7e-07
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    53   8e-07
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    53   9e-07
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    53   9e-07
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    52   1e-06
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    53   1e-06
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    52   1e-06
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    52   1e-06
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    53   1e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    52   1e-06
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    52   1e-06
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     52   1e-06
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    52   2e-06
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    52   2e-06
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    52   2e-06
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    52   2e-06
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    52   2e-06
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    52   2e-06
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    52   2e-06
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    52   2e-06
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    52   2e-06
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    52   2e-06
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    52   2e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    52   2e-06
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    51   2e-06
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    52   3e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    51   3e-06
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    51   3e-06
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    51   3e-06
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    51   3e-06
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     51   3e-06
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    51   4e-06
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    51   4e-06
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    51   4e-06
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    51   4e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    51   4e-06
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    50   4e-06
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    51   4e-06
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    50   5e-06
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    50   5e-06
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    51   5e-06
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    51   5e-06
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    50   5e-06
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     50   6e-06
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    51   6e-06
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    50   6e-06
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    50   7e-06
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    50   7e-06
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    50   7e-06
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    50   8e-06
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    50   8e-06
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    50   9e-06
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    49   9e-06
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    49   1e-05
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    50   1e-05
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    50   1e-05
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    50   1e-05
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    50   1e-05
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    50   1e-05
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    49   1e-05
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    49   1e-05
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    49   1e-05
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    49   1e-05
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    49   1e-05
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    49   1e-05
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    49   1e-05
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    49   2e-05
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    49   2e-05
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    49   2e-05
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    49   2e-05
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    49   2e-05
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    49   2e-05
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    49   2e-05
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    49   2e-05
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    49   2e-05
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    49   2e-05
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    48   2e-05
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    49   2e-05
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    49   3e-05
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    49   3e-05
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    48   3e-05
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    49   3e-05
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    48   3e-05
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    48   3e-05
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    48   3e-05
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    48   3e-05
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    48   4e-05
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    48   4e-05
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    47   4e-05
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    48   4e-05
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    48   4e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    48   4e-05
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    47   4e-05
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    48   4e-05
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    48   4e-05
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    48   4e-05
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    47   4e-05
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    47   4e-05
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    47   4e-05
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    48   4e-05
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    48   5e-05
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    47   5e-05
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    47   5e-05
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    47   5e-05
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    47   5e-05
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    47   5e-05
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    48   5e-05
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    48   5e-05
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    47   5e-05
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    47   5e-05
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    47   5e-05
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    47   5e-05
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    47   5e-05
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    47   6e-05
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    47   6e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    47   6e-05
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    47   6e-05
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    47   6e-05
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    47   6e-05
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    47   6e-05
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    47   7e-05
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    47   7e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    47   7e-05
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    47   7e-05
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    47   7e-05
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     47   8e-05
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    46   8e-05
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    47   8e-05
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    47   9e-05
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    47   9e-05
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    47   9e-05
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    47   1e-04
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    46   1e-04
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    46   1e-04
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    46   1e-04
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    46   1e-04
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      46   1e-04
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    46   1e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    46   1e-04
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    46   1e-04
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    46   1e-04
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    46   1e-04
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    46   1e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    46   1e-04
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    46   1e-04
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    46   1e-04
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    45   2e-04
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    45   2e-04
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    46   2e-04
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    46   2e-04
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    46   2e-04
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    45   2e-04
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     45   2e-04
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    46   2e-04
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    46   2e-04
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    45   2e-04
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    46   2e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    45   2e-04
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    45   2e-04
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    45   2e-04
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    45   2e-04
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             45   2e-04
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             45   2e-04
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    45   2e-04
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    45   2e-04
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    45   2e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    45   2e-04
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    45   2e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    45   2e-04
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    45   3e-04
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    45   3e-04
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    45   3e-04
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    45   3e-04
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    45   3e-04
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    45   3e-04
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    45   3e-04
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    45   3e-04
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    45   4e-04
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    45   4e-04
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    45   4e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    45   4e-04
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    45   4e-04
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    45   4e-04
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    45   4e-04
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    45   4e-04
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    45   4e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    45   4e-04
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    45   4e-04
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    44   4e-04
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    45   4e-04
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    44   4e-04
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    44   4e-04
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    45   4e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   4e-04
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    44   5e-04
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    44   5e-04
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    44   5e-04
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    44   5e-04
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      44   5e-04
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    44   5e-04
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    44   5e-04
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    44   5e-04
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    44   5e-04
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    44   5e-04
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    44   6e-04
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    44   6e-04
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    44   6e-04
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    44   7e-04
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    44   7e-04
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    44   7e-04
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    44   7e-04
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    43   7e-04
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    44   7e-04
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    44   7e-04
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    43   8e-04
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    44   8e-04
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    44   8e-04
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    44   8e-04
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    44   8e-04
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    44   8e-04
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    43   9e-04
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    44   9e-04
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    44   9e-04
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    43   0.001
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    43   0.001
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    44   0.001
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    44   0.001
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    44   0.001
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    43   0.001
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      43   0.001
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    43   0.001
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    43   0.001
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    43   0.001
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    43   0.001
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    43   0.001
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    43   0.001
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    43   0.001
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    43   0.001
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    43   0.001
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    43   0.001
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    43   0.001
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    43   0.001
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    43   0.001
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    43   0.001
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    42   0.001
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    43   0.001
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    43   0.001
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    43   0.002
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    43   0.002
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    42   0.002
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    43   0.002
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    43   0.002
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    42   0.002
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    43   0.002
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       42   0.002
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    42   0.002
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    42   0.002
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    42   0.002
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    43   0.002
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    42   0.002
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    42   0.002
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    42   0.002
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    42   0.002
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    42   0.002
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    42   0.002
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    42   0.002
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    42   0.002
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    42   0.002
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    42   0.002
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    42   0.002
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    42   0.003
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    42   0.003
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               42   0.003
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    42   0.003
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    42   0.003
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    42   0.003
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    42   0.003
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    42   0.003
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    41   0.003
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    42   0.003
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    42   0.003
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    42   0.003
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    42   0.003
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    41   0.004
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    42   0.004
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    42   0.004
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    42   0.004
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    41   0.004
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    41   0.004
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    41   0.004
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    41   0.004
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    41   0.004
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    41   0.005
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    41   0.005
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    41   0.005
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    41   0.005
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    41   0.005
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    41   0.005
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    41   0.005
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    41   0.005
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    41   0.005
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    41   0.005
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    41   0.005
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    41   0.006
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    41   0.006
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    41   0.006
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    41   0.006
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    41   0.006
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    40   0.007
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    40   0.007
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    40   0.007
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    40   0.007
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    41   0.007
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    40   0.007
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    41   0.007
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    40   0.007
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    40   0.007
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    40   0.007
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    40   0.007
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    40   0.007
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    40   0.007
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    40   0.008
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    40   0.008
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    40   0.008
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    40   0.008
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    40   0.009
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    40   0.009
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    40   0.009
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    40   0.009
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    40   0.009
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    40   0.009
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    40   0.009
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    40   0.010
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    40   0.010
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    40   0.010
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    40   0.011
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    40   0.011
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    40   0.011
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    40   0.012
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    39   0.012
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    40   0.012
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    40   0.012
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      39   0.012
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    40   0.012
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    40   0.013
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    40   0.013
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    40   0.013
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    40   0.013
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    39   0.014
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    40   0.015
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    40   0.015
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    40   0.015
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    40   0.015
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    39   0.016
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    39   0.017
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    39   0.017
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    39   0.017
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    39   0.017
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    39   0.017
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    40   0.017
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    39   0.018
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    39   0.018
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    39   0.018
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    39   0.018
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    39   0.019
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    39   0.019
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    39   0.019
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    39   0.020
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    39   0.022
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    39   0.022
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    39   0.022
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    39   0.022
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    39   0.023
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    39   0.023
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    39   0.024
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    39   0.024
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    39   0.025
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    39   0.025
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    39   0.025
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    39   0.027
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    38   0.028
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    38   0.028
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    39   0.029
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    39   0.029
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    39   0.029
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    38   0.030
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    39   0.030
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    39   0.032
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    39   0.034
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    38   0.034
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    38   0.034
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    38   0.034
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    38   0.035
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    38   0.036
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    38   0.036
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    39   0.036
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    38   0.038
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               38   0.040
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    38   0.042
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    38   0.043
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    38   0.043
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    38   0.043
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    38   0.044
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    38   0.044
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    38   0.044
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    38   0.045
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    38   0.045
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    38   0.046
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    38   0.046
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    38   0.046
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    38   0.046
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    38   0.046
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    37   0.048
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    38   0.048
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    38   0.048
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    38   0.050
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    38   0.053
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    38   0.054
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    38   0.059
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    37   0.059
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    37   0.059
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    37   0.059
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    37   0.059
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    38   0.060
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    37   0.060
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    38   0.060
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    37   0.062
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    37   0.062
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    38   0.063
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    37   0.065
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    37   0.066
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    37   0.067
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    38   0.070
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     37   0.071
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    37   0.071
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    37   0.076
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    37   0.076
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    37   0.077
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    37   0.077
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    37   0.080
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    37   0.081
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    37   0.081
NDAI0B01910 Chr2 complement(463465..464985) [1521 bp, 506 aa] {O...    37   0.084
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    37   0.085
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    37   0.085
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    37   0.088
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    37   0.088
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    37   0.090
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    37   0.091
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    37   0.092
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    37   0.093
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    37   0.095
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    37   0.095
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    37   0.096
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    37   0.096
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    37   0.097
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    37   0.098
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    37   0.098
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    37   0.10 
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    37   0.10 
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    37   0.11 
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    37   0.11 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    37   0.11 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    37   0.11 
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    37   0.12 
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    36   0.12 
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    37   0.12 
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    37   0.12 
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    37   0.12 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    36   0.12 
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    36   0.13 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    37   0.13 
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    37   0.13 
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    37   0.13 
KLLA0F10615g Chr6 (978492..979604) [1113 bp, 370 aa] {ON} highly...    36   0.13 
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    37   0.14 
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    37   0.14 
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               36   0.14 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    36   0.14 
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    36   0.15 
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    36   0.15 
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    36   0.17 
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    36   0.17 
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    36   0.17 
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    36   0.18 
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    36   0.18 
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    36   0.18 
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    36   0.19 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    36   0.19 
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    36   0.19 
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     36   0.20 
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    36   0.20 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     36   0.20 
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    36   0.21 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    36   0.21 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    36   0.22 
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    36   0.22 
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    36   0.22 
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    36   0.22 
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    36   0.23 
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    36   0.24 
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    35   0.24 
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    35   0.24 
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    35   0.24 
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    36   0.25 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    35   0.25 
Kwal_56.24577 s56 complement(1061240..1062766) [1527 bp, 508 aa]...    35   0.25 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    35   0.26 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    35   0.26 
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    35   0.26 
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    35   0.27 
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    35   0.27 
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    35   0.27 
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    35   0.29 
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    35   0.29 
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    35   0.29 
KAFR0A04480 Chr1 (889486..890616) [1131 bp, 376 aa] {ON} Anc_6.1...    35   0.29 
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    35   0.30 
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    35   0.30 
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    35   0.31 
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    35   0.32 
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    35   0.32 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    35   0.34 
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    35   0.34 
YDL156W Chr4 (174918..176486) [1569 bp, 522 aa] {ON}  CMR1DNA-bi...    35   0.35 
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    35   0.35 
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    35   0.36 
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    35   0.36 
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    35   0.36 
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    35   0.37 
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               35   0.37 
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    35   0.38 
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    35   0.38 
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    35   0.38 
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    35   0.40 
KAFR0L01440 Chr12 complement(266463..267377) [915 bp, 304 aa] {O...    35   0.40 
Kwal_56.22681 s56 complement(232799..234571) [1773 bp, 590 aa] {...    35   0.46 
NDAI0E04600 Chr5 (1039124..1042228) [3105 bp, 1034 aa] {ON} Anc_...    35   0.47 
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    34   0.49 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    35   0.50 
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    35   0.51 
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    35   0.52 
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    34   0.52 
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    34   0.53 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    35   0.56 
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    35   0.57 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    34   0.57 
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    34   0.58 
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    34   0.61 
TDEL0B04610 Chr2 complement(821716..823281) [1566 bp, 521 aa] {O...    34   0.62 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    34   0.64 
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    34   0.69 
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    34   0.71 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   0.73 
TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {O...    34   0.73 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    34   0.75 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    34   0.77 
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    34   0.79 
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    34   0.80 
Kpol_1002.94 s1002 (240130..241269) [1140 bp, 379 aa] {ON} (2401...    34   0.80 
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    34   0.85 
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    34   0.86 
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    34   0.87 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    34   0.87 
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    33   0.93 
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    34   0.94 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    33   0.95 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    34   0.96 
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    33   1.0  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    33   1.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    33   1.1  
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    33   1.1  
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    33   1.2  
TDEL0G02780 Chr7 complement(531606..533033) [1428 bp, 475 aa] {O...    33   1.2  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    33   1.3  
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    33   1.3  
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    33   1.3  
AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic ho...    33   1.3  
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    33   1.3  
NDAI0D02490 Chr4 (575553..577499) [1947 bp, 648 aa] {ON} Anc_5.104     33   1.4  
KNAG0G01320 Chr7 (295446..296891) [1446 bp, 481 aa] {ON} Anc_8.1...    33   1.4  
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    33   1.4  
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    33   1.4  
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    33   1.5  
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    33   1.5  
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    33   1.5  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    33   1.5  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    33   1.6  
TBLA0A01480 Chr1 (344851..346026) [1176 bp, 391 aa] {ON} Anc_6.1...    33   1.6  
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    33   1.8  
Kwal_47.17206 s47 complement(299680..300366) [687 bp, 228 aa] {O...    32   1.8  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    33   1.9  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    33   1.9  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    33   1.9  
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               33   2.0  
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    33   2.0  
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    33   2.1  
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    32   2.1  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    33   2.1  
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    33   2.2  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    32   2.3  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    32   2.3  
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    32   2.4  
Kpol_530.43 s530 (97335..98945) [1611 bp, 536 aa] {ON} (97335..9...    32   2.4  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    32   2.5  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    32   2.5  
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    32   2.6  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    32   2.6  
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    32   2.7  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    32   2.7  
CAGL0L06182g Chr12 (702461..703948) [1488 bp, 495 aa] {ON} highl...    32   2.7  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    32   2.7  
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    32   2.8  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    32   2.8  
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    32   2.8  
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    32   2.9  
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    32   2.9  
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    32   3.0  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   3.0  
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    32   3.0  
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    32   3.0  
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    32   3.1  
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    32   3.1  
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    32   3.1  
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    32   3.2  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    32   3.2  
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    32   3.2  
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    32   3.2  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    32   3.3  
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    32   3.3  
NCAS0C01570 Chr3 (289762..291063) [1302 bp, 433 aa] {ON}               32   3.3  
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    32   3.3  
ZYRO0G19250g Chr7 (1595380..1596999) [1620 bp, 539 aa] {ON} high...    32   3.4  
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    32   3.5  
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    32   3.5  
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    32   3.5  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    32   3.6  
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    32   3.6  
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    31   3.7  
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    32   3.9  
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    32   3.9  
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    32   4.0  
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    32   4.1  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    32   4.1  
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    32   4.2  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    32   4.2  
NDAI0B04620 Chr2 (1147583..1149748) [2166 bp, 721 aa] {ON} Anc_1...    32   4.2  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    31   4.4  
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    32   4.4  
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    32   4.5  
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    32   4.6  
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    31   4.7  
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    32   4.7  
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    31   4.8  
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    32   4.8  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    31   4.8  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    31   5.0  
TDEL0A04820 Chr1 (848835..849815) [981 bp, 326 aa] {ON} Anc_5.61...    31   5.0  
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    31   5.1  
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    32   5.2  
Smik_2.15 Chr2 complement(17939..21052) [3114 bp, 1037 aa] {ON} ...    32   5.3  
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    31   5.5  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    31   5.7  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    31   5.9  
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    31   5.9  
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    31   6.1  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    31   6.1  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    31   6.2  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    31   6.3  
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    31   6.3  
Suva_4.89 Chr4 (162699..164267) [1569 bp, 522 aa] {ON} YDL156W (...    31   6.3  
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    31   6.4  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    31   6.6  
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    31   6.8  
Smik_12.266 Chr12 (506562..507455) [894 bp, 297 aa] {ON} YLR208W...    31   6.8  
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    31   7.1  
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    31   7.2  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    30   7.2  
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    31   7.4  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    31   7.4  
KLLA0C16643g Chr3 complement(1457590..1458498) [909 bp, 302 aa] ...    30   7.6  
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    31   7.6  
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    30   8.0  
KLTH0H01628g Chr8 (144953..146488) [1536 bp, 511 aa] {ON} simila...    31   8.1  
AFR608W Chr6 (1536859..1538580) [1722 bp, 573 aa] {ON} Unclear i...    31   8.2  
TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7....    31   8.3  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    30   8.4  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    31   8.6  
SAKL0H25014g Chr8 (2178085..2179431) [1347 bp, 448 aa] {ON} high...    30   8.9  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    31   8.9  
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    31   8.9  
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    31   9.0  
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    31   9.0  
Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}...    30   9.2  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    30   9.2  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    30   9.3  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    30   9.5  
KLTH0E06534g Chr5 complement(600189..601571) [1383 bp, 460 aa] {...    30   9.6  

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/423 (100%), Positives = 423/423 (100%)

Query: 1   MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVEEEYELWNSNVPVMYE 60
           MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVEEEYELWNSNVPVMYE
Sbjct: 1   MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVEEEYELWNSNVPVMYE 60

Query: 61  FVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKVATINLPAGIAGLDQGD 120
           FVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKVATINLPAGIAGLDQGD
Sbjct: 61  FVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKVATINLPAGIAGLDQGD 120

Query: 121 EEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVS 180
           EEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVS
Sbjct: 121 EEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVS 180

Query: 181 TLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE 240
           TLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE
Sbjct: 181 TLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE 240

Query: 241 FESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300
           FESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL
Sbjct: 241 FESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDAD 360
           YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDAD
Sbjct: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDAD 360

Query: 361 DGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420
           DGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS
Sbjct: 361 DGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420

Query: 421 LLV 423
           LLV
Sbjct: 421 LLV 423

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/393 (63%), Positives = 302/393 (76%), Gaps = 4/393 (1%)

Query: 29  MSDYEDDNTDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSP--E 85
           M +YE+   D   LTV++EYELW SNV +MY+FVSETKLTWPSL+IQWLPS D   P  +
Sbjct: 1   MMEYEEIEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQ 60

Query: 86  QSLIFGTHTAGEEVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIR 145
           Q +I GTHT+G+E NYLK+A I+LP  + GL   D   E    S   +  KF H +EVIR
Sbjct: 61  QEMILGTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPV-KSMIKVTKKFEHEDEVIR 119

Query: 146 ARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSG 205
           ARYMP N  IIATINGKG I I+DR+  +S+    TL++HK+NGYGLAFNP I GELLS 
Sbjct: 120 ARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSA 179

Query: 206 SDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLE 265
           SDDTTVALWDI +  +P SI+ +H DIVND KWHEF+ N+FGTVSEDKTLQVHDKR    
Sbjct: 180 SDDTTVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSN 239

Query: 266 PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEF 325
             + LP   P N L+FSKHS+NL+AAAG D+++YLYD+R +S PLH M+GHQD+VT++EF
Sbjct: 240 SAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEF 299

Query: 326 SPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ 385
           S H DGI+CSSGSDRR  IWDLTQIGAEQ+Q+DADDG PELMMMHAGHRS +N+FSFNPQ
Sbjct: 300 SSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQ 359

Query: 386 IPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           +PWL+AS EEDNV+Q WK+S KLV+   P  +D
Sbjct: 360 VPWLIASAEEDNVVQVWKISKKLVSNIIPEYTD 392

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  484 bits (1245), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/385 (59%), Positives = 287/385 (74%), Gaps = 11/385 (2%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101
           L++EEEYELW +NVP+MY+FVSETKLTWPSLTIQWLP +  S +Q +I GTHT+GE+ NY
Sbjct: 10  LSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDDNY 69

Query: 102 LKVATINLPAGIAGLD-------QGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSN 154
           LK+A+I LP  I G +         + E + N  S   I  K  H EE+ RAR+MP + N
Sbjct: 70  LKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRARFMPQDPN 129

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
            IATING G + +FDR+ ++++A VS  AFHK+NGYGL+FNP   GELLS SDD T+ALW
Sbjct: 130 FIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALW 189

Query: 215 DIEAAK-KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273
           ++      P   +T+H+DIVND  WHEF  N+FG+VSEDKTLQ+HDKR     V +L  +
Sbjct: 190 NVMGTNTSPSKAVTTHEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRTN-STVHRLTLS 248

Query: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
           SPFNTL FSKHS+NL AAAG DS +YLYD+R+ +  LH MSGH+DSVT++EFSPH DGI+
Sbjct: 249 SPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKDGIL 308

Query: 334 CSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLAST 393
           CSSGSDRR ++WDL QIG+EQ+Q+DA DG PELMMMHAGH+S VN+FSFN  IPWL+AS 
Sbjct: 309 CSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLMASV 368

Query: 394 EEDNVIQAWKVSMKLVNASPPAISD 418
           EEDN++  WKVS KL   SP  I D
Sbjct: 369 EEDNIVHVWKVSKKLT--SPGLIQD 391

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  461 bits (1187), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 291/389 (74%), Gaps = 20/389 (5%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP----EQSLIFGTHTA 95
           + LT++EEY+LW SNVP+MY+FVSETKLTWP+LT++WLPS   S      Q LI GTHT+
Sbjct: 35  KELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTS 94

Query: 96  GEEVNYLKVATINLPAGIA-----------GLDQGDEEDEANDHSSFAIANKFPHIEEVI 144
           GEE NYLK+A I+LP  +              D+ +++ +    S+  I  KF H EE+ 
Sbjct: 95  GEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEIT 154

Query: 145 RARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLS 204
           RAR+MP N++IIATING GT+ I++++ ++  A +STL FHKENGYGL+FNP+  G+LLS
Sbjct: 155 RARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS 214

Query: 205 GSDDTTVALWDIEA----AKKPKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           GSDD T+ALWDI+     AKKP  I  S H+DIVND KW+EF SNVF +VSED TLQ+HD
Sbjct: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDS 319
           +R +   +  + T  PFNTL+FSKHS+ L+AAAG DS +YLYD R++S PL+ M+GH+DS
Sbjct: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS 334

Query: 320 VTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNE 379
           +T +EFSPHTDG++ SSG+DRR I+WD+  IGAEQ  DDA+DGAPE++M+HAGHRS VN+
Sbjct: 335 ITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVND 394

Query: 380 FSFNPQIPWLLASTEEDNVIQAWKVSMKL 408
           FS NP IPWL+AS EE+N+IQ WK S KL
Sbjct: 395 FSINPNIPWLMASAEEENIIQVWKCSHKL 423

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  458 bits (1179), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 213/378 (56%), Positives = 281/378 (74%), Gaps = 6/378 (1%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEV 99
           + LTV++EYELW +NVP+MY+FVSET+LTWPSLT QWLP   +   Q +I GTHT+GEEV
Sbjct: 9   EPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILGTHTSGEEV 68

Query: 100 NYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATI 159
           +YLKVA ++LP  +   +  D  D     S+  I  KF H  E+ RARYMP +SNIIATI
Sbjct: 69  DYLKVAALDLPDEVVTGEAND--DNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATI 126

Query: 160 NGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEA- 218
           NG+G +SI+DR+   S    +TL +HKENGYGL+FNP++S EL+SGSDD T+ALWDI++ 
Sbjct: 127 NGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSG 186

Query: 219 AKKPKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFN 277
           +K PKS+  + H DIVND  WH F+ N+FG+VSED TL++HDKR   + +  +   + FN
Sbjct: 187 SKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFN 246

Query: 278 TLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
           TL+FSKHS NL AAAG+D+ IYLYD R  + PLHVM+GH+D++T ++F P  DGI+ S G
Sbjct: 247 TLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKEDGILVSGG 306

Query: 338 SDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDN 397
           +DRR I+WDL +IGAEQ  D+ADDG+PE++M+HAGHRS +N+F+ +P IPWL AS EEDN
Sbjct: 307 ADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLSASVEEDN 366

Query: 398 VIQAWKVSMKL--VNASP 413
           V+Q WK S  L  V  +P
Sbjct: 367 VVQVWKCSKNLSRVGGTP 384

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  448 bits (1152), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/372 (56%), Positives = 271/372 (72%), Gaps = 5/372 (1%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEV 99
           + L+++EEY+LW SNVP+MY+FVSET LTWPSLT++WLP    S  Q +I GTHT+ EE 
Sbjct: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQ 68

Query: 100 NYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATI 159
           NYLK+A I LP  +    +  EE+E    S+  I  KF H  EV RARYMP + N+IATI
Sbjct: 69  NYLKIAAIYLPDEVVPDAEPKEEEEVL-KSNVKIIKKFEHENEVTRARYMPQDDNLIATI 127

Query: 160 NGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA 219
           +G GTI +++R  E     +ST  FH ENGYGL+FNP+  G+LLSGSDD+ + LWD+   
Sbjct: 128 SGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TG 186

Query: 220 KKPKSILT---SHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF 276
           K  + ILT    H DIVND KWH F+ N+FG+VSED TLQ+HD+R+R   V+K+    P+
Sbjct: 187 KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY 246

Query: 277 NTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSS 336
           NTL+FS HS NL AAAG DS +YLYD R  S PLH+M GH+D+VT++EF P  DG++ S+
Sbjct: 247 NTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISA 306

Query: 337 GSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEED 396
           GSDRR I+WDL +IGAEQ  DDADDG+PE+MM+HAGHRS +N+FS NP IPWL A+ EE+
Sbjct: 307 GSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEE 366

Query: 397 NVIQAWKVSMKL 408
           N++Q WK S KL
Sbjct: 367 NIVQVWKPSSKL 378

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  448 bits (1153), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 223/400 (55%), Positives = 277/400 (69%), Gaps = 18/400 (4%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE--------QSLIFG 91
           Q  T+ EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP++ Q  E        Q L+ G
Sbjct: 9   QPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIG 68

Query: 92  THTAGEEVNYLKVATINLPAGIAGL-----DQGDEEDEANDHSSFAIANKFPHIEEVIRA 146
           T T   E NYLK+A I+LP  +        D   E + ++  S   I  KF H +EV RA
Sbjct: 69  TLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVTRA 128

Query: 147 RYMPANSNIIATINGKGTISIFDRTLEES-KAQVSTLAFHKENGYGLAFNPHISGELLSG 205
           RYMP + NIIAT+NG G + IFDR ++E     +++ ++HKENGYGLAFNP +SG+LLS 
Sbjct: 129 RYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSA 188

Query: 206 SDDTTVALWDIE--AAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           SDD TVALWD+   A K P      H DIVND KWHEF+S++FGTVSED TL +HD    
Sbjct: 189 SDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSD 248

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
              ++KL  +S FNTL+FSK S NLLAAAG DS +YLYD+R +  PLH M+GH+DSVT++
Sbjct: 249 -RAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSL 307

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
           EFSPH DG++ SSGSDRR I+WDL  IGAEQ  DDA DG PEL MMH GHRSPVNEFS N
Sbjct: 308 EFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEFSHN 367

Query: 384 PQIPWLLASTEEDNVIQAWKVSMKLVN-ASPPAISDPSLL 422
             +PWL+ S EE+NV+Q WK + K+V    PPA  D + L
Sbjct: 368 SNVPWLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTL 407

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  447 bits (1149), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 278/381 (72%), Gaps = 9/381 (2%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101
           ++V+EEY+LW SNVP+MY+FVSETKL WPSLTIQWLPS+ +S EQ LI GTHT+G E NY
Sbjct: 10  VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGTEQNY 69

Query: 102 LKVATINLPAGI-----AGLDQGDEEDEANDH--SSFAIANKFPHIEEVIRARYMPANSN 154
           LK+A+++LP  +           D+  E+     S   I  KF H +EV RARY P N N
Sbjct: 70  LKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPN 129

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           +IATI+G G + ++DR+ +   A  +  +FHKENGYGL F+    GELLS SDD ++A+W
Sbjct: 130 LIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIW 189

Query: 215 DIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273
           D+ + K  P  + TSH++IVN+ KWHE    +FG+VS+D TL +HDKR+  +PV K+  +
Sbjct: 190 DVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRID-KPVVKILQS 248

Query: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
            P+NTL+FSKHS NL AAAG DSQ+ LYD+R   +P+H MSGH DSVT++EF+PH DGI+
Sbjct: 249 EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPHKDGIL 308

Query: 334 CSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLAST 393
           CS  SDRR +IWDL QIGAEQ Q+DADDG PEL+MMHAGH+SPVN+FS +P IPWL+AS 
Sbjct: 309 CSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPWLMASV 368

Query: 394 EEDNVIQAWKVSMKLVNASPP 414
           EE+NV+Q WK S KL +   P
Sbjct: 369 EEENVVQIWKASKKLTSPYIP 389

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  446 bits (1146), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/369 (57%), Positives = 271/369 (73%), Gaps = 3/369 (0%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101
           L+++EEYELW SNVP+MY+FVSET LTWP+LT++WLP +  S  Q LI GTHT+ EE NY
Sbjct: 10  LSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGTHTSEEEPNY 69

Query: 102 LKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATING 161
           LK+A I+LP  I    + D E +    S+  I  KF H +EV RARYMP +SN+IATING
Sbjct: 70  LKIAAIDLPDEIVP-GKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATING 128

Query: 162 KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEA-AK 220
            GT+ ++DR+ +  +  +S+L FH++NGYGL+FNP   G+LLSGSDD+ +ALWDI   + 
Sbjct: 129 SGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNST 188

Query: 221 KPKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTL 279
           KP S   S H D VND KWHE   N FG+VSED TLQ+HD+RV+     K+ T + FNT+
Sbjct: 189 KPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFNTI 248

Query: 280 SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSD 339
           +FSKHS NL AAAG DS IYLYD R   + LH MSGH+ +VT +EF    DGI+ SSG D
Sbjct: 249 AFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSGED 308

Query: 340 RRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI 399
           RR I+WDL +IGAEQ  DDADDG+PE++M+HAGHRSPVN+FS NP IPWL+AS EE+N++
Sbjct: 309 RRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEENIV 368

Query: 400 QAWKVSMKL 408
           Q WK S KL
Sbjct: 369 QVWKCSSKL 377

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  443 bits (1140), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 278/377 (73%), Gaps = 8/377 (2%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSD--GQSP-EQSLIFGTHTAG 96
           + L+++EEYELW SNVP+MY+FVSET+LTWPSL+++WLP +   Q+P  Q LI GTHT+G
Sbjct: 20  KELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHTSG 79

Query: 97  EEVNYLKVATINLPAGIAGLDQGDEED---EANDHSSFAIANKFPHIEEVIRARYMPANS 153
           EE NYLK+A I+LP  I    +  E+    E    S+  I  KF H EE+ RARYMP NS
Sbjct: 80  EEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEITRARYMPQNS 139

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           N++ATING G + ++DR+ ++    VST  +HKENGYGL+FN + +G+LLSGSDD T+AL
Sbjct: 140 NLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIAL 199

Query: 214 WDIEAAKK-PKSILTS-HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLP 271
           W++  +   P  + +S H DIVND KW  F+ NVFG+VSED TLQ+HD+R +     +  
Sbjct: 200 WNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQFK 259

Query: 272 TASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG 331
             +PFNTL+FSKHS+ L AAAG DS +YL+D RD+S PLH M+GH  +VT +EFSP  DG
Sbjct: 260 VDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQDG 319

Query: 332 IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391
           I+ +SG DRRAIIWD+  IG EQ  DDA+DGAPE++M+HAGHRS +N+FS NP IPWL+A
Sbjct: 320 ILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWLMA 379

Query: 392 STEEDNVIQAWKVSMKL 408
           S+EE+N+IQ WK S KL
Sbjct: 380 SSEEENIIQVWKCSHKL 396

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  442 bits (1136), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 222/400 (55%), Positives = 280/400 (70%), Gaps = 25/400 (6%)

Query: 37  TDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFG 91
           T  + L+V+EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP+  Q PE     Q LI G
Sbjct: 3   TQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIG 62

Query: 92  THTAGEEVNYLKVATINLPAGIAGLDQGDEEDEAND---------HSSFAIANKFPHIEE 142
           THT+GEE NYLK A INLP  I  L+  D ++EA +          S+  I  K+ H EE
Sbjct: 63  THTSGEEENYLKFAEINLPKEI--LNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202
           + RARYMP N   +ATING+GT+ I+ R    S+   STL FH+ENGY L+F+P + G L
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIYSR----SEGLQSTLKFHEENGYALSFSPLVEGLL 176

Query: 203 LSGSDDTTVALWDI----EAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258
           LSGSDD TVALWD+    ++ +  ++    H DIVND KWH F  ++FGTVSED  L+++
Sbjct: 177 LSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKIN 236

Query: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQD 318
           D RV            PFNTL+FS HS NLLAAAG DS +YLYD+R+M  PLH MSGH+D
Sbjct: 237 DLRVENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHED 296

Query: 319 SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVN 378
           +VT +EFSPH DG++ SSGSD R I+WDL QIGAEQ+ DDA+DG PEL+M+HAGH+S VN
Sbjct: 297 AVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVN 356

Query: 379 EFSFNPQIPWLLASTEEDNVIQAWKVSMKL-VNASPPAIS 417
           +F  N QIPWL+ASTEE+N++Q WK S  L V   PP +S
Sbjct: 357 DFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVS 396

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/385 (54%), Positives = 271/385 (70%), Gaps = 20/385 (5%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFGTHT 94
           + L+V+EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP+  Q P+     Q LI GTHT
Sbjct: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTHT 65

Query: 95  AGEEVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFA-------IANKFPHIEEVIRAR 147
           +GEE NYLK A INLP  +   +   E+ E  D +S         I  K+ H EE+ RAR
Sbjct: 66  SGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRAR 125

Query: 148 YMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSD 207
           YMP + N++ATING+GT+ ++ R    S    STL FHK+NGY L+F+P I G LLSGSD
Sbjct: 126 YMPQDPNMVATINGQGTVFLYSR----SDGLQSTLKFHKDNGYALSFSPLIKGHLLSGSD 181

Query: 208 DTTVALWDIEAAKKPKSILTS----HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           D +VALWD+       + + +    H DIVND KWH F  ++FGTVSED  L+++D R  
Sbjct: 182 DHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRAE 241

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
              +       PFNTL+FS HS N+LAAAG+DS +YLYD+R+M  PLH MSGH+D+VT +
Sbjct: 242 NTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNL 301

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
           EFSPH DG++ SSGSD R I+WDL QIGAEQ+ DDA+DG PEL+M+HAGHRS VN+F  N
Sbjct: 302 EFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDLN 361

Query: 384 PQIPWLLASTEEDNVIQAWKVSMKL 408
            Q+PWL+ASTEE+N++Q WK S  L
Sbjct: 362 AQVPWLIASTEEENILQVWKCSHSL 386

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  434 bits (1115), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 209/382 (54%), Positives = 271/382 (70%), Gaps = 14/382 (3%)

Query: 46  EEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP--EQSLIFGTHTAGEEVNYLK 103
           EEY+LW SNVP+MY+FVSET+L WPSLT+QWLP    +P   Q LI GTHT+ EE NYLK
Sbjct: 35  EEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDEEQNYLK 94

Query: 104 VATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKG 163
           +A ++LP  +       E DE    S+  +  KF H  EV RARYMP + NI+ATI+G G
Sbjct: 95  IAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISGTG 154

Query: 164 TISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDI-----EA 218
           T+ I+DR+ E   A + TL +H +NGYGLAFNP I G LLSGSDD+ VALWD+     E 
Sbjct: 155 TVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEP 213

Query: 219 AKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT 278
            +K ++I   H DIVND +WH F+ ++FGTVSED +LQ+HD R   +PV  +    PFNT
Sbjct: 214 VQKWENI---HSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR-ESKPVATINGTKPFNT 269

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS 338
           LSFS HS NLLA  GV+S++YLYD R +  PLH+MSGH D+VT+++FS   DGII S+G+
Sbjct: 270 LSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILSAGA 329

Query: 339 DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398
           D+R IIWD+  IGAEQ  +DA+D   E+MM+HAGHRSP+N+F+ NP IPWL+AS EE+N+
Sbjct: 330 DKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEEENI 389

Query: 399 IQAWKVSMKL--VNASPPAISD 418
           +Q WK S KL  ++ +PP   D
Sbjct: 390 VQLWKCSHKLPRISGTPPVRVD 411

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  433 bits (1113), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/397 (53%), Positives = 278/397 (70%), Gaps = 25/397 (6%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-----DGQSPEQSLIFGTHT 94
           + L+V+EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP+     DG   +Q LI GTHT
Sbjct: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHT 65

Query: 95  AGEEVNYLKVATINLPAGIAGLDQGDEEDEAND---------HSSFAIANKFPHIEEVIR 145
           +GEE NYLK A INLP  I  L   D ++EA +          S+  I  K+ H EE+ R
Sbjct: 66  SGEEENYLKFAEINLPKEI--LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITR 123

Query: 146 ARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSG 205
           ARYMP + NI+ATING+GT+ ++ R    S+   STL FHK+NGY L+F+  + G LLSG
Sbjct: 124 ARYMPQDPNIVATINGQGTVFLYSR----SEGLQSTLKFHKDNGYALSFSTLVKGRLLSG 179

Query: 206 SDDTTVALWDIEAAKKPKSILTS----HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           SDD TVALW++ +   P   + +    H DI+ND KWH F  ++FGTVSED  L+++D R
Sbjct: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
                +  +    PFNTL+FS HS NLLAAAG+DS +YLYD+R+M  PLH MSGH+D+V 
Sbjct: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFS 381
            +EFS H DG++ SSGSD R ++WDL QIGAEQ+ DDA+DG PEL+M+HAGHRS VN+F 
Sbjct: 300 NLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 359

Query: 382 FNPQIPWLLASTEEDNVIQAWKVSMKL-VNASPPAIS 417
            NPQIPWL+AS EE+N++Q WK S  L +   PP ++
Sbjct: 360 LNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVN 396

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  434 bits (1115), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/398 (53%), Positives = 277/398 (69%), Gaps = 21/398 (5%)

Query: 37  TDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFG 91
           T  ++L+V+EEY+LW SNVP+MY+FVSET+LTWPSL++QWLP+  Q  E     Q LI G
Sbjct: 29  TQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIG 88

Query: 92  THTAGEEVNYLKVATINLPAGIAGLDQGDEEDEANDH-------SSFAIANKFPHIEEVI 144
           THT+GEE NYLK A IN+P  I       EE E +D        S+  I  K+ H EE+ 
Sbjct: 89  THTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEIT 148

Query: 145 RARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLS 204
           RARYMP N + +AT+NG+GT+ ++ R    S    STL FHK+NGY L+FN  + G+LLS
Sbjct: 149 RARYMPQNPDFVATLNGQGTVFLYSR----SGGLQSTLKFHKDNGYALSFNALVEGQLLS 204

Query: 205 GSDDTTVALWDIEAAKKPKSILTS----HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           GSDD TVALW++ +     S + +    H DIVND+KWH F   +FGTVSED  L+++D 
Sbjct: 205 GSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDV 264

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
           R     +  +    PFNTL+FS HS NLLAAAG+DS +YLYD+R+M  PLH MSGH+D+V
Sbjct: 265 RAHNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAV 324

Query: 321 TTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEF 380
           T +EFS H DG++ SSGSD R I+WDL QIGAEQ+ DDA+DG PEL+M+HAGHRS VN+F
Sbjct: 325 TNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDF 384

Query: 381 SFNPQIPWLLASTEEDNVIQAWKVSMKL-VNASPPAIS 417
             N QIPWL+AS+EE+N++Q WK S  L +   PP ++
Sbjct: 385 DLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVN 422

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  424 bits (1091), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 205/381 (53%), Positives = 272/381 (71%), Gaps = 7/381 (1%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEV 99
           + L++++EY+LW SNVP+MY+FVSET+L WPSLTIQWLP    S EQ L+ GTHT+  E 
Sbjct: 8   RELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHTSDSEQ 67

Query: 100 NYLKVATINLPAGIAG-----LDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSN 154
           NYLK+A INLP  I       L   +   +    S   I  KF H  EV RARY P +SN
Sbjct: 68  NYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSN 127

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           +IATI+G GT+ ++DRT ++  A     A+HKENGYGL F+    GEL+S SDD ++A+W
Sbjct: 128 LIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIW 187

Query: 215 DIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273
           DI++ K  P S+ + H DIVN+ KWHE + N++G+VSED  L +HDKR   +P++KL   
Sbjct: 188 DIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSE-KPLQKLLQK 246

Query: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
            PFNT++FSKHS NL AAAG D+ +YL+D R  +  LH MSGHQ++VT++EF+ H DGI+
Sbjct: 247 EPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHHKDGIL 306

Query: 334 CSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLAST 393
           CS GSDRR ++WDL QIG EQ ++DADDG PEL+MMHAGH+S +N+FSF+P +PWL+AS 
Sbjct: 307 CSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVPWLMASV 366

Query: 394 EEDNVIQAWKVSMKLVNASPP 414
           EE+N++Q WK S KL N   P
Sbjct: 367 EEENIVQIWKPSRKLTNPYFP 387

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  413 bits (1061), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 203/383 (53%), Positives = 273/383 (71%), Gaps = 10/383 (2%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNY 101
           LTV++EY+LW SNVP++Y+FVSET+LTWPSLT+QWLP D  S  Q LI GT T+G E +Y
Sbjct: 11  LTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAETDY 70

Query: 102 LKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATING 161
           LK+A ++LP  I    + D+  ++N      +  KF H  E+ RARYMP N+NIIAT+NG
Sbjct: 71  LKIAALDLPDEIIIGKKSDKVVKSN----LKVVKKFAHDGEINRARYMPQNTNIIATVNG 126

Query: 162 KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKK 221
           +GTI I+D + ++  A +STL +HK+N YGLAFNP+  GEL+SGSDD+T+ALWD    K 
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATNDKL 186

Query: 222 PKSI---LTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT 278
            + I    TSH DIVND +WH F +N+FG+VSED TLQ+ DKR   +   K+ +   +N+
Sbjct: 187 KQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNS 246

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS 338
           ++FS  S NL AAAG  + IYLYD+R+    LH M+GH++ VT++EFS   DGI+ S  S
Sbjct: 247 IAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISGSS 306

Query: 339 DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398
           DRR I+WDL +IGAEQ  D+ADDG PE+MM+HAG RS +N+ S +P IPWL AS EE+N+
Sbjct: 307 DRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEENNI 366

Query: 399 IQAWKVSMKL--VNASPP-AISD 418
           +Q WK S KL  ++ +P  +ISD
Sbjct: 367 VQVWKCSSKLPRISGTPEVSISD 389

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  414 bits (1063), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/377 (53%), Positives = 273/377 (72%), Gaps = 12/377 (3%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSD---GQSPEQSLIFGTHTAG 96
           + +TV+EEYELW SNVP++Y+FVSET+LTWP+LT++WLP          Q LI GTHT+G
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG 85

Query: 97  EEVNYLKVATINLPAGIAGLDQGDEEDEANDH----SSFAIANKFPHIEEVIRARYMPAN 152
           EE NYLK+  ++LP  +    + D E +  D     S+  I  KFPH  E+ RARYMP +
Sbjct: 86  EEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQD 145

Query: 153 SNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVA 212
            NIIATING+G I I+DR+    +A +STL +H ENGYGLAFN +    LLSGSDD+ +A
Sbjct: 146 DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205

Query: 213 LWDIEAAKKP-KSILT---SHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVK 268
           LWDI   +K  K  +T   +H DI+NDVKWH  E+++FG+VSED T+++ DKR   + + 
Sbjct: 206 LWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS-QIIH 264

Query: 269 KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH 328
            + T  P+NTL+FS  S NL AAAG D+ +YLYD+RD+S+PL+ M+GH+D+VT +EF P+
Sbjct: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324

Query: 329 TDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
            DGI+ SSGSDRR I+WDL +IGAEQ+QD+ +DG PE++M+HAGH++ +N+ + NP I W
Sbjct: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384

Query: 389 LLASTEEDNVIQAWKVS 405
           L+AS EEDN++Q WK S
Sbjct: 385 LVASAEEDNIVQIWKCS 401

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  396 bits (1018), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 274/385 (71%), Gaps = 13/385 (3%)

Query: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP--EQSLIFGTHTAGE 97
           + L+++EEY+LW SNVP+MY+FVSETKLTWPSLT++WLP D Q+P  +Q +I GTHT+ +
Sbjct: 8   RELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSDQ 67

Query: 98  EVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIA 157
           E NY+K+A+I LP  +  +D  +  D A   S+  I  KF   +E+ R+RYM  + NII+
Sbjct: 68  EPNYVKIASIELPNEV--IDPHNVSD-APVKSNVRITKKFKLEKEITRSRYMVQDPNIIS 124

Query: 158 TINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIE 217
           TI+G GT+SIFDR    S + V T ++HK+NGYGL+FNP   G+LLS +DD  +A++DI 
Sbjct: 125 TIDGNGTVSIFDRN--SSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDIN 182

Query: 218 A-AKKPKSILTSHDD-IVNDVKWHEFESNVFGTVSEDK-TLQVHDKRVRLEPVKKLPTAS 274
           A ++ P     S D+ I+ND+KWH F++ +FGTVSE+K TL ++D R + + V  +    
Sbjct: 183 AESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTK-DKVTSIEMEQ 241

Query: 275 PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIIC 334
           PFN+L+FSKHS+NL +AAG D  +YLYD+R+    LH MSGH+  VT +EF    DGI+ 
Sbjct: 242 PFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGILV 301

Query: 335 SSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTE 394
           SS  DRR IIWDL +IG+EQ  +DA D  PELMM+HAGHRS VN+FS N  IPWL+ASTE
Sbjct: 302 SSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIASTE 361

Query: 395 EDNVIQAWKVSMKL--VNASPPAIS 417
           E+N+IQ WK S +L  ++ S P I+
Sbjct: 362 EENIIQVWKSSSRLPRISNSKPFIN 386

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  382 bits (982), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/382 (50%), Positives = 263/382 (68%), Gaps = 21/382 (5%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQ----SPEQSLIFGTHTAGE 97
           LT ++EYELW SNVP++Y+FVSETKL WPSLT++WLPS+      S EQ L+ GTHT+GE
Sbjct: 20  LTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE 79

Query: 98  EVNYLKVATINLPAGIAGLDQGDEEDEANDH--SSFAIANKFPHIEEVIRARYMPANSNI 155
           E NYLK+A I LP  I        ED ++ H  S+  I  KF H  EV RA YMP +S I
Sbjct: 80  EQNYLKIAEITLPDQIIN---EKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTI 136

Query: 156 IATINGKGTISIFDRTLEESKAQ--VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           IATING GT+ I+D +++E+++   +S L+ HKENGYGLAFNP   G+LLS SDD +VA 
Sbjct: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196

Query: 214 WDIEAAKKPKSILTSHD-DIVNDVKWHEFESNVFGTVSEDKTLQVHDKR-----VRLEPV 267
           W+I+   K   +LT  +  I+NDV+W++F  N+FG V+E   L + D R     +++   
Sbjct: 197 WNIQ---KSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN 253

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
             + T S FN ++FS HS  L+AA+G DS IYLYD R+++ PLH M GH+DSVT+++F  
Sbjct: 254 HDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA 313

Query: 328 HTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG-APELMMMHAGHRSPVNEFSFNPQI 386
             DGI+ S GSD+R  +WDL QIG EQ+ D+ +DG  PEL+M+HAGHRSP+N+FS +  +
Sbjct: 314 LNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNL 373

Query: 387 PWLLASTEEDNVIQAWKVSMKL 408
            WL AS EEDN++Q WK++  L
Sbjct: 374 NWLCASIEEDNIVQVWKMNNSL 395

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  141 bits (356), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 114/428 (26%), Positives = 191/428 (44%), Gaps = 65/428 (15%)

Query: 33  EDDNTDVQSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFG 91
           E +N+   S  +++ Y  W  N  ++Y++++     WPSLT Q+ P  D  +    L+  
Sbjct: 2   EIENSTSISNDLQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLLS 61

Query: 92  THTAG-----EEVNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFAIANKFPHIE--- 141
           T T+      E +    ++T+N    + +   D  + E + ++   F   N    I    
Sbjct: 62  TFTSSQIPDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITF 121

Query: 142 ---EVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLA--------------- 183
              +  +ARYMP N +II   +  G I IFDRT   SK   +T A               
Sbjct: 122 PEGDCNKARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAK 181

Query: 184 ---FHKENG--------YGLAFNPHISGELLSGSDDTTVALWDI--EAAKKPKSIL---- 226
              F  E+G          +A+NP   G+LLS   +  + LWD   E + K + I     
Sbjct: 182 QRKFVIEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIW 241

Query: 227 -TSHDDI-VNDVKWHEFESNVFGTVSEDKTLQVHDKRVR--LEPVKKLPTASPFNTLSFS 282
            T+ DD+  N+V W    +++F T  E+  + V D R    +  +++       N+  F+
Sbjct: 242 DTNFDDLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFN 301

Query: 283 KHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRR 341
             +  LLA+   +  I L+D+R ++ P+  +  H  S++T+E+SP  + +I S G  D  
Sbjct: 302 YENAMLLASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGL 360

Query: 342 AIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQA 401
             +WD++                E + +H GH   +N+ S++   PWLL S   DN IQ 
Sbjct: 361 VKLWDISN-------------EEEPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQI 407

Query: 402 WKVSMKLV 409
           WK +  LV
Sbjct: 408 WKPAKHLV 415

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  140 bits (353), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 108/407 (26%), Positives = 182/407 (44%), Gaps = 55/407 (13%)

Query: 45  EEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--EVNY 101
           ++ Y  W  N  ++YE+++     WPSLT Q  P  D    E  ++  + T+ +  E   
Sbjct: 22  QQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLPEDEA 81

Query: 102 LKVATI----NLP-AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARYM 149
           + VA +    ++P + +   D  + E + ++       N       KFP   +  +ARY 
Sbjct: 82  IYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFP-AGDCNKARYC 140

Query: 150 PANSNIIATINGKGTISIFDRTLEES---------------KAQVSTLAFHKEN-GYGLA 193
           P+N ++I++ +  G++ +FDRT   S                 Q+ST    ++N    LA
Sbjct: 141 PSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLA 200

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKK-------PKSILTSHDDIVNDVKWHEFESNVF 246
           +N    G L +      V +WD+    K       P S L +     ND+ W     ++ 
Sbjct: 201 WNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDPHSSLLADPQGSNDISWMVNHDSLL 260

Query: 247 GTVSEDKTLQVHDKRVRLEPVKKLPT---ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM 303
               E   L V D R+  +P +       ++  N   F+ +   LL +A    +I L+D+
Sbjct: 261 AYCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWDI 320

Query: 304 RDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDADDG 362
           RD SSP+  +  H  SV+ ++++PH   I+ ++G D   + IWDL+Q   +         
Sbjct: 321 RDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQPVDQ--------- 370

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
             EL   H GH   VN+ S++P  PW++ S   DN IQ WK S  L+
Sbjct: 371 --ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNLM 415

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  134 bits (338), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/410 (27%), Positives = 182/410 (44%), Gaps = 61/410 (14%)

Query: 45  EEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--EVNY 101
           ++ Y  W  N  + Y++++     WPSLT Q  P  D  + E  ++  + T+ +  E   
Sbjct: 22  QKRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDES 81

Query: 102 LKVATINLPAGI--AGLDQGD-EEDEANDHSSFAIANK---------FPHIEEVIRARYM 149
           L VA ++    I  + L+  D EE E    +S  + +K         FP   +  +ARY 
Sbjct: 82  LYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFP-AGDCNKARYC 140

Query: 150 PANSNIIATINGKGTISIFDRTLE---------------ESKAQVST-LAFHKENGYGLA 193
           P+N ++I + +  G+I +FDRT                 +   Q+ST L  HK     LA
Sbjct: 141 PSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLA 200

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKK-------PKSILTSHDDIVNDVKWHEFESNVF 246
           +N    G L +      V +WD+E   K       P ++ T      N+V W     ++ 
Sbjct: 201 WNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLL 260

Query: 247 GTVSEDKTLQVHDKRVRLEPVKKLPTAS------PFNTLSFSKHSRNLLAAAGVDSQIYL 300
              SED  + + D R    P K   + S        NT  F+ H   LL +A    +I L
Sbjct: 261 AYCSEDNLVGIMDIR---NPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINL 317

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDA 359
           +D+R+ + PL  +  H DS++ ++++P    ++ + G D   + IWDL+Q   +      
Sbjct: 318 WDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ------ 370

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
                EL+  H GH   VN+ S++P   W++ S   DN IQ W+ S  LV
Sbjct: 371 -----ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSLV 415

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  134 bits (337), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 107/410 (26%), Positives = 189/410 (46%), Gaps = 56/410 (13%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSP--EQSLIFGTHTAG----- 96
           +++ Y  W  N  ++Y++++     WPSLT Q++P D + P  +  L+  + T+      
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP-DLEVPTDKHRLLLSSFTSSQLPED 79

Query: 97  EEVNYLKVATI-NLP-AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRAR 147
           E V   +++T+ ++P + +   D  + E + ++ +     N       +FP   +  RA 
Sbjct: 80  EAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPS-GDCNRAC 138

Query: 148 YMPANSNIIATINGKGTISIFDRTLEESK-------AQVSTLAFHKENGYG--------- 191
           YMP N +II  I   G ++IFDRT   +        A    +  ++    G         
Sbjct: 139 YMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALS 198

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIV-------NDVKWHEFESN 244
           LA+N   +G + S   +  + +WDI   +K +  +++ +  +       NDV W    S+
Sbjct: 199 LAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSS 258

Query: 245 VFGTVSEDKTLQVHDKRV--RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
           +     E  T+ + D R     +P K  P     N L F+  +  LL AA  +  I L+D
Sbjct: 259 ILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNGGIALWD 318

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDADD 361
            R  S PL V + H DSV+ ++++P+   I+ ++G     I IWD ++    + +D    
Sbjct: 319 CRAFSKPLSVFN-HGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTSR----EPED---- 369

Query: 362 GAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNA 411
               L+ +H GH   VN+ ++N   PWL+ S   DN +  WK +  LV A
Sbjct: 370 ---SLLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANLVQA 416

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  132 bits (332), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 105/407 (25%), Positives = 185/407 (45%), Gaps = 55/407 (13%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----E 97
           V+  Y  W  N  ++Y++++     WPSLT Q+ P  D  + +  L+  + T+      E
Sbjct: 30  VQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSSQLPEDE 89

Query: 98  EVNYLKVATI-NLP-AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARY 148
            +   +V+T+ +LP + +   D  + E + ++ S     N        FP + +   ARY
Sbjct: 90  SIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFP-MGDCNGARY 148

Query: 149 MPANSNIIATINGKGTISIFDRT--------------LEESKAQVSTLAFHKENGYGLAF 194
           +P N ++IA  +  G+I +FDRT              + E + Q S+L  H+E    LA+
Sbjct: 149 LPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQE-VVSLAW 207

Query: 195 NPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI-------VNDVKWHEFESNVFG 247
           N    G L +      V +WD++   +   ++   D          NDV W    +++  
Sbjct: 208 NWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHASILA 267

Query: 248 TVSEDKTLQVHDKRVR---LEPVKKLPTASP-FNTLSFSKHSRNLLAAAGVDSQIYLYDM 303
              E  ++ V D R +   L   K     S   N+  F+ H+  LL +     ++ L+D+
Sbjct: 268 CCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVNLWDI 327

Query: 304 RDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSG-SDRRAIIWDLTQIGAEQSQDDADDG 362
           RD+ +PL  +  H  S++  +++P+   I+ ++  SD    +WD+ Q   E         
Sbjct: 328 RDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE--------- 377

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
             EL+ +H GH   VN+ S+N   PWL+ S   DN +Q W+ +  LV
Sbjct: 378 --ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNLV 422

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  130 bits (328), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 107/406 (26%), Positives = 184/406 (45%), Gaps = 51/406 (12%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--EVN 100
           +++ Y  W  N  ++YE+++     WPSLT Q++P  D  S +  ++  + T+ +  E  
Sbjct: 21  LQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLPEDE 80

Query: 101 YLKVATINLPAGIAGLD-----------QGDEEDEANDHSSFAIANKFPHIEEVIRARYM 149
            + ++ I+    IA              + D + + + + +  I  +FP   +  RARYM
Sbjct: 81  AIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPE-GDCNRARYM 139

Query: 150 PANSNIIATINGKGTISIFDRTLEES---KAQVSTLAFHKE----------NGYGLAFNP 196
           P N ++IA+ +  G++ IFDRT   S   K   +T  +  E              LA+N 
Sbjct: 140 PQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAWNY 199

Query: 197 HISGELLSGSDDTTVALWDIEAAKKPKSILTSHD-------DIVNDVKWHEFESNVFGTV 249
             SG L +   D  V +WDI    K +  LT  D       +  N+V W    S++    
Sbjct: 200 QRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHHSSILAVC 259

Query: 250 SEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS 307
            E   L + D R       K  +      N + F+  +  LL +A  +  + + D+R + 
Sbjct: 260 GEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIRQLE 319

Query: 308 SPLHVMSGHQDSVTTVEFSPHTDGIICSSG-SDRRAIIWDLTQIGAEQSQDDADDGAPEL 366
            P+   S H D+V+T++++P    +I S+G +D    IWDL Q      +DD       L
Sbjct: 320 HPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ------EDDP------L 366

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNAS 412
           + +H GH   VN+ ++N   PW++ S   DN +  WK +  +VN +
Sbjct: 367 VFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANIVNGN 412

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  129 bits (323), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 110/422 (26%), Positives = 188/422 (44%), Gaps = 67/422 (15%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--- 97
           + ++E Y  W  N  ++Y++++     WPSLT Q+ P  D  S E  ++  + T+ +   
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKPE 76

Query: 98  -EVNYL-KVATINLP--AGIAGLDQGDEEDEANDHSSFA-------IANKFPHIEEVIRA 146
            E  Y+ K++T+     + +   D  + E +  + + F        I+  FP+  E  RA
Sbjct: 77  DETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPN-GECNRA 135

Query: 147 RYMPANSNIIATINGKGTISIFDRT------LEESKAQ-------------------VST 181
           RY+P N +IIA  +  G I IFDRT      + +SK                     + T
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDT 195

Query: 182 LAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSIL-------TSHDDIVN 234
            +        LA+N      LLS   +  V +WDI+       I+        S    VN
Sbjct: 196 SSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVN 255

Query: 235 DVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVK--KLPTASPFNTLSFSKHSRNLLAAA 292
           DV W     ++F   +E   + + D R + E ++  +       N+  F+  +  +LA+A
Sbjct: 256 DVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILASA 315

Query: 293 GVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQI 350
             + ++ L+D+R+M+ SP+  M  H  SV+T+E+SP+ D ++ ++G  D    +WD +  
Sbjct: 316 DSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDTS-- 372

Query: 351 GAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVN 410
                         E +  H GH   VN+ S++   PWL+ S   DN +  WK +  LV 
Sbjct: 373 ------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGNLVG 420

Query: 411 AS 412
            S
Sbjct: 421 HS 422

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  129 bits (323), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 109/420 (25%), Positives = 185/420 (44%), Gaps = 67/420 (15%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----E 97
           ++E Y  W  N  ++YE+++     WPSLT Q+ P  D    E  ++  + T+      E
Sbjct: 19  LQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPEDE 78

Query: 98  EVNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFA-------IANKFPHIEEVIRARY 148
            +   K++T+     + +   D  + E +  + + +        I+  FP+  E  RARY
Sbjct: 79  SIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPN-GECNRARY 137

Query: 149 MPANSNIIATINGKGTISIFDRT------LEESKA----QVSTLAFHK------------ 186
           +P N +IIA  +  G I IFDRT      + +SK     +      H             
Sbjct: 138 LPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDASS 197

Query: 187 ---ENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSI-------LTSHDDIVNDV 236
                   +A+N      LLS   +  V +WDI+       I       + S    VNDV
Sbjct: 198 ADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSGVNDV 257

Query: 237 KWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSRNLLAAAGV 294
            W     ++F   +E  T+ + D R + E +K    +     N+  F+  +  +LA+A  
Sbjct: 258 TWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHNGGVNSCKFNYRNSLILASADS 317

Query: 295 DSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQIGA 352
           + ++ L+D+R+M+  PL  M  H  SV+T+E+SP+ D ++ ++G  D    +WD ++   
Sbjct: 318 NGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKLWDTSR--- 373

Query: 353 EQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNAS 412
                       E +  H GH   VN+ S++   PWL+ S   DN +  WK ++ LV  S
Sbjct: 374 -----------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAVNLVGYS 422

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  127 bits (320), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 109/413 (26%), Positives = 188/413 (45%), Gaps = 59/413 (14%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----E 97
           +++ Y  W  N  ++Y++++     WPSLT Q+ P  D  S    ++  + T+      E
Sbjct: 17  LQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISSFTSSQLPEDE 76

Query: 98  EVNYLKVATINLP--AGIAGLDQGDEEDEAN-------DHSSFAIANKFPHIEEVIRARY 148
            ++  K++T+     A +   D  + E + +        H    +  KFP+  +  RARY
Sbjct: 77  AIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIKFPN-GDCNRARY 135

Query: 149 MPANSNIIATINGKGTISIFDRT------LEESK-------------AQVSTLAFHKENG 189
           +P N ++IA  +  G++ IFDRT      + +SK               V  L  +    
Sbjct: 136 LPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEELHENTNEA 195

Query: 190 YGLAFNPHISGELLSGSDDTTVALWDIEAA--KKP---KSILTSHDDI--VNDVKWHEFE 242
             LA+N    G L S      V +WDI+      P   K +L    D   VNDV W    
Sbjct: 196 ISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNIQFDALGVNDVSWMPSH 255

Query: 243 SNVFGTVSEDKTLQVHDKRVRLE--PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300
            ++F    E  TL + D+R+  E   + +       N+  F+  +  LLA+A  +  + +
Sbjct: 256 DSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLASADSEGLVNM 315

Query: 301 YDMRDMSS-PLHVMSGHQDSVTTVEFSPHTDGIICSSG-SDRRAIIWDLTQIGAEQSQDD 358
           +D+R++   P+  ++ H  S++T+E++P+ D II ++G +D    +WD++    E     
Sbjct: 316 WDIRNLDQYPIKSIN-HGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVSNTDNE----- 369

Query: 359 ADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNA 411
                  L+ +H GH   VN+ S++    WL+ S   DN IQ WK +  LV A
Sbjct: 370 -------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNLVEA 415

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  125 bits (315), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 177/409 (43%), Gaps = 60/409 (14%)

Query: 45  EEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----EE 98
           ++ Y  W  N  ++YE+++     WPSLT Q+ P  + ++    ++  + T+      E 
Sbjct: 22  QDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSFTSSLVPEDES 81

Query: 99  VNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIR--------ARY 148
           +   +++T+     A +   D  DE +   D+S+  +  K    E VIR        ARY
Sbjct: 82  LYITRISTLKHLSWASLNNFDL-DEMEFKPDNSNIKLPPKNLTTELVIRFPNGDCNRARY 140

Query: 149 MPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLA--------------- 193
           +P N ++IA  +  G++ IFDRT   +        F +     LA               
Sbjct: 141 LPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGENEAL 200

Query: 194 ---FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTS-------HDDIVNDVKWHEFES 243
              +N    G L+    D  V  WDI   K+   ++ +        +   ND  W    +
Sbjct: 201 TIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVWMPEHN 260

Query: 244 NVFGTVSEDKTLQVHDKR--VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLY 301
           ++F   SED  L + D R    +  +         N   F+  +  LLA+      I L+
Sbjct: 261 SLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIGNICLW 320

Query: 302 DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDAD 360
           D+R   +P++++  H  S++T+E++P+   ++ S+G D   + +WD              
Sbjct: 321 DIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA------------- 366

Query: 361 DGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
            G+ + + +H GH   VN+ S+N   PWL+ S  +DN IQ WK +  LV
Sbjct: 367 -GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNLV 414

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  125 bits (313), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 108/422 (25%), Positives = 188/422 (44%), Gaps = 67/422 (15%)

Query: 41  SLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE-- 97
           S  ++E Y  W  N  ++Y++++     WPSLT Q+ P  D    E  ++  + T+ +  
Sbjct: 16  SADLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKP 75

Query: 98  --EVNYL-KVATINLP--AGIAGLDQGDEEDEANDHSSFA-------IANKFPHIEEVIR 145
             E  Y+ +++T+     A +   D  + E +  + +++        I   FP+  E  R
Sbjct: 76  EDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPN-GECNR 134

Query: 146 ARYMPANSNIIATINGKGTISIFDRT------LEESKA----QVSTLAFHK--------- 186
           ARY+P N +IIA  +  G I IFDRT      + +SK     ++  L  H          
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMD 194

Query: 187 ------ENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILT-------SHDDIV 233
                      LA+N      LLS   +  + +WDI+       I+        S    V
Sbjct: 195 TSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSV 254

Query: 234 NDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPT--ASPFNTLSFSKHSRNLLAA 291
           NDV W     ++F   +E   + + D R + E +K          N+  F+  +  +LA+
Sbjct: 255 NDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGGVNSCKFNYKNSLILAS 314

Query: 292 AGVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQ 349
           A  + ++ L+D+R+M+ +P+  M  H  SV+T+E+SP+ D ++ ++G  D    +WD T+
Sbjct: 315 ADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR 373

Query: 350 IGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
                          E +  H GH   VN+ S++   PWL+ S   DN +  WK +  +V
Sbjct: 374 --------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWKPAENIV 419

Query: 410 NA 411
            +
Sbjct: 420 GS 421

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  124 bits (310), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 101/410 (24%), Positives = 182/410 (44%), Gaps = 58/410 (14%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--EVN 100
           ++E Y  W  N  ++Y +++     WPSLT Q+ P  D  +    ++  T T+ +  E  
Sbjct: 16  LQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTFTSSQLPEDE 75

Query: 101 YLKVATINLP-----AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARY 148
            L +A ++       + +   D  + E + ++ + F   N        FP+  +  RARY
Sbjct: 76  SLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPN-GDCNRARY 134

Query: 149 MPANSNIIATINGKGTISIFDRTLEESK----------AQVSTLAFHKEN------GYGL 192
           +P N +++A  +  G+I IF+RT   S+          A++ +     EN         +
Sbjct: 135 LPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEAVSI 194

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHD-------DIVNDVKWHEFESNV 245
           A+N   +G L S     ++ +WDI         L  ++       +  N+V W     ++
Sbjct: 195 AWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDSI 254

Query: 246 FGTVSEDKTLQVHDKRVRLEPVKKLPT----ASPFNTLSFSKHSRNLLAAAGVDSQIYLY 301
           F   SE   L + D R + E +K        +   N+  F+ ++  LLA+A    +I ++
Sbjct: 255 FAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLASADSTGKINMW 314

Query: 302 DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDAD 360
           D+R +         H  S++T+E++P+ + I+ ++G D   + IWD T  G         
Sbjct: 315 DIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWD-TANGQN------- 366

Query: 361 DGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVN 410
                 + +H GH   VN+ S++   PWLL+S   DN I  WK +  LV+
Sbjct: 367 ------IFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNLVD 410

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  122 bits (307), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 102/405 (25%), Positives = 181/405 (44%), Gaps = 57/405 (14%)

Query: 45  EEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----EE 98
           ++ Y LW  N  ++Y++++     WPSL+ Q+ P  D  S    L+F + T+      E 
Sbjct: 9   QQRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDEN 68

Query: 99  VNYLKVATI-NLP-AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARYM 149
           V    ++T+ ++P + +   D  + E + +  +     N        FPH  +  RA Y+
Sbjct: 69  VTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRATYL 127

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLA-------FHKENG------YGLAFNP 196
           P N ++I+T +  G++ IFDRT +  K+ +S L            NG        L +N 
Sbjct: 128 PQNPDLISTASSDGSVYIFDRT-KRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNR 186

Query: 197 HISGELLSGSDDTTVALWDIEAAKKPKSILT--SHDDI------VNDVKWHEFESNVFGT 248
            I G L S   +  + +WDI+  +K   I++  S D I       NDV W      +   
Sbjct: 187 QIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSI 246

Query: 249 VSEDKTLQVHDKRVRLEPVKKLPT---ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRD 305
             ED  + + D R      +  P+   AS  N   F+     L+A A  D  + L+D+R 
Sbjct: 247 AREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRK 306

Query: 306 MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQIGAEQSQDDADDGAP 364
           + +P+  ++  +  ++ +E++P    ++ + G  D    +W+            A +G  
Sbjct: 307 LHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLWN------------ASNG-- 351

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
           +L+  H GH   VN+ +++P   WL+ S   DN    WK + +LV
Sbjct: 352 QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRLV 396

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  122 bits (306), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/410 (22%), Positives = 180/410 (43%), Gaps = 61/410 (14%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----E 97
           ++E Y  W  N  ++Y++++     WPSL+ Q+    + ++    ++  + T+G     E
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 98  EVNYLKVATI-NLP-AGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVI--------RAR 147
            +N + ++T+ ++P A +   D   +E E    ++  +  K  H E+ I        RAR
Sbjct: 83  SINIMSISTLKHVPWASLNNFDM--DEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRAR 140

Query: 148 YMPANSNIIATINGKGTISIFDRT------------------LEESKAQVSTLAFHKENG 189
           Y+P N +IIA  +  GT+ IF+RT                    E +  V ++  +    
Sbjct: 141 YLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEA 200

Query: 190 YGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTS-------HDDIVNDVKWHEFE 242
             + +N    G L +   D  +  WD++      + +T+         +  NDV W    
Sbjct: 201 LSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLH 260

Query: 243 SNVFGTVSEDKTLQVHDKRVRLE--PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300
            ++     E   L ++D R   E   +         N   F+  +  ++A+A     +++
Sbjct: 261 DSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHI 320

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDA 359
           +D+R  +  +  +  H  S++T+E++P+ D I+ ++G D   + +WD+T           
Sbjct: 321 WDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD---------- 369

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
                EL+  H GH   VN+ S+N   PWL+ S   DN +Q W+ +  LV
Sbjct: 370 ----SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNLV 415

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  121 bits (303), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 98/405 (24%), Positives = 179/405 (44%), Gaps = 49/405 (12%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDG-QSPEQSLIFGTHTA-----GE 97
           V++ Y  W  N  ++Y++++     WPSL+ Q+ P     + +Q ++  + T+      E
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRILLSSFTSQQLPQDE 79

Query: 98  EVNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVI--------RAR 147
            +    ++T+N    + I   D   +E E    +S  + +K    E  I        R R
Sbjct: 80  SIYIGSISTMNHMKWSSINNFDM--DEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNRCR 137

Query: 148 YMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFH---KENG-------YGLAFNPH 197
           YMP N +II T +  G++ IFDRT   +K       F    + NG         LA+N  
Sbjct: 138 YMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGR-KFEIECRNNGDDEQDESLSLAWNYQ 196

Query: 198 ISGELLSGSDDTTVALWDIEAAKKPK---------SILTSHDDIVNDVKWHEFESNVFGT 248
           + G L +   +  V +WD+    K K         S++ ++   VNDV W    +++  +
Sbjct: 197 LEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANG--VNDVSWMVNHTSILAS 254

Query: 249 VSEDKTLQVHDKR--VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDM 306
             E   + + D R   +++ + +       N + F+  +  +L       Q+ ++D+RD 
Sbjct: 255 CGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIRDF 314

Query: 307 SSPLHVMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDADDGAP 364
             P+     G QD ++ ++++P    I+ ++      + IWD     A   Q+D++    
Sbjct: 315 KEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD-----ASGEQEDSNAENN 369

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
            L+ +H GH   VN+ S++   PW + S   DN I  WK +  LV
Sbjct: 370 MLLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANLV 414

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 103/411 (25%), Positives = 178/411 (43%), Gaps = 62/411 (15%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----E 97
           +++ Y  W  N  ++Y++++     WPSLT Q+    D  S    ++    T+      E
Sbjct: 18  LQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRILLSAFTSSQLPEDE 77

Query: 98  EVNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARY 148
            +   K++T+     A I   D  + E +  ++      N       +FP  +  I ARY
Sbjct: 78  AIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFPDGDCNI-ARY 136

Query: 149 MPANSNIIATINGKGTISIFDRTLEES--KAQVSTLAFHKENGY---------------- 190
           +P N ++IA  +  G+I IFDRT   S    Q   L  ++   Y                
Sbjct: 137 LPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENVENTNEAT 196

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPK-----SILTSHDDI--VNDVKWHEFES 243
            +++N    G L S      + LWD++     K      +L    D   VNDV WH    
Sbjct: 197 SISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNWHPSHD 256

Query: 244 NVFGTVSEDKTLQVHDKRVRLEPVK---KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300
           ++     E   + + D R+  E ++   K+      N+  F+ H  +LL +   + +I L
Sbjct: 257 SILAASGESNIIGLFDNRLGTEILRSNEKMHNGG-INSCKFNSHCDSLLISGDSEGRINL 315

Query: 301 YDMRDM-SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDD 358
           +D+R +   P+  +  H  S++T+E++P+ + I+ S+G D   + +WD++          
Sbjct: 316 WDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWDVS---------- 364

Query: 359 ADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
                 EL+  H GH   VN+ S+N    WL+ S   DN +Q WK +  LV
Sbjct: 365 ----TDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNLV 411

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  117 bits (293), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 99/418 (23%), Positives = 177/418 (42%), Gaps = 64/418 (15%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--EVN 100
           ++  Y  W  N  ++Y++++     WPSLT Q+ P  D  +    ++  ++T+ +  E  
Sbjct: 15  LQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDE 74

Query: 101 YLKVATINLPA-----GIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARY 148
            + VA+I+  A      +   D  + E + +  + F   N        FP   +  RARY
Sbjct: 75  NVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFPR-GDCNRARY 133

Query: 149 MPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYG----------------- 191
           MP N ++IA  +  G + +F+RT   ++      A   E  YG                 
Sbjct: 134 MPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEARRT 193

Query: 192 --------LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHD--------DIVND 235
                   LA+N H  G L        V +WD++      + ++  +          VND
Sbjct: 194 PVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGVND 253

Query: 236 VKWHEFESNVFGTVSE-DKTLQVHDKRVR--LEPVKKLPTASPFNTLSFSKHSRNLLAAA 292
           V W     ++     E   +L + D R +  +  ++    +   N   F+  +  LLA+ 
Sbjct: 254 VSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLAST 313

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSG-SDRRAIIWDLTQIG 351
               +  L+D+R +S+   V   H  SV+T+E++PH   ++ ++G SD    IWD T + 
Sbjct: 314 DSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD-TSLE 372

Query: 352 AEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
            E           + + +H+GH   VN+ +++   PWL+ S   DN +  WK +  LV
Sbjct: 373 IED----------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANLV 420

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  117 bits (292), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 105/424 (24%), Positives = 184/424 (43%), Gaps = 67/424 (15%)

Query: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAGE--- 97
           + ++E Y  W  N  ++Y++++     WPSLT Q+ P  D    E  ++  + T+ +   
Sbjct: 17  IDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKPE 76

Query: 98  -EVNYL-KVATINLP--AGIAGLDQGDEEDEAND-------HSSFAIANKFPHIEEVIRA 146
            E  Y+ K++T+     + +   D  + E +  +       H    I+  FP+  +  RA
Sbjct: 77  DETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPN-GDCNRA 135

Query: 147 RYMPANSNIIATINGKGTISIFDRT------LEESKAQ-------------------VST 181
           RY+P N +IIA  +  G I IFDRT      + +SK                     + T
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAMDT 195

Query: 182 LAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAK-------KPKSILTSHDDIVN 234
            +        LA+N      LLS   +  V +WDI+           P   + S    VN
Sbjct: 196 SSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGVN 255

Query: 235 DVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVK--KLPTASPFNTLSFSKHSRNLLAAA 292
           DV W     ++F   +E   + + D R + E ++  +       N+  F+  +  +LA+A
Sbjct: 256 DVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLASA 315

Query: 293 GVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQI 350
             + ++ L+D+R M+ SP+  M  H  S++T+E++P+   ++ ++G  D    +WD  + 
Sbjct: 316 DSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKLWDTAR- 373

Query: 351 GAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVN 410
                         E +  H GH   VN+ S++   PWL+ S   DN +  WK +  LV 
Sbjct: 374 -------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWKPAENLVG 420

Query: 411 ASPP 414
              P
Sbjct: 421 LEQP 424

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  115 bits (287), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 100/407 (24%), Positives = 176/407 (43%), Gaps = 57/407 (14%)

Query: 45  EEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----EE 98
           ++ Y  W  N  ++Y++++     WPSLT ++ P  D  +    L+  + T+      E 
Sbjct: 16  QQRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLSSFTSSQLPEDES 75

Query: 99  VNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVI------RARYMP 150
           +   +++T+     + +   D  + E +  + +     N    I   I      RARY+P
Sbjct: 76  IYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSNRARYLP 135

Query: 151 ANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLA----------------F 194
            N ++I+  +  G+I IFDRT   S    ST +   E    +A                +
Sbjct: 136 QNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSLDW 195

Query: 195 NPHISGELLSGSDDTTVALWDI----EAAKKPKSILTSHDDI----VNDVKWHEFESNVF 246
           N    G L S      + +WDI     +    ++ + S DD      ND+ W     ++ 
Sbjct: 196 NKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDSLL 255

Query: 247 GTVSEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
               E  T+ ++D R + +  K  P       N+  F+ H+  LLA+A     ++++D+R
Sbjct: 256 AACGESNTVAIYDTRSKSQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMWDIR 315

Query: 305 DMSS-PLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQIGAEQSQDDADDG 362
            +   P+  +S H  S++TV+++P+   II  +G  D    +WD            A +G
Sbjct: 316 KLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------ASNG 362

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
             +L+  H GH   VN+ ++N   PWL+ S   DN I  W+ S  LV
Sbjct: 363 --QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHLV 407

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  115 bits (287), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 99/413 (23%), Positives = 186/413 (45%), Gaps = 65/413 (15%)

Query: 44  VEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-DGQSPEQSLIFGTHTAG-----E 97
           V+  Y  W  N  ++Y++++     WPSLT Q+ P  D  S +  L+  + T+      E
Sbjct: 21  VQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLPEDE 80

Query: 98  EVNYLKVATINLP--AGIAGLDQGDEEDEANDHSSFAIAN-------KFPHIEEVIRARY 148
            V   K++T+     + +   D  + E + +        N       +FP+  +  R+RY
Sbjct: 81  SVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSIRFPN-GDCNRSRY 139

Query: 149 MPANSNIIATINGKGTISIFDRTL-----------EESKAQVSTLAFHKEN------GYG 191
           +P N ++IA  +  G++ IF++T            ++ +A++ + +   +N         
Sbjct: 140 LPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEAVS 199

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKK-------PKSILTSHDDIVNDVKWHEFESN 244
           L++N H  G L          +WD++   +       P+  +T   +  ND+ W     +
Sbjct: 200 LSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDS 259

Query: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF------NTLSFSKHSRNLLAAAGVDSQI 298
           +F    E   L + D R+  E  K++ + S +      NT  F+  +  L+A+A    +I
Sbjct: 260 MFIACGESNKLGLFDMRLNGE--KEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRI 317

Query: 299 YLYDMRDM-SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS-DRRAIIWDLTQIGAEQSQ 356
            L+D+R +   P+  M  H  S++T+E++P+   +  S+G  D    +WD + +G E   
Sbjct: 318 NLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLWDAS-VGKE--- 372

Query: 357 DDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
                     + +H GH   VN+ S++   PWL+AS   DN IQ W+ +  +V
Sbjct: 373 ----------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNIV 415

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 88/170 (51%), Gaps = 11/170 (6%)

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +NP  +  L+S S DTT  +WD++++   K+ L +HD  V DV++    + +F +   D 
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDG 299

Query: 254 TLQVHDKR-------VRLEPVKKL-PTASPFNTLSF--SKHSRNLLAAAGVDS-QIYLYD 302
           +++V D R       +   PV  L P  S F  L    S H  N++A    DS +I + D
Sbjct: 300 SVRVFDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILD 359

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGA 352
           MR+  SPL ++ GH  SV  +++ P    ++ S G D + + WDL +  A
Sbjct: 360 MRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTA 409

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 8/132 (6%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEES----KAQVSTLA 183
           S++       H  EV   R++  ++ + A+  G G++ +FD R+L  S    +  VS L 
Sbjct: 265 SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLN 324

Query: 184 FHKENGYGLAF--NPHISGELLS-GSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE 240
                   L    +PH    + +  +D   + + D+   + P  IL  H   VN +KWH 
Sbjct: 325 PDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHP 384

Query: 241 FESNVFGTVSED 252
            + NV  +  +D
Sbjct: 385 IKRNVLLSGGDD 396

 Score = 31.2 bits (69), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 7/97 (7%)

Query: 143 VIRARYMPANSNIIATING-KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE 201
           ++R    P + N++AT       I I D    ES   +  L  H  +   + ++P     
Sbjct: 332 LLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMI--LEGHSASVNQIKWHPIKRNV 389

Query: 202 LLSGSDDTTVALWDIE---AAKKPKSILTSHDDIVND 235
           LLSG DD  V  WD+    A+  P +  T  DDI  D
Sbjct: 390 LLSGGDDCQVLYWDLNKCTASSDPVAT-TKDDDIAMD 425

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 98/219 (44%), Gaps = 21/219 (9%)

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +NP     L+S S DTT  +WD+++A   K+ L +HD  V DV++    + +F +   D 
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 277

Query: 254 TLQVHDKRVRLE-------------PVKKLPTASP-FNTLSFSKHSRNLLAAAGVD-SQI 298
           +++V D R                 P    PT  P    L  S    N++A   +D S++
Sbjct: 278 SVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKV 337

Query: 299 YLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQD 357
            + DMR   SPL  +  H   +  +++ P    ++ S+  D + + WDL T + +E ++D
Sbjct: 338 LILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSESTKD 397

Query: 358 DADDGAPE-----LMMMHAGHRSPVNEFSFNPQIPWLLA 391
              D  P+       M +A     VN   + PQ  W  A
Sbjct: 398 TTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 55/144 (38%), Gaps = 22/144 (15%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEES----------------KAQVST 181
           H  EV   R++  ++ + A+  G G++ +FD R L  S                   V  
Sbjct: 253 HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPP 312

Query: 182 LAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEF 241
                E      F+P++        D + V + D+ +   P   L +H   +N +KWH  
Sbjct: 313 ALLRLEPS---PFDPNVIATF--AIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPT 367

Query: 242 ESNVFGTVSEDKTLQVHDKRVRLE 265
             NV  + S+D  +   D    L+
Sbjct: 368 RRNVLLSASDDCQVLYWDLNTHLD 391

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 275 PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIIC 334
           P  +  ++    NLL ++ +D+   ++D++  +     +  H   V  V F   +  +  
Sbjct: 212 PITSFHWNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFA 271

Query: 335 SSGSDRRAIIWDLTQIGAEQ--SQDDADDGAPEL 366
           S G D    ++DL  +       +    DGAP+L
Sbjct: 272 SCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDL 305

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 96/398 (24%), Positives = 176/398 (44%), Gaps = 55/398 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG---EEVNYLKVATIN 108
           P +YE +    + WP LT+  +P    ++ ++  QS++  T T     +E   + +A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 109 LPAGIAGLDQGDEEDEANDHSSF--AIANK-FPHIEEVIRARYMP-ANSN---IIATING 161
           L   +   D  ++++E  D       I N+  P  +   R +  P A SN   + AT++ 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 162 KGTISIFDRTLEE-------------SKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGS 206
            G + I+D   +              +K  + T+  H    GYGL ++P I +G LLSG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 207 DDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
               + L     ++     +S   S+++ + D++W   ES VF T + D  +++ D R +
Sbjct: 294 CSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRSK 353

Query: 264 L-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR-------DMSSPLHVMS 314
             +P   +  + +  N +S+S     LLA+   +    ++D+R       D   P+    
Sbjct: 354 KHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQYD 413

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT---------QIGAEQSQDDADDGAPE 365
            H+ ++T++ F+P  + I+     D    +WDL+         Q  AE  +    D  P+
Sbjct: 414 FHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE--LQDIPPQ 471

Query: 366 LMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 472 LLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNVWK 506

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 96/397 (24%), Positives = 178/397 (44%), Gaps = 53/397 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLPSDGQSPE-----QSLIFGTHTAG-----EEVNYLKVA 105
           P +YE +    + WP LT+  +P DG   E     QS++  T T        E+  LK++
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIP-DGLGTERRNYPQSILMATATQASKKKENELMVLKLS 176

Query: 106 TINLP-AGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVI-RARYMPANSN---IIATIN 160
            +N         ++ D+ED+ ++ S   I N+   + +   R +  P  S+   + AT++
Sbjct: 177 QLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMS 236

Query: 161 GKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSG 205
             G + I D             +  + +K  + T+  H    GYGL ++P I +G LL+G
Sbjct: 237 ENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTG 296

Query: 206 SDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
                V L     +K     +    S++  + D++W   ES VF T   D  +++ D R 
Sbjct: 297 DCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTRS 356

Query: 263 RLEP--VKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHVM 313
           +     +    +A+  N +S+++    LLA+   D +  ++D+R +S        P+   
Sbjct: 357 KKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPVAQY 416

Query: 314 SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------PEL 366
             H+ ++T++ F+P  + II  +  D    +WDL+ +   E+ +  A +        P+L
Sbjct: 417 DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQL 476

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           + +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 477 LFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 93/394 (23%), Positives = 182/394 (46%), Gaps = 49/394 (12%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHT--AGEEVNYLKVATI-N 108
           P +YE +    + WP L++  +P    S+ ++  QS++  T T  + ++ N L V ++ N
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 109 LPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVI-RARYMPANSN----IIATINGKG 163
           L   +   ++ +EE+E +D     I N+   + +   R +  P  S     + AT++  G
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 164 TISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGSDD 208
            + IFD             +  ++SK  V T+  H    GYGL ++P I SG LLSG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 209 TTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRL- 264
             + L     +K     ++    ++  + D++W + ES VF T   D  ++V D R +  
Sbjct: 299 GQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKKH 358

Query: 265 EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHVMSGH 316
           +P   +  + +  N +S+++    LLA+   +    ++D+R  +        P+   + H
Sbjct: 359 KPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNFH 418

Query: 317 QDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------PELMMM 369
           + ++T++ F+P  + I+     D    +WDL+ +   E+ +   ++        P+L+ +
Sbjct: 419 KGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLFV 478

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           H   +  + +  ++ QIP  L ST  D  +  WK
Sbjct: 479 H--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 176/397 (44%), Gaps = 54/397 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG---EEVNYLKVATIN 108
           P +YE +    + WP LT+  +P    S+ ++  QS++  T T      E   + +A  N
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 109 LPAGIAGLDQGDEEDEANDHSSFAIANK--FPHIEEVIRARYMP-ANSN---IIATINGK 162
           L   +   D  +++DE  +    A+      P  +   R +  P A SN   + AT++  
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMSEN 233

Query: 163 GTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGSD 207
           G + I+D             +  + +K  + T+  H    GYGL ++P I +G LLSG  
Sbjct: 234 GDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSGDC 293

Query: 208 DTTVALWDIEAA-----KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
              +       +     K+P ++  S++  + D++W   ES VF T   D  +++ D R 
Sbjct: 294 SGQIYFTQRHTSRWVTDKQPFTV--SNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRS 351

Query: 263 RL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR-------DMSSPLHVM 313
           +  +P   +  + +  N +S+S     LLA+   +    ++D+R       D   P+   
Sbjct: 352 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQPVAQY 411

Query: 314 SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT------QIGAEQSQ-DDADDGAPEL 366
             H+ ++T++ F+P  + I+     D    +WDL+      +I  + ++  +  +  P+L
Sbjct: 412 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQL 471

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           + +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 472 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 83/167 (49%), Gaps = 13/167 (7%)

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +NP  +  L+S S DTT  +WD+E++   K+ L +HD  V DV++    + +F +   D 
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 315

Query: 254 TLQVHDKR------------VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDS-QIYL 300
           +++V D R             +++P      ++    L  S H  N++A    DS +I +
Sbjct: 316 SVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIII 375

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
            DMR+  +P+  + GH  S+  +++ P    I+ S   D + + WDL
Sbjct: 376 LDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 58/136 (42%), Gaps = 14/136 (10%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLE------ESKAQVST 181
           S++       H  EV   R++  ++ + A+  G G++ +FD R+L       E  AQ+  
Sbjct: 281 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDP 340

Query: 182 LAFHKENGYGLAF-----NPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDV 236
            +    +   L       +P+I       +D   + + D+   + P   L  H   +N +
Sbjct: 341 SSSAAASNALLRLEPSPHDPNIVATF--AADSNKIIILDMRNPETPVLTLQGHSSSLNQI 398

Query: 237 KWHEFESNVFGTVSED 252
           KWH  E N+  + ++D
Sbjct: 399 KWHPTERNILLSCADD 414

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 93/401 (23%), Positives = 169/401 (42%), Gaps = 60/401 (14%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAGEEVNYLKVATINLPA 111
           P +Y+ +    + WP LT+  +P    S  ++  QSL+  T T        ++  ++L  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 112 GIAGLDQGDEEDEANDHSSFA--------IANKFPHIEEVI-RARYMP-ANSN---IIAT 158
               L + D  DE N              I N+   + +   R R  P A SN   + AT
Sbjct: 179 LAKTLVKDD--DEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTAT 236

Query: 159 INGKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELL 203
           ++  G + IFD             +  + SK  V T+  H    GY L ++P I +G LL
Sbjct: 237 MSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALL 296

Query: 204 SGSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           +G     + L     +K     +     ++  V D++W   E+ VF +   D  +++ D 
Sbjct: 297 TGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDT 356

Query: 261 RVRL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLH 311
           R +  +P   +  + +  N +S+++    LLA+   +    ++D+R  +        P+ 
Sbjct: 357 RSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNVQPVA 416

Query: 312 VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT---------QIGAEQSQDDADDG 362
               H+ ++T++ F+P  + II  +  D    +WDL+         Q  AE  +   +  
Sbjct: 417 QYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKE--LESI 474

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
            P+L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 475 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 95/194 (48%), Gaps = 27/194 (13%)

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +NP  +  L+S S DTT  +WD++++   ++ L +HD  V DVK+    + +F +   D 
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDG 289

Query: 254 TLQVHDKRV------------------RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVD 295
           +++V D R                    L   +K P+A     L  S    N++A   +D
Sbjct: 290 SVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSA--LLRLQPSPSDPNVMATFALD 347

Query: 296 SQ-IYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL------T 348
           S+ I + DMR+  SP+  + GH  +V  +++ P    ++ S G D + + WDL      T
Sbjct: 348 SKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPT 407

Query: 349 QIGAEQSQDDADDG 362
            + A +++ +A+DG
Sbjct: 408 SLSANENKVNANDG 421

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 92/236 (38%), Gaps = 24/236 (10%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEES---------KAQ 178
           S++       H  EV   +++  ++ + A+  G G++ +FD R+L  S         +  
Sbjct: 255 SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNG 314

Query: 179 VSTLAFHKENGYGL------AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI 232
             TL  ++++   L        +P++        D  ++ + D+     P   L  H   
Sbjct: 315 SDTLTDNEKSPSALLRLQPSPSDPNVMATF--ALDSKSILILDMRNPGSPVLTLEGHSAA 372

Query: 233 VNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAA 292
           VN +KWH  +SNV  +  +D  +   D    L P       +  N        + + A  
Sbjct: 373 VNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPTSLSANENKVNANDGPISGQQINAPV 432

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH-TDGIICSSG---SDRRAII 344
              +Q  + ++ D+  P    S  Q  +  + + PH  D   C SG    + RA++
Sbjct: 433 SQWNQSNVQNVLDV--PAMCYSNRQQEINNIAWRPHGGDWFGCVSGKKFQNVRAVV 486

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/77 (20%), Positives = 35/77 (45%)

Query: 275 PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIIC 334
           P  +  ++    NLL ++ +D+   ++D++  +     +  H   V  V+F  H+  +  
Sbjct: 224 PVTSFHWNPIDTNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVFDVKFLAHSTQLFA 283

Query: 335 SSGSDRRAIIWDLTQIG 351
           S G D    ++DL  + 
Sbjct: 284 SCGGDGSVRVFDLRSLA 300

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 114/265 (43%), Gaps = 58/265 (21%)

Query: 140 IEEVIRARYMPA--NSNIIATINGKGTISIFDRTLEESKAQ----VSTLAFHKENGYGLA 193
           I  V   ++MP+   S  IAT     ++ I+    EE+K +    +S   FHK++    A
Sbjct: 156 IYPVSNIQWMPSAFRSRKIAT--ASDSLRIWSLNTEENKLEEQLNLSLCKFHKQHPNNKA 213

Query: 194 F-------------NPHISGE----------------LLSGSDDTTVALWDIEAAKKPKS 224
           F             NP + GE                L+S S DTT  +WD++++   K+
Sbjct: 214 FVGLSQIPTKTSDVNPSVLGEFPPITSFHWNPVDTNILISSSIDTTCIVWDLQSSNYVKT 273

Query: 225 ILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR------VRLEPVKKLP------- 271
            L +HD  V DV++    + +F +   D +++V D R      +  EP    P       
Sbjct: 274 QLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSS 333

Query: 272 -------TASPFNTLSFSKHSRNLLAAAGVDS-QIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                   +     L  S H  N+LA   + S +I + DMR+  SPL V++GH  S+  +
Sbjct: 334 RSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQI 393

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLT 348
           ++ P     + S   D + + WD++
Sbjct: 394 KWHPTKKNTLISCSDDCQVLFWDIS 418

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 53/134 (39%), Gaps = 22/134 (16%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHK----------- 186
           H  EV   R++  ++ + A+  G G++ +FD R L  S       A              
Sbjct: 278 HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDS 337

Query: 187 --ENGYGL------AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
             EN + L        +P++       S++  + + D+     P  +L  H   +N +KW
Sbjct: 338 TDENSHALLRLEPSPHDPNVLATFAIASNE--ILILDMRNPDSPLVVLNGHSASINQIKW 395

Query: 239 HEFESNVFGTVSED 252
           H  + N   + S+D
Sbjct: 396 HPTKKNTLISCSDD 409

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 91/398 (22%), Positives = 176/398 (44%), Gaps = 53/398 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG-----EEVNYLKVAT 106
           P +YE +    + WP +T+  +P    S+ ++  QS++  T T        E+  LK++ 
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 107 INLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVI-RARYMPANSN------IIATI 159
           +          + +EE++ +D     I N+   + +   R +  P  S+      + AT+
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILTATM 241

Query: 160 NGKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLS 204
           +  G + IFD             +  + +K  + T+  H    GY L ++P I +G LL+
Sbjct: 242 SENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGALLT 301

Query: 205 GSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           G     V L     +K     +    +++  V D++W   ES VF +   D  ++V D R
Sbjct: 302 GDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDTR 361

Query: 262 VRL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHV 312
            +  +P   +  + +  N +S+S+    LLA+   +    ++D+R  S       SP+  
Sbjct: 362 SKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSNNTSPVAQ 421

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------PE 365
              H+ ++T++ F+P  + I+  +  D    +WDL+ +   E+ +  A +        P+
Sbjct: 422 YDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQ 481

Query: 366 LMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 482 LLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNIWK 516

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 179/397 (45%), Gaps = 52/397 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG-----EEVNYLKVA- 105
           P +YE +    L WP LT+  +P    S+ ++  QS++  T T        E+  LK++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 106 -TINLPAGIAGLDQGDEEDEANDHSSFAIANK-FPHIEEVIRARYMP----ANSNIIATI 159
            T  L      +D  D++++ ++     + N+  P  +   R R  P        + +T+
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 160 NGKGTISIFDRTLEE-------------SKAQVSTLAFHKE-NGYGLAFNPHI-SGELLS 204
           +  G + I+D T +              +K  + T+  H    GYGL ++P I +G LL+
Sbjct: 239 SENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLT 298

Query: 205 GSDDTTVALWDIEAAK--KPKSILT-SHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           G     V L     +K    K+  T  ++  + D++W   ES VF T   D  +++ D R
Sbjct: 299 GDCSGMVYLTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 358

Query: 262 VRL-EPV-KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSS------PLHVM 313
            +  +PV   + + +  N +S+++    LLA+        ++D+R  S       P+   
Sbjct: 359 SKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVAQY 418

Query: 314 SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT------QIGAEQSQ-DDADDGAPEL 366
             H+ ++T++ F+P  + I+  +  D    +WDL+      +I  ++++  + +   P+L
Sbjct: 419 DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIPPQL 478

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           + +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 479 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 138/333 (41%), Gaps = 70/333 (21%)

Query: 53  SNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEVNYLKVATINLPAG 112
           SN  + +E V+E  +T+P   IQWLPS                    N  K+AT +    
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPS------------------VPNPRKLATSSECLR 231

Query: 113 IAGLDQGDEEDEANDHSSF---AIANKFPH------IEEVIRARYMPANSNIIATINGKG 163
           I  LD     D + D+SS     I+N   H      + E +       N      I    
Sbjct: 232 IWSLD-----DNSMDNSSVFNNNISNNSRHNTYKKSLTEQVNLSLCKYNEQ--HQIINNS 284

Query: 164 TISIFDRTLEESKAQVSTL-AFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKP 222
           T S+ +++      Q+  + +FH        +N   +  L+S S DTT  +WD++++   
Sbjct: 285 TNSVSNKSNARLLGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDLQSSNYV 336

Query: 223 KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR------VRLEPVKKLPTASPF 276
           K+ L +HD  V DVK+    + +F +   D +++V D R      +  E    L   + F
Sbjct: 337 KTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNNTF 396

Query: 277 NT--------------------LSFSKHSRNLLAAAGVDSQ-IYLYDMRDMSSPLHVMSG 315
           N                     L  S    NL+A  G+D + I + DMR+   P+ V+SG
Sbjct: 397 NNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVLSG 456

Query: 316 HQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT 348
           H  SV  +++ P    ++ S G D + + WDL 
Sbjct: 457 HSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLN 489

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 62/165 (37%), Gaps = 30/165 (18%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHKE 187
           S++       H  EV   +++  ++ + A+  G G+I +FD R L+ S     T    + 
Sbjct: 333 SNYVKTQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQG 392

Query: 188 NGYGLAFNPHISGEL-------LS-------------------GSDDTTVALWDIEAAKK 221
           N     FN  ++ ++       LS                   G D   + + D+     
Sbjct: 393 NN---TFNNDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGV 449

Query: 222 PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEP 266
           P  +L+ H   VN +KWH  +  V  +  +D  +   D    L P
Sbjct: 450 PVLVLSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDLNSELNP 494

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/397 (23%), Positives = 177/397 (44%), Gaps = 54/397 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG---EEVNYLKVATIN 108
           P +YE +    + WP LT+  +P    S+ ++  QS++  T T     +E   + +A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 109 LPAGIAGLDQGDEEDEANDHSSFAIA--NKFPHIEEVIRARYMP-ANSN---IIATINGK 162
           L   +   +  +E++E +D     I      P  +   R +  P A SN   + AT++  
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSEN 233

Query: 163 GTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGSD 207
           G + I+D             +  + +K  + T+  H    GYGL ++P I +G LLSG  
Sbjct: 234 GDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSGDC 293

Query: 208 DTTVALWDIEAA-----KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
              V       +     K+P ++  S++  + D++W   ES VF T   D  +++ D R 
Sbjct: 294 SGQVYFTQRHTSRWVTDKQPFTV--SNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTRS 351

Query: 263 RL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR-------DMSSPLHVM 313
           +  +P   +  + +  N +S+S     LLA+   +    ++D+R       D   P+   
Sbjct: 352 KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQPVAQY 411

Query: 314 SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT------QIGAEQSQ-DDADDGAPEL 366
             H+ ++T++ F+P  + I+     D    +WDL+      +I  + ++  +  +  P+L
Sbjct: 412 DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEIPPQL 471

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           + +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 472 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/401 (22%), Positives = 164/401 (40%), Gaps = 59/401 (14%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAGEEVNYLKVATINLPA 111
           P +YE +    + WP +T+  +P    S+ +S  QSL+  T T        ++  + L  
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 112 GIAGLDQGDEEDEANDHSSFAIANKFPHIEE--------VIRARYMPANSN----IIATI 159
               L + D E+   D      A+  P IE           R +  P  ++    + AT+
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQEVLTATM 237

Query: 160 NGKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLS 204
              G + +FD             +  + S+  + T+  H    GYGL ++P I +G LL+
Sbjct: 238 CENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALLT 297

Query: 205 GSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           G     + L     +K     +    +++  V D++W   ES VF T   D  +++ D R
Sbjct: 298 GDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTR 357

Query: 262 VRLEP--VKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHV 312
            +     +    + +  N +S+++    LLA+   +    ++D+R  S        P+  
Sbjct: 358 SKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEGVQPVAQ 417

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGA--------- 363
              H+  +T++ F+P  D ++  +  D    +WDL+    E   D+              
Sbjct: 418 YDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLS---VEADDDEIQQQTKEYKELQKI 474

Query: 364 -PELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
            P+L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 475 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 512

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/396 (21%), Positives = 174/396 (43%), Gaps = 51/396 (12%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAGEEVNYLKVATINLPA 111
           P +YE +    + WP +T+  +P    S  ++  QSL+  T T   + N  ++  + +  
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQ 186

Query: 112 GIAGLDQGDEEDEANDHSSF-----AIANKFPHIEEVI-RARYMP----ANSNIIATING 161
               L + DE++   +          I N+   +++   R +  P    A   + +T++ 
Sbjct: 187 LAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPFANAAQEVLCSTMSE 246

Query: 162 KGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGS 206
            G + IFD             +  +++K  + T+  H    GY   ++P I +G +LSG 
Sbjct: 247 NGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAMLSGD 306

Query: 207 DDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
               V L     +K     ++   +++  + D++W   ES VF +   D  +++ D R +
Sbjct: 307 CSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSK 366

Query: 264 L-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHVMS 314
             +P   +  + +  N +S+S+    LLA+   D    ++D+R  +       SP+    
Sbjct: 367 KHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNASTASPVAQYQ 426

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------PELM 367
            H+ ++T++ F+P  + II  +  D    +WDL+ +   E+ +  A +        P+L+
Sbjct: 427 FHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLL 486

Query: 368 MMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
            +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 487 FVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 519

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 56/130 (43%), Gaps = 7/130 (5%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
           L +S+    + A+ G+D  I ++D R     P   +      V  + +S     ++ S  
Sbjct: 339 LQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGD 398

Query: 338 SDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDN 397
            D    +WDL Q   +    +A   +P  +  +  H+  +   SFNP    ++A   EDN
Sbjct: 399 DDGTWGVWDLRQFTPQ----NASTASP--VAQYQFHKGAITSISFNPLDESIIAVASEDN 452

Query: 398 VIQAWKVSMK 407
            +  W +S++
Sbjct: 453 TVTLWDLSVE 462

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 92/396 (23%), Positives = 175/396 (44%), Gaps = 51/396 (12%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG-----EEVNYLKVAT 106
           P +YE +    L WP L++  +P    S+ ++  QSL+  T T        E+  LK++ 
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 107 INLPAGIAGLDQGDEEDEANDHSSFAIANK-FPHIEEVIRARYMPANS----NIIATING 161
           +         D  +E+D+ ++     + N+  P  +   R +  P  S     + A+++ 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSE 246

Query: 162 KGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNP-HISGELLSGS 206
            G + IFD             +  + +K  + T+  H    GY L ++P + SG LL+G 
Sbjct: 247 NGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGD 306

Query: 207 DDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
               V L     +K      +    ++  + D+++   E+ VF T   D  +++ D R +
Sbjct: 307 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSK 366

Query: 264 L-EPVKKLPTASP-FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHVMS 314
             +P   +  +S   N +S+++    LLA+   +    ++D+R  S       SP+   S
Sbjct: 367 KHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYS 426

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------PELM 367
            H+ ++T++ F+P  D II  +  D    +WDL+ +   E+ +  A +        P+L+
Sbjct: 427 FHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLL 486

Query: 368 MMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
            +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 487 FVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 519

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 9/131 (6%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
           + FS+    + A  G D  I ++D R     P   +      V  + ++    G + +SG
Sbjct: 339 IQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKI-GYLLASG 397

Query: 338 SDRRAI-IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEED 396
            D     +WDL Q     S ++A   +P  +  ++ H+  +   +FNP    ++A   ED
Sbjct: 398 DDNGTWGVWDLRQF----SPNNAASVSP--VAQYSFHKGAITSIAFNPLDDSIIAVASED 451

Query: 397 NVIQAWKVSMK 407
           N +  W +S++
Sbjct: 452 NTVTLWDLSVE 462

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 90/395 (22%), Positives = 172/395 (43%), Gaps = 50/395 (12%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG-----EEVNYLKVAT 106
           P +YE +    L WP +T+  +P    S+ ++  QS++  T T        E+  LK++ 
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 107 INLPAGIAGLDQGDEEDEANDHSSFAIANK-FPHIEEVIRARYMPANSN----IIATING 161
           ++        ++ ++ED +++ S   + ++  P  +   R R  P  S+    + AT++ 
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMSE 239

Query: 162 KGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGS 206
            G + IFD             +  + +K  + T+  H    GY L ++P I SG LL+G 
Sbjct: 240 NGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTGD 299

Query: 207 DDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
               V       +K     +    S++  + D++W   E+ VF T   D  ++V D R +
Sbjct: 300 CSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSK 359

Query: 264 LE--PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS------SPLHVMSG 315
                +    + +  N +S+++    LLA+   +    ++D+R  S       P+     
Sbjct: 360 KHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQYDF 419

Query: 316 HQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG--AEQSQDDADDG-----APELMM 368
           H+ ++T++ F P  + I+  +  D    +WDL+      E  Q  A+        P+L+ 
Sbjct: 420 HKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQLLF 479

Query: 369 MHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 480 VH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 511

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 97/400 (24%), Positives = 176/400 (44%), Gaps = 59/400 (14%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG---EEVNYLKVATIN 108
           P +YE +    + WP LT+  +P    S+ ++  QS++  T T     +E   + +A  N
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 109 LPAGIAGLDQGDEEDEANDHSSF--AIANK-FPHIEEVIRARYMP-ANSN---IIATING 161
           L   +   D   E+DE +D       I N+  P  +   R +  P A SN   + AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 162 KGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSGS 206
            G + I++             +  + +K  + T+  H    GYGL ++P I +G LLSG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 207 DDTTVALWDIEAA-----KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
               +       +     K+P ++  S++  + D++W   ES VF T   D  +++ D R
Sbjct: 295 CSGQIYFTQRHTSRWVTDKQPFTV--SNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTR 352

Query: 262 VRL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR-------DMSSPLHV 312
            +  +P   +  + +  N +S+S     LLA+   +    ++D+R       D   P+  
Sbjct: 353 SKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQ 412

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT---------QIGAEQSQDDADDGA 363
              H+ ++T++ F+P  + I+     D    +WDL+         Q  AE  +    +  
Sbjct: 413 YDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKE--LQEIP 470

Query: 364 PELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           P+L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 471 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 112/268 (41%), Gaps = 64/268 (23%)

Query: 140 IEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHIS 199
           I  V R ++MP +S  +AT +    I      L+E +  +S + + K  G G   N H  
Sbjct: 107 IYPVSRIQWMPMSSEKLATCSDSLRIWSLGDQLKE-QVNLSLVKYGK--GVGDVANGHTL 163

Query: 200 GEL----------------LSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFES 243
           G+L                LS S DTT  +WD++A+   K+ L +HD  V D K+    S
Sbjct: 164 GKLPPVTSFDWNSIDTNIILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQSS 223

Query: 244 NVFGTVSEDKTLQVHDKR------VRLEPVKKLPTASPFNTLSFSK------HSR----- 286
           N+F +   D +++V D R      +  EP  ++ T +P + +  S       H+R     
Sbjct: 224 NLFASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTP-SQIQLSAQGHDDGHARKNNQN 282

Query: 287 --------------------------NLLAAAGVDSQIY-LYDMRDMSSPLHVMSGHQDS 319
                                     N+LA    DS +  + DMR   SP+  ++GH  +
Sbjct: 283 AAETSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCA 342

Query: 320 VTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           +  + + P    ++ + G D + + WDL
Sbjct: 343 LNQLRWHPSKPNVLATCGDDCQILYWDL 370

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 85/190 (44%), Gaps = 26/190 (13%)

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +NP     L+S S DTT  +WD++++   ++ L +HD  V DV++    + +F +   D 
Sbjct: 251 WNPVDPNLLISSSIDTTCIVWDLQSSNYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDG 310

Query: 254 TLQVHDKRV---------------RLEPV--------KKLPTASPFNTLSFSKHSRNLLA 290
           +++V D R                 L+P             T  P   L  S    N++A
Sbjct: 311 SVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIA 370

Query: 291 AAGVDS-QIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349
              +DS ++ + DMR+  SP+ V+ GH  +V  + + P    ++ S   D + + WDL  
Sbjct: 371 TFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDLNN 430

Query: 350 --IGAEQSQD 357
             +G    QD
Sbjct: 431 YIMGHPTDQD 440

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 55/137 (40%), Gaps = 25/137 (18%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-----------------RTLEESKAQVST 181
           H  EV   R++   + + ++  G G++ +FD                  TL+ + A  S+
Sbjct: 286 HDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSS 345

Query: 182 LAFHKENGYGL------AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVND 235
            A   + G  L       F+P++        D   V + D+     P  +L  H   VN 
Sbjct: 346 SAADSDTGVPLLRLEPSPFDPNVIATF--AIDSPRVLILDMRNPGSPVLVLEGHSAAVNQ 403

Query: 236 VKWHEFESNVFGTVSED 252
           ++WH  + NV  + ++D
Sbjct: 404 MRWHPSKRNVLLSCADD 420

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 89/398 (22%), Positives = 174/398 (43%), Gaps = 55/398 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAG-----EEVNYLKVAT 106
           P +YE +    L WP L++  +P    S+ ++  QSL+  T T        E+  LK++ 
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 107 INLPAGIAGLDQGDEEDEANDHSSFAIANK-FPHIEEVIRARYMPANS----NIIATING 161
           +         ++ +++D+ ++     + N+  P  +   R +  P  S     + AT++ 
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 162 KGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNP-HISGELLSGS 206
            G + IFD             +  + +K  + T+  H    GY L ++P + SG LL+G 
Sbjct: 246 NGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTGD 305

Query: 207 DDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
               V L     +K      +    ++  + D+++   E+ VF +   D  +++ D R +
Sbjct: 306 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSK 365

Query: 264 LE--PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHVMS 314
                +    +A+  N +S+++    LLA+   +    ++D+R  S       SP+   +
Sbjct: 366 KHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQYN 425

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT---------QIGAEQSQDDADDGAPE 365
            H+ ++T++ F+P  D II  +  D    +WDL+         Q  AE  +    +  P+
Sbjct: 426 FHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRE--LQEIPPQ 483

Query: 366 LMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 484 LLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 518

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 58/131 (44%), Gaps = 9/131 (6%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
           + FS+    + A+ G D  I ++D R     P   +      V  + ++    G + +SG
Sbjct: 338 IQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKI-GYLLASG 396

Query: 338 SDRRAI-IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEED 396
            D  +  +WDL Q     S + A   +P  +  +  H+  +   SFNP    ++A   ED
Sbjct: 397 DDNGSWGVWDLRQF----SPNTAASTSP--VAQYNFHKGAITSISFNPLDDSIIAVASED 450

Query: 397 NVIQAWKVSMK 407
           N +  W +S++
Sbjct: 451 NTVSLWDLSVE 461

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 93/397 (23%), Positives = 172/397 (43%), Gaps = 53/397 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAGEEVNYLKVATINLPA 111
           P +YE +    L WP +T+  +P    S+ ++  QS++  T T   +    ++  + L +
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKL-S 183

Query: 112 GIAGLDQGDEEDEANDHSSFAIANKFPHIE-EVIRAR----------YMPANSNIIA-TI 159
            +A     DE+D A D       +  P IE E I+ R          +   +  ++A T+
Sbjct: 184 QLAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATM 243

Query: 160 NGKGTISIFD-----RTLEESKAQVSTLAFHKE---------NGYGLAFNPHI-SGELLS 204
           +  G   IFD     +       QV   A   +          GYGL ++P I +G LL+
Sbjct: 244 SENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLT 303

Query: 205 GSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           G     V L    ++K     +     ++  + D+KW   E+ VF T   D  +++ D R
Sbjct: 304 GDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIR 363

Query: 262 VRL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS------SPLHVM 313
            +  +P   +  + +  N +S+++    LLA    +    ++D+R  S      SP+   
Sbjct: 364 SKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVAQY 423

Query: 314 SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT------QIGAEQSQ-DDADDGAPEL 366
             H+ ++T++ F+P  + II  +  D    +WDL+      +I  + ++  +     P+L
Sbjct: 424 DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIPPQL 483

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           + +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 484 LFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 517

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 136/302 (45%), Gaps = 51/302 (16%)

Query: 145 RARYMPANSN-----IIATINGKGTISIFD-------------RTLEESKAQVSTLAFHK 186
           R +  P  +N     + AT++  G + IFD             +  ++SK  + T+  H 
Sbjct: 229 RLKVTPFATNNNQEILTATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHG 288

Query: 187 E-NGYGLAFNPHI-SGELLSGSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEF 241
              G+GL ++P I SG LL+G     + L     +K   + +S    ++  + D++W + 
Sbjct: 289 NVEGFGLDWSPLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKT 348

Query: 242 ESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP------FNTLSFSKHSRNLLAAAGVD 295
           E  VF T   D  +++ D R +    K  P  S        N +S+++    LLA+ G D
Sbjct: 349 EQTVFATAGCDGYIRIWDTRSK----KHKPAISTRASNVDVNVISWNEKMEYLLAS-GDD 403

Query: 296 SQIY-LYDMRDMS------SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT 348
             ++ ++D+R  S      SP+     H+ ++T++ F+P  +  +  +  D    +WDL+
Sbjct: 404 KGVWGVWDLRQFSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLS 463

Query: 349 ------QIGAEQSQ-DDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQA 401
                 +I  +  +  + +   P+L+ +H   +  V +  ++ QIP  L ST  D  +  
Sbjct: 464 VEADDEEIKQQTHETKELEQIPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNV 520

Query: 402 WK 403
           WK
Sbjct: 521 WK 522

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 95/400 (23%), Positives = 181/400 (45%), Gaps = 56/400 (14%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHT--AGEEVNYLKVATI-N 108
           P +YE +    + WP LT+  +P    S+ ++  QSL+  T T  + ++ N L V ++ N
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 109 LPAGIAGLDQGDEEDEANDHSSFAIA------NKFPHIEEVIRARYMP-ANSN---IIAT 158
           L   +   D+ D+EDE ++ +              P  +   R +  P ANS+   + AT
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 159 INGKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELL 203
           ++  G + IFD             +  + +K  + T+  H    GY L ++P I +G LL
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 204 SGSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           +G     +       +K     +    S++  + D++W   E  VF +   D  +++ D 
Sbjct: 293 TGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDT 352

Query: 261 RVRL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIY-LYDMRDMS-------SPL 310
           R +  +P   +  + +  N +S+S     LLA+ G D+ ++ ++D+R  S        P+
Sbjct: 353 RSKKHKPAISVKASNTDVNVISWSDKLGYLLAS-GDDNGVWGVWDLRQFSPDTANSVQPV 411

Query: 311 HVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------ 363
                H+ ++T++ F+P  + I+  +  D    +WDL+ +   E+ +  A +        
Sbjct: 412 AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIP 471

Query: 364 PELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           P+L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 472 PQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWK 508

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 80/166 (48%), Gaps = 20/166 (12%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           ++S S DTT  +WD++++   K+ L +HD  V DV++    + +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 262 ------VRLEPVKKLPTASPFNT-------------LSFSKHSRNLLAAAGVDS-QIYLY 301
                 +  EP     + +   T             L  S +  N+LA    DS +I + 
Sbjct: 319 SLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIIL 378

Query: 302 DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           DMR+  SP+  + GH  SV  +++ P    ++ S G D + + WDL
Sbjct: 379 DMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 54/133 (40%), Gaps = 21/133 (15%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESK------------AQVSTLAFH 185
           H  EV   R++  ++ + A+  G G++ +FD R+L  S             A   T+   
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPS 345

Query: 186 KENGYGL------AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
            +    L       ++P++       +D   + + D+   + P   L  H   VN +KWH
Sbjct: 346 SKGSDALLRLEPSPYDPNVLATF--AADSNKIIILDMRNPESPILNLQGHGSSVNGIKWH 403

Query: 240 EFESNVFGTVSED 252
             + NV  +  +D
Sbjct: 404 PTKRNVLLSCGDD 416

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 141 EEVIRARYMPANSNIIATING-KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHIS 199
           + ++R    P + N++AT       I I D  +   ++ +  L  H  +  G+ ++P   
Sbjct: 350 DALLRLEPSPYDPNVLATFAADSNKIIILD--MRNPESPILNLQGHGSSVNGIKWHPTKR 407

Query: 200 GELLSGSDDTTVALWDIEAA 219
             LLS  DD  V  WD+ ++
Sbjct: 408 NVLLSCGDDCQVLYWDLNSS 427

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 20/166 (12%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           ++S S DTT  +WD++++   K+ L +HD  V DV++    + +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 262 -------VRLEPVKKLP-----TASPFNT-------LSFSKHSRNLLAAAGVDS-QIYLY 301
                  +   P    P     T +P +        L  S +  N+LA    +S +I + 
Sbjct: 319 SLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIIL 378

Query: 302 DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           DMR+  SP+  + GH  SV  +++ P    ++ S G D + + WDL
Sbjct: 379 DMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 51/136 (37%), Gaps = 27/136 (19%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHKENGYGLAFNPH 197
           H  EV   R++  ++ + A+  G G++ +FD R+L       ST+ +          N  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAH-----STIIYEPPASSAPGLNAD 340

Query: 198 ISGELLSGSD---------------------DTTVALWDIEAAKKPKSILTSHDDIVNDV 236
            +     GSD                        + + D+   + P   L  H   VN++
Sbjct: 341 TTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEGHSSSVNEI 400

Query: 237 KWHEFESNVFGTVSED 252
           KWH  + NV  +  +D
Sbjct: 401 KWHPTKRNVLLSCGDD 416

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 79/160 (49%), Gaps = 14/160 (8%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           L+S S DTT  +WD++++   K+ L +HD  V DV++    + +F +   D +++V D R
Sbjct: 296 LISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLR 355

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLL------AAAGV-------DSQIYLYDMRDMS 307
            +    +   P  +P +    S+    LL        A V        ++I + DMR+  
Sbjct: 356 SLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSE 415

Query: 308 SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           SP+ V+ GH+ ++  +++ P    I+ S   D + + WDL
Sbjct: 416 SPVLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDL 455

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 59/137 (43%), Gaps = 15/137 (10%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKA-------QVS 180
           S++       H  EV   R++  ++ + A+  G G++ +FD R+L  S          VS
Sbjct: 313 SNYVKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVS 372

Query: 181 TLAFHKENGYGLAFNP-----HISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVND 235
                ++    L   P     ++    +S S+   + + D+  ++ P  +L  H   +N 
Sbjct: 373 NADLSQQQNALLRLEPSPTDANVIATFVSESNK--ILILDMRNSESPVLVLEGHKSAINQ 430

Query: 236 VKWHEFESNVFGTVSED 252
           +KWH  +  +  + S+D
Sbjct: 431 IKWHPTKRYILLSCSDD 447

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 143 VIRARYMPANSNIIAT-INGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE 201
           ++R    P ++N+IAT ++    I I D  +  S++ V  L  HK     + ++P     
Sbjct: 383 LLRLEPSPTDANVIATFVSESNKILILD--MRNSESPVLVLEGHKSAINQIKWHPTKRYI 440

Query: 202 LLSGSDDTTVALWDIEAA 219
           LLS SDD  V  WD+ + 
Sbjct: 441 LLSCSDDCQVLYWDLNST 458

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 89/399 (22%), Positives = 172/399 (43%), Gaps = 54/399 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAGEEVNYLKVATINLPA 111
           P +YE +    + WP +T+  +P    S+ ++  QSL+  T T        ++  ++L  
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 112 GIAGLDQGDEEDEANDHSSFA--------IANK-FPHIEEVIRARYMPANSN----IIAT 158
            +  L + DEE+E  D  +          I N+  P  +   R +  P  S+    + AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 159 INGKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELL 203
           ++  G + IFD             +  + +K  + T+  H    GY L ++P   +G LL
Sbjct: 232 MSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGALL 291

Query: 204 SGSDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           +G     +       +K     +    +++  + D++W   ES VF +   D  +++ D 
Sbjct: 292 TGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIWDT 351

Query: 261 RVRL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLH 311
           R +  +P   +  + +  N +S+S+    LLA+   +    ++D+R  S        P+ 
Sbjct: 352 RSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQPVA 411

Query: 312 VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIGAEQSQDDADDGA------P 364
               H+ ++T++ F+P  + II     D    +WDL+ +   E+ +  A +        P
Sbjct: 412 QYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPP 471

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           +L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 472 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 507

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 80/167 (47%), Gaps = 22/167 (13%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           ++S S DTT  +WD++++   K+ L +HD  V DV++    + +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 262 ------VRLEPVKKLPTASP--------------FNTLSFSKHSRNLLAAAGVDS-QIYL 300
                 +  EP    P + P                 L  S +  N+LA    DS +I +
Sbjct: 319 SLAHSTIIYEPPSS-PASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIII 377

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
            DMR+  SP+  + GH  SV  +++ P    ++ S   D +A+ WDL
Sbjct: 378 LDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 17/131 (12%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHKENGYGLAFNPH 197
           H  EV   R++  ++ + A+  G G++ +FD R+L  S       +         A  P 
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPS 345

Query: 198 ISGE--LLS--------------GSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEF 241
           + G   LL                +D   + + D+   + P   L  H   VN++KWH  
Sbjct: 346 LKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPT 405

Query: 242 ESNVFGTVSED 252
           + NV  + S+D
Sbjct: 406 KRNVLLSCSDD 416

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 86/397 (21%), Positives = 174/397 (43%), Gaps = 52/397 (13%)

Query: 56  PVMYEFVSETKLTWPSLTIQWLP----SDGQSPEQSLIFGTHTAGEEVNYLKVATINLPA 111
           P +YE +    L WP +T+  +P    S+ ++  QS++  T T   +    ++  ++L  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 112 GIAGLDQGDEEDEANDHSSFA------IANKFPHIEEVI-RARYMPANSN----IIATIN 160
               L + +E+++ ++ S         I N+   + +   R +  P  S     + AT++
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 161 GKGTISIFD-------------RTLEESKAQVSTLAFHKE-NGYGLAFNPHI-SGELLSG 205
             G + IFD             +  + ++  + T+  H    GY L ++P I +G LL+G
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLTG 299

Query: 206 SDDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
                +       +K     +     ++  V D++W   ES VF +   D  +++ D R 
Sbjct: 300 DCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRS 359

Query: 263 RL-EPVKKLPTA-SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS-------SPLHVM 313
           +  +P   +  + +  N +S+S+    LLA+   +    ++D+R  S        P+   
Sbjct: 360 KKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQPVAQY 419

Query: 314 SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT------QIGAEQSQ-DDADDGAPEL 366
             H+ ++T++ F+P  D II  +  D    +WDL+      +I  + ++  + +   P+L
Sbjct: 420 DFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKIPPQL 479

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           + +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 480 LFVH--WQKDVKDVKWHKQIPGCLVSTGTDG-LNIWK 513

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 9/131 (6%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMS-SPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
           + +S+    + A+AG D  I ++D R     P   +      V  + +S    G + +SG
Sbjct: 333 IQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISWSEKI-GYLLASG 391

Query: 338 SDRRAI-IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEED 396
            D     +WDL Q     S D+ +D  P  +  +  H+  +   +FNP    ++A   ED
Sbjct: 392 DDNGLWGVWDLRQF----SPDNINDVQP--VAQYDFHKGAITSINFNPLDDSIIAVASED 445

Query: 397 NVIQAWKVSMK 407
           N +  W +S++
Sbjct: 446 NTVTLWDLSVE 456

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 125/288 (43%), Gaps = 42/288 (14%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELL 203
           IR+     +   +AT      I I+D +   SK  + TL  H+++ Y L + P    +L+
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLS---SKKILMTLQGHEQDIYSLDYFP-AGDKLV 427

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV- 262
           SGS D TV +WD+   +   S+  S +D V  V     +       S D+T++V D    
Sbjct: 428 SGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 263 ----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLH----- 311
               RL+   +L T    +  S  F++  R++++ + +D  + L+D+R ++         
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGS-LDRSVKLWDLRGLNGQKSHATCE 544

Query: 312 -VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMH 370
              +GH+D V +V  +   D  I S   DR  + WD               G P LM+  
Sbjct: 545 VTYTGHKDFVLSVA-TTQDDEYILSGSKDRGVLFWDTA------------SGNPLLMLQ- 590

Query: 371 AGHRSP------VNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNAS 412
            GHR+       VN F   P I  + A+   D   + WK + K  ++S
Sbjct: 591 -GHRNSVISVAVVNGFPLGPDI-GVFATGSGDCKARIWKYTKKTSSSS 636

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 126/301 (41%), Gaps = 50/301 (16%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE-L 202
           IR+     +   +AT      I I+D +   +K  V TL  H+++ Y L + P  SG+ L
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLS---TKRIVMTLQGHEQDIYSLDYFP--SGDKL 435

Query: 203 LSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
           +SGS D TV +WD+   +   S+  S +D V  V     E       S D+TL+V D   
Sbjct: 436 VSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSET 493

Query: 263 -----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLH---- 311
                RL+   +L T    +  S  F++  + +++ + +D  + L+++ +  S       
Sbjct: 494 GFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGS-LDRSVKLWNLHNTGSSSKNDSK 552

Query: 312 --------VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGA 363
                     +GH+D V +V  +   D  I S   DR  + W            D   G 
Sbjct: 553 PTAATCEVTYTGHKDFVLSVATT-QNDKYILSGSKDRGVLFW------------DTQSGN 599

Query: 364 PELMMMHAGHRSPV------NEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAIS 417
           P LM+   GHR+ V      N F   P    + A+   D   + WK S    NAS P + 
Sbjct: 600 PLLMLQ--GHRNSVISVAVANGFPLGPDY-GVFATGSGDCKARIWKYSKNKANASEPQVQ 656

Query: 418 D 418
           +
Sbjct: 657 E 657

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 108/264 (40%), Gaps = 28/264 (10%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A+ +  GTI I+D T    +  V TL+ H  +   + +     G L SGS D T+  WD
Sbjct: 250 LASASKDGTIKIWDTT---RRVCVLTLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWD 304

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           + A  K  +IL SH   +N +  +   +   G            +  R + +K     + 
Sbjct: 305 MAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAK 364

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG-IIC 334
            N          L+  A  D  +YL+D    S P+  M+GHQ  V  V FSP  DG  I 
Sbjct: 365 KN-----GQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP--DGRYIV 417

Query: 335 SSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTE 394
           S+  D    +W            D  +G    +    GH + V + +++     LL S  
Sbjct: 418 SASFDNSIKLW------------DGRNGT--FIATFRGHVASVYQVAWSSDCR-LLVSCS 462

Query: 395 EDNVIQAWKVSMKLVNASPPAISD 418
           +D  ++ W V  K ++   P  +D
Sbjct: 463 KDTTLKVWDVRTKKLSVDLPGHND 486

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 77/182 (42%), Gaps = 18/182 (9%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH SG +++GS D T  +WD      P   L  H + V  V W 
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCN-TNTPMYTLKGHFNWVLCVAWC 194

Query: 240 EFESNVFGTVSEDKTLQVHDK----------RVRLEPVKKLPTASPFNTLSFSKHSRNLL 289
             +  +  T S D T+++ D           R   + +  L T  P + +      R  L
Sbjct: 195 P-DGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSL-TWEPMHLVKAGDQPR--L 250

Query: 290 AAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349
           A+A  D  I ++D       L  +SGH +SV+ V++     GI+ S   D+    WD+  
Sbjct: 251 ASASKDGTIKIWDTTRRVCVL-TLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWDMAA 307

Query: 350 IG 351
            G
Sbjct: 308 GG 309

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 9/184 (4%)

Query: 165 ISIFDRTLEESKAQVSTLAFHKENGYGLAF-NPHISGELLSGSDDTTVALWDIEAAKKPK 223
           +  FD T E+  +     A   +N   +A  N  +   +++ SDD T+ LWD   A KP 
Sbjct: 335 VGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPI 394

Query: 224 SILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSK 283
           + +T H  +VN V +   +     + S D ++++ D R            +    +++S 
Sbjct: 395 TRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWSS 453

Query: 284 HSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDSVTTVEFSPHTDGI-ICSSGSDRR 341
             R LL +   D+ + ++D+R  +  L V + GH D V TV++S   DG  +CS+G D+ 
Sbjct: 454 DCR-LLVSCSKDTTLKVWDVR--TKKLSVDLPGHNDEVYTVDWS--VDGKRVCSAGKDKM 508

Query: 342 AIIW 345
             IW
Sbjct: 509 VRIW 512

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ +R ++     ++GH  ++    F+PHT G + +   D  A IW            D 
Sbjct: 125 VFKVRPVTRSSSAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIW------------DC 172

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           +   P  M    GH + V   ++ P    L+A+   DN I+ W
Sbjct: 173 NTNTP--MYTLKGHFNWVLCVAWCPDGE-LIATGSMDNTIRLW 212

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 22/168 (13%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           ++S S DTT  +WD++++   K+ L +HD  V DV++    + +F +   D +++V D R
Sbjct: 259 IISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR 318

Query: 262 --------------VRLEPVKKLPTASPFNTLSF-------SKHSRNLLAAAGVDS-QIY 299
                                   T +P +  S+       S +  N+LA    DS +I 
Sbjct: 319 SLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSNKII 378

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           + DMR+  SP+  + GH  SV  +++ P    ++ S   D + + WDL
Sbjct: 379 ILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDL 426

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 55/135 (40%), Gaps = 23/135 (17%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEES--------------KAQVSTLA 183
           H  EV   R++  ++ + A+  G G++ +FD R+L  S                   T  
Sbjct: 286 HDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTT 345

Query: 184 FHKENGYGL------AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVK 237
              +  Y L       ++P++       +D   + + D+   + P   L  H   VN++K
Sbjct: 346 PSSDGSYALLRLEPSPYDPNVLATF--AADSNKIIILDMRNPESPILTLEGHSSSVNEIK 403

Query: 238 WHEFESNVFGTVSED 252
           WH  + NV  + S+D
Sbjct: 404 WHPTKRNVLLSCSDD 418

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 124/297 (41%), Gaps = 47/297 (15%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLA--------- 193
           V R +++P     +AT +    I     +L+E +  +S   + K++    A         
Sbjct: 111 VTRCQWLPKGGGKLATCSDSLRIWSVGDSLQE-QLNLSLCKYSKQSNGSTASAALGSLPP 169

Query: 194 -----FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGT 248
                +N   +  ++S S DTT  +WD++++   K+ L +HD  V DVK+    + +F +
Sbjct: 170 VTSFDWNSVDTNLIISSSIDTTCTVWDLQSSNYVKTQLIAHDSEVYDVKFLTNSTQLFAS 229

Query: 249 VSEDKTLQVHDKR------VRLEPVKKLPTASPFNT-------------------LSFSK 283
              D +++V D R      +  EP+  L + +  ++                   L  S 
Sbjct: 230 CGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPSP 289

Query: 284 HSRNLLAAAGVDSQ-IYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRA 342
              N++A    DS  + + DMR   SP+  + GH  +V  + + P    ++ + G D + 
Sbjct: 290 FDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDDCQV 349

Query: 343 IIWD----LTQIGAEQSQDDADDGAPELMMMHAGHR--SPVNEFSFNPQIPWLLAST 393
           + WD    L   GA  S+ + ++    L      +   + +N  ++ PQ  W   +T
Sbjct: 350 LYWDINSWLHHSGAATSKWNTNNVVHSLETPKFAYNDAAEINNIAWRPQGDWFGMNT 406

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 55/149 (36%), Gaps = 27/149 (18%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFH-- 185
           S++       H  EV   +++  ++ + A+  G G++ +FD R L  S      LA    
Sbjct: 200 SNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTS 259

Query: 186 ---KENGYGLA-------------------FNPHISGELLSGSDDTTVALWDIEAAKKPK 223
              K +G G                     F+P++        D   V + D+     P 
Sbjct: 260 GTVKSSGEGNVGGNEDGTNHTALLRLEPSPFDPNVVATFT--QDSNAVLILDMRYPGSPI 317

Query: 224 SILTSHDDIVNDVKWHEFESNVFGTVSED 252
             L  H   VN ++WH  + NV  T  +D
Sbjct: 318 LTLEGHSSAVNQMRWHPTQRNVLLTCGDD 346

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 116/238 (48%), Gaps = 29/238 (12%)

Query: 189 GYGLAFNPHI-SGELLSGSDDTTVALWDIEAA-----KKPKSILTSHDDIVNDVKWHEFE 242
           GYGL ++P I +G +L+G     V L    A+     K+P ++   ++  + D++W   E
Sbjct: 287 GYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTV--GNNKSIEDIQWSRAE 344

Query: 243 SNVFGTVSEDKTLQVHDKRVRLE--PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIY- 299
             VF T   D  +++ D R +     +  + + +  N +S+++    LLA+ G DS  + 
Sbjct: 345 MTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLAS-GDDSGTWG 403

Query: 300 LYDMRDMS-------SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT-QIG 351
           ++D+R  S       +P+   + H+ ++T++ F+P  + II  +  D    +WDL+ +  
Sbjct: 404 VWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 463

Query: 352 AEQSQDDADDGA------PELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
            E+ +    + A      P+L+ +H   +  V +  ++ QIP  L ST  D  +  WK
Sbjct: 464 DEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 11/132 (8%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMS--SPLHVMSGHQDSVTTVEFSPHTDGIICSS 336
           + +S+    + A  GVD  I ++D R       L VM    D V  + ++    G + +S
Sbjct: 338 IQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTD-VNVMSWNEKI-GYLLAS 395

Query: 337 GSDRRAI-IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEE 395
           G D     +WDL Q  A+ ++          +  +  H++ +   SFNP    ++A   E
Sbjct: 396 GDDSGTWGVWDLRQFSAQNTEKTTP------VAQYNFHKAAITSISFNPLDESIIAVASE 449

Query: 396 DNVIQAWKVSMK 407
           DN +  W +S++
Sbjct: 450 DNTVTLWDLSVE 461

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 46/110 (41%), Gaps = 27/110 (24%)

Query: 155 IIATINGKGTISIFDRTLEESKAQ-------VSTLAFHKENGYGLAFNPHISGELLSGSD 207
           ++A+ +  GT  ++D  L +  AQ       V+   FHK     ++FNP     +   S+
Sbjct: 392 LLASGDDSGTWGVWD--LRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASE 449

Query: 208 DTTVALWDI-----------------EAAKKPKSILTSH-DDIVNDVKWH 239
           D TV LWD+                 E  + P  +L  H    V DVKWH
Sbjct: 450 DNTVTLWDLSVEADDEEIKQQTAETAELQQIPPQLLFVHWQRDVKDVKWH 499

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 111/246 (45%), Gaps = 29/246 (11%)

Query: 184 FHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW--HEF 241
           + +EN + L   P     L++   D +V L D    K   SI   H   +ND+K    +F
Sbjct: 10  YFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSI-QCHTTSINDMKVINSDF 68

Query: 242 ESN-VFGTVSEDKTLQVHDKRVRLEPVKKLPT--ASPFNTLSFSKHSRNLLAAAGV---- 294
           ++  VF T +ED  ++V D R R   V  L    ASPF    FS  SR+ + A G     
Sbjct: 69  DTGAVFATAAEDG-VKVWDIRAR-NNVASLQNDKASPF----FSLDSRHNMLACGTELKD 122

Query: 295 -DSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGA 352
            D+++++YD+R+ + P+   +  H D +T ++F P    ++ S  +D    I+DLT    
Sbjct: 123 YDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLT---- 178

Query: 353 EQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNAS 412
              QDD +D   +++   + H          P+  W L+  E   + +    S +++   
Sbjct: 179 ---QDDEEDALHQVINFASIHSCGW----LGPKRIWSLSHMETFGIHELNDKSDEMIEPK 231

Query: 413 PPAISD 418
           P    D
Sbjct: 232 PLEFGD 237

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 75/154 (48%), Gaps = 6/154 (3%)

Query: 184 FHKENGYGLAFNPHISG-ELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFE 242
           FH E+ + L  + H S    ++G  +  + LWD     +P + L+   D V+ VK+++ E
Sbjct: 171 FHGEHAF-LGIDHHRSNSNFVTGGAE--INLWD-STRSRPITNLSWGADNVSTVKFNQNE 226

Query: 243 SNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
           +++F +   D ++ ++D R    P +K       N L ++         A  D   Y YD
Sbjct: 227 TDIFASAGSDNSVVLYDLRTN-SPTQKFVQKMRTNALCWNPMEAYNFVVANEDHNAYYYD 285

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSS 336
           MR++S  LHV   H  +V  V+FSP  D I+  S
Sbjct: 286 MRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGS 319

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 80/205 (39%), Gaps = 52/205 (25%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNP-HIS-----GELLSGSD 207
           N +AT +  G +  ++ +  E   +V +   H    +GL   P H+S       +LS  D
Sbjct: 81  NKLATASADGVVKYWNMSTRE---EVCSFKAHYGLIHGLCVTPQHLSQNKNENYMLSCGD 137

Query: 208 DTTVALW-----DIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
           D TV LW     D  + +  + ++ S + ++                             
Sbjct: 138 DRTVKLWSVNTDDFSSERGDEEVIKSGNGLI----------------------------- 168

Query: 263 RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTT 322
                K       F  +   + + N +      ++I L+D    S P+  +S   D+V+T
Sbjct: 169 -----KTFHGEHAFLGIDHHRSNSNFVTGG---AEINLWDS-TRSRPITNLSWGADNVST 219

Query: 323 VEFSPHTDGIICSSGSDRRAIIWDL 347
           V+F+ +   I  S+GSD   +++DL
Sbjct: 220 VKFNQNETDIFASAGSDNSVVLYDL 244

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 113/276 (40%), Gaps = 40/276 (14%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P N   IA+ +  GTI ++D    +    + TL+ H  +   + +     G + +GS D 
Sbjct: 272 PGNKPRIASASKDGTIKVWDTVRRQC---ILTLSGHTSSVSCIKWGGQ--GVIYTGSHDR 326

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV------HDKRVR 263
           T+  WD+ A  K  +IL SH   VN +           ++S D  L+V      + +   
Sbjct: 327 TIRCWDMNAGGKCINILKSHAHWVNHL-----------SLSTDYALKVGAFDHTYSRPAT 375

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
            E  +K    +       +     L+A A  D  +YL++    + PL  M+GHQ  V  V
Sbjct: 376 AEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHV 435

Query: 324 EFSPHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSF 382
            FSP  DG  I S+  D    +W              +  + + +    GH + V + ++
Sbjct: 436 AFSP--DGRYIVSASFDNSIKLW--------------EGSSGKFISTFRGHVASVYQVAW 479

Query: 383 NPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           +     LL S  +D  ++ W V  + +    P  +D
Sbjct: 480 SSDCR-LLVSCSKDTTLKVWDVRTRKLAVDLPGHND 514

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 76/179 (42%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H        F PH S  +++GS D    +WD +  + P   L  H + V  V W 
Sbjct: 164 SAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCD-TQTPIYTLKGHTNWVLCVAWS 222

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSF-SKHSRNLLAAA 292
             +  V  T S D T+++ D +        L    K  T+  +  +   +  ++  +A+A
Sbjct: 223 A-DGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASA 281

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       L  +SGH  SV+ +++     G+I +   DR    WD+   G
Sbjct: 282 SKDGTIKVWDTVRRQCIL-TLSGHTSSVSCIKWGGQ--GVIYTGSHDRTIRCWDMNAGG 337

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           ++ +R ++     ++GH  ++    F+PHT   + +   D  A IWD 
Sbjct: 153 VFKVRPVTRSSSAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDC 200

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD  +  +P + L+   D V+ VK+++ E+++F +   D ++ ++D R    P +K 
Sbjct: 195 INLWD-SSRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTN-SPTQKF 252

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N L ++         A  D   Y YDMR++S  LHV   H  +V  V+FSP  D
Sbjct: 253 TQRMRTNALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGD 312

Query: 331 GIICSS 336
            I+  S
Sbjct: 313 EIVTGS 318

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 83/201 (41%), Gaps = 45/201 (22%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNP-HISGE-----LLSGSD 207
           N +A+ +  G +  ++ +  E   ++ +   H    +GL   P H+S       +LS  D
Sbjct: 81  NKLASASADGVVKYWNMSTRE---EICSFKAHYGLVHGLCVTPQHLSANKNENYMLSCGD 137

Query: 208 DTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D TV LW +      +   +S +D        E +S+  G +   KT             
Sbjct: 138 DKTVKLWSVNT----EDFSSSKND--------EEQSSTDGLI---KTFH----------- 171

Query: 268 KKLPTASPFNTLSFSKH-SRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFS 326
                   +  L    H S+     AG  ++I L+D    S P   +S   D+V+TV+F+
Sbjct: 172 ------GDYAFLGIDHHRSKPYFVTAG--AEINLWDS-SRSRPTANLSWGADNVSTVKFN 222

Query: 327 PHTDGIICSSGSDRRAIIWDL 347
            +   I  S+GSD   +++DL
Sbjct: 223 QNETDIFASAGSDNSVVLYDL 243

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 75/160 (46%), Gaps = 14/160 (8%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           L+S S DTT  +WD+++    K+ L +HD  V DV++    +++F +   D +++V D R
Sbjct: 262 LVSSSIDTTCIVWDLQSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFDLR 321

Query: 262 ------VRLEPVKKLPTASPFNT-------LSFSKHSRNLLAAAGVDSQ-IYLYDMRDMS 307
                 +  EP     T +           L  S    N++A    DS+ I + DMR+  
Sbjct: 322 SLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDMRNPE 381

Query: 308 SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           SP   + GH   V  +++ P    ++ S   D + + WDL
Sbjct: 382 SPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 25/132 (18%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHKENGYGLA---- 193
           H  EV   R++  ++++ A+  G G++ +FD R+L  S     T+ +    G G      
Sbjct: 289 HDSEVYDVRFLSQSTHLFASCGGDGSVRVFDLRSLAHS-----TIVYEPPAGEGTVNDVT 343

Query: 194 -------------FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE 240
                         +P+I   L++ S D  + + D+   + P   L  H  +VN +KWH 
Sbjct: 344 AQNNALLRLEPSLMDPNIIATLVADSKD--ILILDMRNPESPALTLKGHSSLVNQIKWHP 401

Query: 241 FESNVFGTVSED 252
            + NV  + S+D
Sbjct: 402 TKRNVLLSCSDD 413

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 113/276 (40%), Gaps = 40/276 (14%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D      +  + TL+ H  +   + +     G L SGS D 
Sbjct: 244 PGDKPRLASASKDGTIKIWD---TARRVCLFTLSGHTNSVSCVKWGGR--GVLYSGSHDK 298

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV----HDKRVRLE 265
           T+  WD+ A  K  +IL SH   +N +           ++S D  L+V    H  +    
Sbjct: 299 TIRAWDMNAGGKCINILKSHAHWINHL-----------SLSTDYALRVGAFDHTGKKPSS 347

Query: 266 PVKKLPTASPFNTLSFSKHSR--NLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
           P +    A         K+ +   L+  A  D  +YL+D    + P+  M+GHQ  V  V
Sbjct: 348 PEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHV 407

Query: 324 EFSPHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSF 382
            FSP  DG  I S+  D    +W            D  DG    +    GH + V + ++
Sbjct: 408 AFSP--DGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASVYQVAW 451

Query: 383 NPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           +     LL S  +D  ++ W V  K ++   P   D
Sbjct: 452 SSDCR-LLVSCSKDTTLKVWDVRTKKLSVDLPGHKD 486

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 75/146 (51%), Gaps = 8/146 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LWD   + KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 373 MVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 431

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDSV 320
                       +    +++S   R LL +   D+ + ++D+R  +  L V + GH+D V
Sbjct: 432 DGTFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVR--TKKLSVDLPGHKDEV 488

Query: 321 TTVEFSPHTDGI-ICSSGSDRRAIIW 345
            TV++S   DG  +CS+G D+   IW
Sbjct: 489 YTVDWS--VDGKRVCSAGKDKMVRIW 512

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD      P   L  H + V  V W 
Sbjct: 136 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCN-TNTPMQTLKGHFNWVLCVAWS 194

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSKHS-RNLLAAA 292
             +  +  T S D T+++            L    K  T+  +  +   K   +  LA+A
Sbjct: 195 P-DGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASA 253

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       L  +SGH +SV+ V++     G++ S   D+    WD+   G
Sbjct: 254 SKDGTIKIWDTARRVC-LFTLSGHTNSVSCVKWGGR--GVLYSGSHDKTIRAWDMNAGG 309

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 15/104 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ +R ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 125 VFKVRPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 172

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           +   P  M    GH + V   +++P    L+A+   DN I+ W+
Sbjct: 173 NTNTP--MQTLKGHFNWVLCVAWSPDGE-LIATGSMDNTIRLWQ 213

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 115/270 (42%), Gaps = 40/270 (14%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A+ +  GTI I+D +    +  + TL+ H  +   + +     G L +GS D T+ +WD
Sbjct: 251 LASASKDGTIKIWDAS---RRTCLYTLSGHTNSVSCVKWGGQ--GLLYTGSHDKTIRVWD 305

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH----DKRVRLEP--VKK 269
           I+A  K  +IL SH   VN +           ++S D  ++V     D +    P   + 
Sbjct: 306 IKAGGKCINILKSHAHWVNHL-----------SLSTDYAIRVGPFGPDGKASPSPQEARD 354

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
           +   +    +  S     L+  A  D  ++L++    + PL  M+GHQ  V  V FSP  
Sbjct: 355 IAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP-- 412

Query: 330 DG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
           DG  I S+  D    +W            D  DG  + +    GH + V + +++     
Sbjct: 413 DGRYIVSASFDNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR- 457

Query: 389 LLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           LL S  +D  ++ W V  + ++   P   D
Sbjct: 458 LLVSCSKDTTLKVWDVKTRKLSVDLPGHQD 487

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+   + KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 374 MVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 432

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LL +   D+ + ++D++  +  L V + GHQD 
Sbjct: 433 DGKFIATFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVK--TRKLSVDLPGHQDE 488

Query: 320 VTTVEFSPHTDG-IICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   +W
Sbjct: 489 VYTVDWS--VDGQRVCSGGKDKMVRLW 513

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 91/225 (40%), Gaps = 49/225 (21%)

Query: 128 HSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKE 187
            SS AIA    H   ++ + + P  S+ + T  G  T  I+D     ++  +S L  H  
Sbjct: 134 RSSAAIAG---HGSTILCSAFAPDTSSRMVTGAGDNTARIWDCA---TQTPLSVLKGHSN 187

Query: 188 NGYGLAFNPHISGELLS-GSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVF 246
               +A++P   GEL++ GS D T+ LW+ +A K     +  H   +  + W        
Sbjct: 188 WVLCVAWSP--DGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWE------- 238

Query: 247 GTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDM 306
                                       P + ++     R  LA+A  D  I ++D    
Sbjct: 239 ----------------------------PLHLVAAGDKPR--LASASKDGTIKIWDASRR 268

Query: 307 SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
           +  L+ +SGH +SV+ V++     G++ +   D+   +WD+   G
Sbjct: 269 TC-LYTLSGHTNSVSCVKWGGQ--GLLYTGSHDKTIRVWDIKAGG 310

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 109/273 (39%), Gaps = 63/273 (23%)

Query: 140 IEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKE-----NGYGLAF 194
           I  + + ++MP  +  +AT +    I   +  L E +  +S + + K      NG  L  
Sbjct: 105 IYPLSKIQWMPKGTGKLATCSDSLRIRSVEEQLHE-QLNLSLVKYGKSLGEVSNGRMLGQ 163

Query: 195 NPHISG---------ELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNV 245
            P ++           +L  S DTT  +WD++A+   K+ L +HD  V D K+    SN+
Sbjct: 164 LPPVTSFDWNALDTNLILFSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLTQSSNL 223

Query: 246 FGTVSEDKTLQVHDKR------VRLEPVKKLPTASPFNT--------------------- 278
           F +   D +++V D R      +  EP +++   +P  T                     
Sbjct: 224 FASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQSS 283

Query: 279 --------------------LSFSKHSRNLLAAAGVDSQIY-LYDMRDMSSPLHVMSGHQ 317
                               L  S    N+LA    DS +  + DMR   SP+ ++ GH 
Sbjct: 284 ALSSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEGHA 343

Query: 318 DSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQI 350
             V  +++ P    ++ + G D + + WDL ++
Sbjct: 344 APVNQLKWHPSKPNVLATCGDDCQILYWDLLEL 376

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 64/171 (37%), Gaps = 49/171 (28%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEE------------- 174
           S++       H  EV  A+++  +SN+ A+  G G++ +FD R L               
Sbjct: 197 SNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQG 256

Query: 175 ---SKAQVSTLAFHKENGYGLA------------------------------FNPHISGE 201
              S+ QV TLA H+++G                                  F+P+I   
Sbjct: 257 QTPSQTQVHTLAAHEQDGQLQKNSQSSALSSSASSSLGALDNCALLRLEPSPFDPNILAT 316

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
           +    D   V + D+     P  +L  H   VN +KWH  + NV  T  +D
Sbjct: 317 I--QQDSNVVIILDMRYPGSPMLLLEGHAAPVNQLKWHPSKPNVLATCGDD 365

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 3/137 (2%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD+   KKP S L+   D V+ V++++ E ++  +   D ++ ++D R    P +K+
Sbjct: 198 IQLWDVNR-KKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTN-SPTQKV 255

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N L ++       A A  D   Y YDMR+MS  LHV   H  +V  V+FSP  +
Sbjct: 256 VQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGE 315

Query: 331 GIICSSGSDRRAIIWDL 347
            I+  S  D+   I++L
Sbjct: 316 EIVTGS-YDKTIRIFNL 331

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 102/270 (37%), Gaps = 63/270 (23%)

Query: 168 FDRTLEESKAQVST-------------LAF-HKENGYGLAFNPHISGELLSGSDDTTVAL 213
           F+R  E +KA  +T             L + H++  Y LA N ++  +L SGS D  V  
Sbjct: 35  FERAREYTKALTATKLERMFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKY 94

Query: 214 WDIEA--------------------------AKKPKSILTSHDDIVNDVKWHEFESNVFG 247
           W++                             KK   +L+  DD    +K     S+ F 
Sbjct: 95  WNMATREELCSFRAHYGLVTGLCVTPTHLSPTKKDSFMLSCGDD--KTIKLWSVNSDDFN 152

Query: 248 TVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS 307
           ++ +D  +        L  +K       F ++   + + N +      +QI L+D+ +  
Sbjct: 153 SIKDDTKIVSDTGDGAL--LKTFYGEHAFQSIDHHRRNPNFVTGG---AQIQLWDV-NRK 206

Query: 308 SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELM 367
            PL  +S   D+V+ V F+ + + I+ S+GSD   +++DL      Q             
Sbjct: 207 KPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQK------------ 254

Query: 368 MMHAGHRSPVNEFSFNPQIPWLLASTEEDN 397
                 R   N   +NP  P+  A   ED+
Sbjct: 255 ---VVQRMRTNALCWNPMEPFNFAIANEDH 281

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +K P S LT   D V  VK+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 195 IQLWDANRSK-PISNLTWGADNVTSVKFNQTETDILASTGSDNSIVLYDLRTN-SPTQKI 252

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
             +   N + ++         A  D   Y YDMR+MS  L+V   H  +V  V+FSP  D
Sbjct: 253 RQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 331 GIICSS 336
            I+  S
Sbjct: 313 EIVTGS 318

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 78/200 (39%), Gaps = 43/200 (21%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE------LLSGSD 207
           N +A+ +  G +  F+ +  E   ++ +   H     GL   P  S        ++S  D
Sbjct: 81  NKLASSSADGVVKYFNMSTRE---EICSFKAHYGLVTGLCVRPETSATNKNEHYMISCGD 137

Query: 208 DTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D TV LW ++                         SN F    +D T+   D       +
Sbjct: 138 DKTVKLWSVD-------------------------SNDFSNNKKDDTIHKGDG-----LL 167

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
           K       F  L    H RN        +QI L+D  + S P+  ++   D+VT+V+F+ 
Sbjct: 168 KTYYGDHAFFGLD---HHRNNSTFVTGGAQIQLWDA-NRSKPISNLTWGADNVTSVKFNQ 223

Query: 328 HTDGIICSSGSDRRAIIWDL 347
               I+ S+GSD   +++DL
Sbjct: 224 TETDILASTGSDNSIVLYDL 243

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 72/153 (47%), Gaps = 4/153 (2%)

Query: 184 FHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFES 243
           FH E+ +    +       ++G     + LWD   +K P S L+   D +N V++++ E 
Sbjct: 169 FHGEHAFQSLDHHRQKSNFVTGG--AQIELWDTNRSK-PISNLSWGADNINHVRFNQNEV 225

Query: 244 NVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM 303
           ++  +   D ++ ++D R    P +K+      N++ ++         A  D   Y YDM
Sbjct: 226 DILASTGSDNSVVLYDLRTN-SPTQKIVQTMRTNSICWNPVEAFNFVIANEDHNAYYYDM 284

Query: 304 RDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSS 336
           R+MS  LHV   H  +V  V+FSP  D ++  S
Sbjct: 285 RNMSKALHVFKDHVSAVMDVDFSPTGDEVVTGS 317

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 81/199 (40%), Gaps = 42/199 (21%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLA-----FNPHISGELLSGSDD 208
           N +AT +G G I  ++ +  E   ++S+   H     GL       +P     +LS  DD
Sbjct: 81  NKLATASGDGVIKYWNMSTRE---ELSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDD 137

Query: 209 TTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVK 268
            TV LW + +           DD              F  V +D  L   D+ +    +K
Sbjct: 138 KTVKLWSVNS-----------DD--------------FSNVKDDTRLNT-DEGI----IK 167

Query: 269 KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH 328
                  F +L   +   N +      +QI L+D  + S P+  +S   D++  V F+ +
Sbjct: 168 TFHGEHAFQSLDHHRQKSNFVTGG---AQIELWDT-NRSKPISNLSWGADNINHVRFNQN 223

Query: 329 TDGIICSSGSDRRAIIWDL 347
              I+ S+GSD   +++DL
Sbjct: 224 EVDILASTGSDNSVVLYDL 242

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 99/203 (48%), Gaps = 22/203 (10%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           LLS S+D TV LW ++   KP      H+  V DV++    +N+F T S D+T ++    
Sbjct: 589 LLSASEDKTVRLWSVQ-DDKPLVSYKGHEKPVWDVEFSPSCNNLFATASNDQTARLWSCD 647

Query: 262 VRLEPVKKLPT-ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
            R+ P++ +    +  + +SF  + R +   +  D  + ++D+    S + +  GH  +V
Sbjct: 648 -RVYPLRVMAGHLNDVDCVSFHSNGRYIFTGSS-DKTVRMWDINTGDS-VRLFMGHNSTV 704

Query: 321 TTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNE 379
           T++  SP  DG   S+GSD   I IWD   IG+ +          +L  M    +S ++ 
Sbjct: 705 TSLSVSP--DGKWISTGSDDGIITIWD---IGSGR----------KLKNMRGHGKSSIHS 749

Query: 380 FSFNPQIPWLLASTEEDNVIQAW 402
            S+NP+   LL S   D  ++ W
Sbjct: 750 LSYNPE-GTLLVSGGADQSVRVW 771

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 17/126 (13%)

Query: 280 SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSD 339
           SFS     LL+A+  D  + L+ ++D   PL    GH+  V  VEFSP  + +  ++ +D
Sbjct: 581 SFSAGDEYLLSASE-DKTVRLWSVQD-DKPLVSYKGHEKPVWDVEFSPSCNNLFATASND 638

Query: 340 RRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI 399
           + A +W   ++             P  +M  AGH + V+  SF+    ++   +  D  +
Sbjct: 639 QTARLWSCDRV------------YPLRVM--AGHLNDVDCVSFHSNGRYIFTGS-SDKTV 683

Query: 400 QAWKVS 405
           + W ++
Sbjct: 684 RMWDIN 689

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 80/170 (47%), Gaps = 14/170 (8%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H++  + + F+P  +    + S+D T  LW  +    P  ++  H + V+ V +H     
Sbjct: 615 HEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRV-YPLRVMAGHLNDVDCVSFHSNGRY 673

Query: 245 VFGTVSEDKTLQVHD----KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300
           +F T S DKT+++ D      VRL     +   S   +LS S   +  ++    D  I +
Sbjct: 674 IF-TGSSDKTVRMWDINTGDSVRLF----MGHNSTVTSLSVSPDGK-WISTGSDDGIITI 727

Query: 301 YDMRDMSSPLHVMSGH-QDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349
           +D+      L  M GH + S+ ++ ++P    ++ S G+D+   +WDL +
Sbjct: 728 WDIGS-GRKLKNMRGHGKSSIHSLSYNPE-GTLLVSGGADQSVRVWDLNK 775

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 103/214 (48%), Gaps = 21/214 (9%)

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSE 251
           +A +P  +   ++GS+DTT+ +WD+ A  K K+ L  H   V DV   +    +F +VSE
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWDL-ATGKLKTTLAGHVMTVRDVAVSDRHPYLF-SVSE 202

Query: 252 DKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLH 311
           DKT++  D              S   T+S    + +L+A AG DS I L+DMR    P+ 
Sbjct: 203 DKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDMR-TRIPVI 260

Query: 312 VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHA 371
            + GH+  +  V+ +P  D  + SS +D    +WD+               A + M +  
Sbjct: 261 TLVGHKGPINQVQCTP-VDPQVVSSSTDATVRLWDVV--------------AGKTMKVLT 305

Query: 372 GHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
            H+  V   + +P+  + +AS   D+ I++W ++
Sbjct: 306 HHKRSVRATALHPK-EFSVASACTDD-IRSWGLA 337

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 88/208 (42%), Gaps = 22/208 (10%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGL 192
           I + + H+  V      P   ++IAT      I ++D     ++  V TL  HK     +
Sbjct: 217 IRDYYGHLSGVRTVSIHPT-LDLIATAGRDSVIKLWDM---RTRIPVITLVGHKGPINQV 272

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
              P +  +++S S D TV LWD+ A K  K +LT H   V     H  E +V    ++D
Sbjct: 273 QCTP-VDPQVVSSSTDATVRLWDVVAGKTMK-VLTHHKRSVRATALHPKEFSVASACTDD 330

Query: 253 KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV 312
                  +   L   +   T    NTLS ++   ++L A G +  +  YD +        
Sbjct: 331 IRSWGLAEGSLLTNFESEKTG-IINTLSINQD--DVLFAGGDNGVLSFYDYK-------- 379

Query: 313 MSGHQ-DSVTTVEFSPHTDG---IICSS 336
            SGH+  S+ T E     +G   ++CS+
Sbjct: 380 -SGHKYQSLATREMVGSLEGERSVLCST 406

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 107/264 (40%), Gaps = 28/264 (10%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A+ +  GTI I+D      +  V TL+ H  +   + +     G L SGS D TV +WD
Sbjct: 251 LASASKDGTIKIWDTV---RRVCVYTLSGHTNSVSCVKWGGQ--GVLYSGSHDKTVRVWD 305

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +    K  +IL +H   VN +      +   G      T     +  R + +K       
Sbjct: 306 MNLGGKCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALKNYEKVVK 365

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG-IIC 334
            N  +       L+  A  D  ++L++    + PL  M+GHQ  V  V FSP  DG  I 
Sbjct: 366 KNGTT-----EELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP--DGRYIV 418

Query: 335 SSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTE 394
           S+  D    +W            D  DG  + +    GH S V + +++     LL S  
Sbjct: 419 SASFDNSIKLW------------DGRDG--KFLSTFRGHVSSVYQVAWSSDCR-LLVSCS 463

Query: 395 EDNVIQAWKVSMKLVNASPPAISD 418
           +D  ++ W V  + ++   P   D
Sbjct: 464 KDTTLKVWDVRTRKLSVDLPGHQD 487

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 89/180 (49%), Gaps = 14/180 (7%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P + LT H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMTTLTGHQNWVLCVSWS 195

Query: 240 EFESNVFGTVSEDKTLQV--HDKRVRL-EPVK---KLPTASPFNTLSFSKHS-RNLLAAA 292
             +  +  T S D T+++   D+   L EP++   K  T+  +  L   K   +  LA+A
Sbjct: 196 P-DGEIIATGSMDNTIRLWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLASA 254

Query: 293 GVDSQIYLYD-MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D +R +   ++ +SGH +SV+ V++     G++ S   D+   +WD+   G
Sbjct: 255 SKDGTIKIWDTVRRVC--VYTLSGHTNSVSCVKWGGQ--GVLYSGSHDKTVRVWDMNLGG 310

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 77/150 (51%), Gaps = 16/150 (10%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+   + KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 374 MVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 432

Query: 262 VRLEPVKKLPT----ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGH 316
                 K L T     S    +++S   R LL +   D+ + ++D+R  +  L V + GH
Sbjct: 433 ----DGKFLSTFRGHVSSVYQVAWSSDCR-LLVSCSKDTTLKVWDVR--TRKLSVDLPGH 485

Query: 317 QDSVTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           QD V TV++S   DG  +CS G D+   +W
Sbjct: 486 QDEVYTVDWS--VDGKRVCSGGKDKMIRLW 513

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 15/104 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           D   P  M    GH++ V   S++P    ++A+   DN I+ W+
Sbjct: 174 DTQTP--MTTLTGHQNWVLCVSWSPDGE-IIATGSMDNTIRLWE 214

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 94/218 (43%), Gaps = 15/218 (6%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGL 192
           +A+   H   V   R+ P     IA+ +   T  ++D    E+  ++     H +  + L
Sbjct: 258 VADLQGHERRVAGCRFHPF-GRYIASASFDNTWRLWD---AETNHELLLQEGHGKEVFCL 313

Query: 193 AFNPHISGELL-SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW--HEFESNVFGTV 249
           AF     G LL S   D T  +WDI +      +L+ H   +  V W    FE     T 
Sbjct: 314 AFQS--DGSLLCSAGLDCTGMIWDIRSGN-CAMVLSGHTKPIYSVDWSPRGFE---VATA 367

Query: 250 SEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSP 309
           S D T+ + D R   +P   L   S  + + F KH+   L + G D  I +Y   D  + 
Sbjct: 368 SGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSG-DSWNK 426

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           + ++ GH D +  ++   H DG + S+G DR    W++
Sbjct: 427 ITILKGHTDKILALDLGTH-DGSVVSAGWDRSVKSWNV 463

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 102/213 (47%), Gaps = 21/213 (9%)

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
           A +P  +   ++GS+DTT+ +WD+ A+ K K  LT H   V D+   +    +F +VSED
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDL-ASGKLKVTLTGHVMTVRDIAVSDRHPYLF-SVSED 203

Query: 253 KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV 312
           KT++  D              S   T+S    + +L+A AG DS + L+D+R    P+  
Sbjct: 204 KTVKCWDLEKNQIIRDYHGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDIR-TRVPVIT 261

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAG 372
           + GH+  +  VE +P  D  I SS +D    +WD+               A + M +   
Sbjct: 262 LVGHKGPINQVECAP-VDPQIVSSSTDATVRLWDIV--------------AGKAMKVLTH 306

Query: 373 HRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           H+  V   + +P   + +AS   D+ I++W ++
Sbjct: 307 HKRSVRAIALHPN-EFSMASACTDD-IRSWGLA 337

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 86/188 (45%), Gaps = 23/188 (12%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           ++IAT      + ++D     ++  V TL  HK     +   P +  +++S S D TV L
Sbjct: 237 DLIATAGRDSVVKLWDI---RTRVPVITLVGHKGPINQVECAP-VDPQIVSSSTDATVRL 292

Query: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED-KTLQVHDKRVRLEPVKKLPT 272
           WDI A K  K +LT H   V  +  H  E ++    ++D ++  + D  + L   +   T
Sbjct: 293 WDIVAGKAMK-VLTHHKRSVRAIALHPNEFSMASACTDDIRSWGLADGSL-LTNFESEKT 350

Query: 273 ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQ-DSVTTVEFSPHTD- 330
               NTLS ++   ++L A G D  +  YD +         SGH+  S+ T E     + 
Sbjct: 351 G-IINTLSINQD--DVLFAGGDDGMLSFYDYK---------SGHKYQSLATREMIGSLES 398

Query: 331 --GIICSS 336
             G++CS+
Sbjct: 399 ERGVLCST 406

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 109/270 (40%), Gaps = 28/270 (10%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D +    +  + TL+ H  +   + +     G L SGS D 
Sbjct: 245 PGDKPRLASASKDGTIKIWDTS---RRVCIYTLSGHTNSVSCVKWGGQ--GLLYSGSHDK 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           TV +WD+    K  +IL SH   VN +      +   G      T     +  R + ++ 
Sbjct: 300 TVRVWDMNVGGKCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALEN 359

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
               +  N       +  L+  A  D  ++L+D      PL  ++GHQ  V  V FSP  
Sbjct: 360 YEKIAKRN-----GKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSP-- 412

Query: 330 DG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
           DG  I S+  D    +W            D  +G    +    GH + V + +++     
Sbjct: 413 DGRFIVSASFDNSIKLW------------DGRNGT--FISTFRGHVASVYQVAWSSDCR- 457

Query: 389 LLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           LL S  +D  ++ W V  + ++   P   D
Sbjct: 458 LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 82/179 (45%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H        F PH S  +++G+ D T  +WD +  + P + L+ H + V  V W 
Sbjct: 137 SAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDCD-TQTPMATLSGHQNWVLCVAWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +     T S D T+++ D +        L+  +K  T+  +  L   K   +  LA+A
Sbjct: 196 P-DGETIATGSMDCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRLASA 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       ++ +SGH +SV+ V++     G++ S   D+   +WD+   G
Sbjct: 255 SKDGTIKIWDTSRRVC-IYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDMNVGG 310

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 74/146 (50%), Gaps = 8/146 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LWD   + KP + LT H  +VN V +   +     + S D ++++ D R
Sbjct: 374 IVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSP-DGRFIVSASFDNSIKLWDGR 432

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDSV 320
                       +    +++S   R LL +   D+ + ++D+R  +  L V + GH+D V
Sbjct: 433 NGTFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWDVR--TRKLSVDLPGHKDEV 489

Query: 321 TTVEFSPHTDGI-ICSSGSDRRAIIW 345
            TV++S   DG  +CS G D+   +W
Sbjct: 490 YTVDWS--VDGKRVCSGGKDKMVRLW 513

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 10/48 (20%), Positives = 25/48 (52%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           ++ ++ ++     ++GH  ++   +F+PHT   + +   D  A +WD 
Sbjct: 126 VFKVKPITRSSSAIAGHGATILCSQFAPHTSSRMVTGAGDNTARVWDC 173

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 98/201 (48%), Gaps = 21/201 (10%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+DT++ +WD+ A+ K K  L+ H   V D+   E    +F + SEDKT++  D    
Sbjct: 140 TGSNDTSIKVWDL-ASGKLKLTLSGHIMTVRDLAISERHPYMF-SASEDKTIKCWDLEKN 197

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
           +         S  +T+S    + +L+ +AG DS + L+DMR    P+  + GH+  +  V
Sbjct: 198 MVIRNYHGHLSGVHTVSLHP-TLDLVVSAGRDSVVKLWDMR-TRVPVMNLIGHKSPINKV 255

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
              P  D  I S  +D    +WD+T             G    ++ H  H+  V +F+ +
Sbjct: 256 RCLP-VDPQIISCSTDANIRLWDITA------------GKSAKILTH--HKRSVRDFALH 300

Query: 384 PQIPWLLASTEEDNVIQAWKV 404
           P   + +AS   D+ I++WK+
Sbjct: 301 PS-EFSMASACTDD-IRSWKL 319

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 42/100 (42%), Gaps = 15/100 (15%)

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           + V++GH   V  VE  P  +    +  +D    +WDL               + +L + 
Sbjct: 115 IRVINGHIGWVRCVEVDPVDNAWYATGSNDTSIKVWDL--------------ASGKLKLT 160

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
            +GH   V + + + + P++  S  ED  I+ W +   +V
Sbjct: 161 LSGHIMTVRDLAISERHPYMF-SASEDKTIKCWDLEKNMV 199

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 2/127 (1%)

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           T+ LWD  A  KP S L+   D +  VK+++ E+++  +   D ++ ++D R    P +K
Sbjct: 194 TIQLWDT-ARSKPLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDVRTN-SPTQK 251

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
           +      N + ++         A  D   Y YDMR+MS  L+V   H  +V  V+F+P  
Sbjct: 252 IVQRLRTNAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTG 311

Query: 330 DGIICSS 336
           D I+  S
Sbjct: 312 DEIVTGS 318

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 77/200 (38%), Gaps = 43/200 (21%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHIS------GELLSGSD 207
           N +A+ +G G I  ++ +   S+ ++ +   H     GL  +P  S        +LS  D
Sbjct: 81  NKVASGSGDGVIKYWNMS---SRDEICSFKAHYGLITGLCVSPQRSPLNRDQHFMLSCGD 137

Query: 208 DTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D TV LW +             DD              F  V +D+ L   D       +
Sbjct: 138 DKTVKLWSMNG-----------DD--------------FANVKDDQNLNSQDG-----LL 167

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
           K       F  +   K     +        I L+D    S PL  +S   D++T+V+F+ 
Sbjct: 168 KTFYGEHAFQGIDHHKVKTTFVTGGPT---IQLWDTA-RSKPLSNLSWGADNITSVKFNQ 223

Query: 328 HTDGIICSSGSDRRAIIWDL 347
               I+ S+GSD   +++D+
Sbjct: 224 TETDILASTGSDNSIVLYDV 243

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 102/213 (47%), Gaps = 21/213 (9%)

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
           A +P  +   ++GS+DTT+ +WD+ A  K K+ L  H   V D+   +    +F +VSED
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDL-ATGKLKTTLAGHVMTVRDIAVSDRHPYLF-SVSED 203

Query: 253 KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV 312
           KT++  D              S   T+S    + +L+A AG DS + L+D+R    P+  
Sbjct: 204 KTVKCWDLEKNHIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVVKLWDIR-TRMPVIT 261

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAG 372
           + GH+  +  V+ +P  D  I SS +D    +WD+               A + M +   
Sbjct: 262 LVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDIV--------------AGKAMKVLTH 306

Query: 373 HRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           H+  V   + +P+  + LAS   D+ I++W ++
Sbjct: 307 HKRSVRATALHPK-EFSLASACTDD-IRSWGIA 337

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 11/173 (6%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGL 192
           I + + H+  V      P   ++IAT      + ++D     ++  V TL  HK     +
Sbjct: 217 IRDYYGHLSGVRTVSIHPT-LDLIATAGRDSVVKLWD---IRTRMPVITLVGHKGPINQV 272

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
              P +  +++S S D TV LWDI A K  K +LT H   V     H  E ++    ++D
Sbjct: 273 QCTP-VDPQIVSSSTDATVRLWDIVAGKAMK-VLTHHKRSVRATALHPKEFSLASACTDD 330

Query: 253 -KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
            ++  + D  + L   +   T    NTLS ++   ++L A G D  +  YD +
Sbjct: 331 IRSWGIADGSL-LTNFESEKTG-IINTLSINQD--DVLFAGGDDGTLSFYDYK 379

>TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {ON}
           Anc_8.672 YPL151C
          Length = 414

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 99/201 (49%), Gaps = 21/201 (10%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS DTT+ +WD+E+  K K  L+ H   V D+   +    +F + SEDK ++  D    
Sbjct: 120 TGSSDTTIKIWDLESG-KLKITLSGHVMPVRDIAISKRSPYLF-SASEDKLIKCWDLEKN 177

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
           +   +     S  NT+     + +L+A AG DS I L+D+R  ++ + ++ GH+  VTTV
Sbjct: 178 MAIREYFGHLSGVNTVDVHP-TLDLIATAGRDSTIRLWDIRSRTAVMTLI-GHKAPVTTV 235

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
           +  P  D  + S+ +D    +WD+              G     + H  H+  V + + N
Sbjct: 236 KCIP-VDPQVVSASNDATVKLWDIVA------------GKAIKTLTH--HKRTVRDIAVN 280

Query: 384 PQIPWLLASTEEDNVIQAWKV 404
           P   + +AS   D+ I++W++
Sbjct: 281 PT-EFSIASACTDD-IRSWRL 299

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 81/179 (45%), Gaps = 17/179 (9%)

Query: 130 SFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENG 189
           + AI   F H+  V      P   ++IAT     TI ++D     S+  V TL  HK   
Sbjct: 177 NMAIREYFGHLSGVNTVDVHPT-LDLIATAGRDSTIRLWD---IRSRTAVMTLIGHKAPV 232

Query: 190 YGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTV 249
             +   P +  +++S S+D TV LWDI A K  K+ LT H   V D+  +  E ++    
Sbjct: 233 TTVKCIP-VDPQVVSASNDATVKLWDIVAGKAIKT-LTHHKRTVRDIAVNPTEFSIASAC 290

Query: 250 SEDKTLQVHDKRVRLEPVKKLPTASPFNTL----SFSKHSRNLLAAAGVDSQIYLYDMR 304
           ++D    +   R+   P   L T    +TL    S S +  N++AA G +  +  +D +
Sbjct: 291 TDD----IRSWRL---PEGSLLTNFESDTLGIVNSISINQDNIMAACGDNGVLSFFDYK 342

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 15/91 (16%)

Query: 312 VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHA 371
           V++GH   V  VE     +    +  SD    IWDL               + +L +  +
Sbjct: 97  VINGHLGWVRCVEVDTVENKWFATGSSDTTIKIWDLE--------------SGKLKITLS 142

Query: 372 GHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           GH  PV + + + + P+L  S  ED +I+ W
Sbjct: 143 GHVMPVRDIAISKRSPYLF-SASEDKLIKCW 172

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 85/182 (46%), Gaps = 18/182 (9%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF P+ S  +++G+ D T  +WD +  + PK+ LT H + V  V + 
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCD-TQTPKATLTGHFNWVLCVSYC 195

Query: 240 EFESNVFGTVSEDKTLQVHDK----------RVRLEPVKKLPTASPFNTLSFSKHSRNLL 289
                V  T S D T+++ D           R  L+ +  L    P + +   +  R  L
Sbjct: 196 P-NGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITSL-AWEPIHLVKPGESPR--L 251

Query: 290 AAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349
           A+A  D  I ++D+      L+ MSGH +SV+ +++S    GII S   D+   +WD+  
Sbjct: 252 ASASKDGTIRIWDITRRVC-LYTMSGHTNSVSCIKWSGQ--GIIYSGSHDKTVRVWDMNA 308

Query: 350 IG 351
            G
Sbjct: 309 DG 310

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 112/270 (41%), Gaps = 28/270 (10%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P  S  +A+ +  GTI I+D T    +  + T++ H  +   + ++    G + SGS D 
Sbjct: 245 PGESPRLASASKDGTIRIWDIT---RRVCLYTMSGHTNSVSCIKWSGQ--GIIYSGSHDK 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           TV +WD+ A  K  +IL SH   VN +      +   G            K  R + +  
Sbjct: 300 TVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKAL-- 357

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
              A+    +  +     L+  A  D  ++L++    + P+  M+GHQ  V  V FSP  
Sbjct: 358 ---ANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP-- 412

Query: 330 DG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
           DG  I S+  D    +W            D  DG  + +    GH + V + +++     
Sbjct: 413 DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR- 457

Query: 389 LLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           LL S  +D  ++ W V  + ++   P   D
Sbjct: 458 LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 114/273 (41%), Gaps = 34/273 (12%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D     S+    T++ H  +   + +     G L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTV---SRVCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHDR 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKW---HEFESNVFGTVSEDKTLQVHDKRVRLEP 266
           TV +WDI +  +  +IL SH   VN +     +      F    +  +     ++  LE 
Sbjct: 300 TVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALEN 359

Query: 267 VKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFS 326
            +K+           + +S  ++  A  D  ++L++    + P+  M+GHQ  V  V FS
Sbjct: 360 YEKI--------CKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFS 411

Query: 327 PHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ 385
           P  DG  I S+  D    +W            D  DG  + +    GH + V + +++  
Sbjct: 412 P--DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSD 455

Query: 386 IPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
              LL S  +D  ++ W V  + ++   P   D
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P   L  H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGHYNWVLCVSWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +  V  T S D T+++ D +        L    K  T+  +  +   K  S+  LA++
Sbjct: 196 P-DGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASS 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D        + MSGH +SV+ V++     G++ S   DR   +WD+   G
Sbjct: 255 SKDGTIKIWDTVSRVCQ-YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           D   P  M    GH + V   S++P    ++A+   DN I+ W
Sbjct: 174 DTQTP--MHTLKGHYNWVLCVSWSPDGE-VIATGSMDNTIRLW 213

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 109/272 (40%), Gaps = 32/272 (11%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P     +A+ +  GTI I+D T    +  + TL+ H  +   + +     G L SGS D 
Sbjct: 245 PGQKPRLASASKDGTIKIWDTT---RRVCLITLSGHTSSVSCIKWGGQ--GVLYSGSHDK 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKW---HEFESNVFGTVSEDKTLQVHDKRVRLEP 266
           T+  WD+    K  +IL SH   VN +     +      F   SE  +     ++  L+ 
Sbjct: 300 TIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKN 359

Query: 267 VKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFS 326
            +K+   +             L+  A  D  +YL++    + P+  M+GHQ  V  V FS
Sbjct: 360 YEKIAKRN--------GEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFS 411

Query: 327 PHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQI 386
           P    I+ S+  D    +W            +  DG  + +    GH + V + +++   
Sbjct: 412 PDGRHIV-SASFDNSIKLW------------NGRDG--KFISTFRGHVASVYQVAWSSDC 456

Query: 387 PWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
             LL S  +D  ++ W V  K +    P   D
Sbjct: 457 R-LLVSCSKDTTLKVWDVKTKKLAVDLPGHKD 487

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 79/180 (43%), Gaps = 14/180 (7%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD    + P S L  H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCN-TQTPMSTLKGHFNWVLCVSWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRVRLEPV-------KKLPTASPFNTLSFSKHSRN-LLAA 291
             +  +  T S D T+++ +   + +PV        K  T+  +  +   K  +   LA+
Sbjct: 196 P-DGELIATGSMDNTIRLWEGN-KGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLAS 253

Query: 292 AGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
           A  D  I ++D       L  +SGH  SV+ +++     G++ S   D+    WD+   G
Sbjct: 254 ASKDGTIKIWDTTRRVC-LITLSGHTSSVSCIKWGGQ--GVLYSGSHDKTIRAWDMNLGG 310

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 15/104 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           +   P  M    GH + V   S++P    L+A+   DN I+ W+
Sbjct: 174 NTQTP--MSTLKGHFNWVLCVSWSPDGE-LIATGSMDNTIRLWE 214

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWDI  +K P S L+   D +N VK+++ ++NV G+   D ++ ++D R      +K+
Sbjct: 198 INLWDINRSK-PLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTN-SATQKI 255

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N++ ++         A  D   Y YDMR+MS  L+V   H  +V  V+ SP  +
Sbjct: 256 VQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGE 315

Query: 331 GIICSS 336
            ++ +S
Sbjct: 316 EVVTAS 321

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 89/210 (42%), Gaps = 46/210 (21%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHI------SGE---LLS 204
           N IA+ +G G I  +D +   S+ Q+++   H     GL   P +      SG    +LS
Sbjct: 81  NKIASGSGDGVIKYWDMS---SREQIASFKAHYGTITGLCITPKVNIDSASSGNQNFVLS 137

Query: 205 GSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRL 264
            SDD TV LW +           +H+D              F  V  D+ +   +     
Sbjct: 138 SSDDKTVKLWSV-----------NHED--------------FAHVDNDQVINTDNG---- 168

Query: 265 EPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVE 324
             +K       F  L  S+ + N +       +I L+D+ + S PL  +S   D++ TV+
Sbjct: 169 -LIKHYYGEHAFQGLDHSRMTSNFVTGG---PRINLWDI-NRSKPLSDLSWGADNINTVK 223

Query: 325 FSPHTDGIICSSGSDRRAIIWDLTQIGAEQ 354
           F+ +   ++ S+GSD   +++DL    A Q
Sbjct: 224 FNQNDANVLGSAGSDNSIVLYDLRTNSATQ 253

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 115/276 (41%), Gaps = 40/276 (14%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D     S+    T++ H  +   + +     G L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTV---SRVCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHDR 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH------DKRVR 263
           TV +WD+ +  +  +IL SH   VN +           ++S D  L+V        K   
Sbjct: 300 TVRVWDMNSQGRCINILKSHAHWVNHL-----------SLSTDYALRVGAFDHTGQKPTS 348

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
            E  +K   A+       + +S  ++  A  D  I+L++    + P+  M+GHQ  V  V
Sbjct: 349 PEDAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHV 408

Query: 324 EFSPHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSF 382
            FSP  DG  I S+  D    +W            D  DG  + +    GH + V + ++
Sbjct: 409 AFSP--DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAW 452

Query: 383 NPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           +     LL S  +D  ++ W V    ++   P   D
Sbjct: 453 SSDCR-LLVSCSKDTTLKVWDVRTGKLSVDLPGHQD 487

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P   L  H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGHFNWVLCVAWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +  V  T S D T+++ D +        L    K  T+  +  +   K  S+  LA++
Sbjct: 196 P-DGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASS 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D        + MSGH +SV+ V++     G++ S   DR   +WD+   G
Sbjct: 255 SKDGTIKIWDTVSRVCQ-YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+   + KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 374 MVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 432

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LL +   D+ + ++D+R  +  L V + GHQD 
Sbjct: 433 DGKFISTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVR--TGKLSVDLPGHQDE 488

Query: 320 VTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   +W
Sbjct: 489 VYTVDWS--VDGKRVCSGGRDKMVRLW 513

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           D   P  M    GH + V   +++P    ++A+   DN I+ W
Sbjct: 174 DTQTP--MHTLKGHFNWVLCVAWSPDGE-VIATGSMDNTIRLW 213

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 107/265 (40%), Gaps = 36/265 (13%)

Query: 156 IATINGKGTISIFDR----TLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTV 211
           +AT +  GTI ++D      L      V++++  K  G  L         L SGS D TV
Sbjct: 251 LATSSKDGTIKVWDTGRRVCLYTLSGHVNSVSCVKWGGKNL---------LYSGSHDKTV 301

Query: 212 ALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLP 271
            +WD+    K  +IL SH   VN +      +   G       +    +  R + +K   
Sbjct: 302 RVWDMNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYE 361

Query: 272 TASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG 331
             +  N          L+  A  D  ++L++    + P+  M+GHQ  V  V FSP  DG
Sbjct: 362 KVAKRN-----GSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP--DG 414

Query: 332 -IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLL 390
             I S+  D    +W            D+ DG  + +    GH + V + +++     LL
Sbjct: 415 RYIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LL 459

Query: 391 ASTEEDNVIQAWKVSMKLVNASPPA 415
           AS  +D  ++ W +  K ++   P 
Sbjct: 460 ASCSKDTSLKVWDIRTKKLSVDLPG 484

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+   + KP S +T H  +VN V +   +     + S D ++++ D R
Sbjct: 374 MVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDSR 432

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LLA+   D+ + ++D+R  +  L V + GH D 
Sbjct: 433 DGKFITTFRGHVASVYQ-VAWSSDCR-LLASCSKDTSLKVWDIR--TKKLSVDLPGHLDE 488

Query: 320 VTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   +W
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMVRLW 513

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           + +A H       +F PH S  +++G+ D T  +WD +  + P   L+ H + V  V W 
Sbjct: 137 AAIAGHGSTILCSSFAPHTSSRMVTGAGDNTARIWDCD-TQTPMVTLSGHTNWVLCVAWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKR------VRLEPVKKLPTASPFNTLSFSKHS-RNLLAAA 292
             +  +  T S D T+++ + +        +   +K  T+  +  L   K   R  LA +
Sbjct: 196 P-DGELIATGSMDNTIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATS 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       L+ +SGH +SV+ V++      ++ S   D+   +WD+   G
Sbjct: 255 SKDGTIKVWDTGRRVC-LYTLSGHVNSVSCVKWG--GKNLLYSGSHDKTVRVWDMNLGG 310

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 15/104 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ +R ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 IFKVRPITRSSAAIAGHGSTILCSSFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           D   P  M+  +GH + V   +++P    L+A+   DN I+ W+
Sbjct: 174 DTQTP--MVTLSGHTNWVLCVAWSPDGE-LIATGSMDNTIRLWE 214

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 109/256 (42%), Gaps = 37/256 (14%)

Query: 163 GTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD---IEAA 219
           G +  F       +  V+ +A H      + FN   +   +SG     + +WD   I AA
Sbjct: 83  GVVEFF---CARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAA 139

Query: 220 K----KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
                 P + +T  D+ V  + W++  ++VF +        + D + + E V  L   SP
Sbjct: 140 GYSPFGPGTAMTPIDE-VQSLAWNQSLAHVFASAGSSGFASIWDLKAKKE-VIHLSYTSP 197

Query: 276 FNTLS--------FSKHSRNLLAAAGVDSQ--IYLYDMRDMSSPLHVMS-GHQDSVTTVE 324
            + L            +S  +  A G D++  I ++D+R+ + PL VMS GH   + +++
Sbjct: 198 HSGLKNQLAVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLD 257

Query: 325 FSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNP 384
           +  H + ++ SSG D   I+W+      E++Q          +  +    +   +  F P
Sbjct: 258 WCKHDEKLMLSSGRDNTCILWN-----PEEAQK---------LTQYPTRGNWCFKTKFAP 303

Query: 385 QIPWLLASTEEDNVIQ 400
           + P L AS   DN IQ
Sbjct: 304 EAPDLFASASFDNKIQ 319

>KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 420

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 106/253 (41%), Gaps = 52/253 (20%)

Query: 143 VIRARYMP-ANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGL--------- 192
           + R ++ P  NS  +AT +    +  +   + + +  +S   ++K  G G          
Sbjct: 108 ISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALGQLPP 167

Query: 193 -------AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNV 245
                  A +P++   ++S S DTT  +WD++A    K+ L +HD  V DVK+    + +
Sbjct: 168 VSSFHWNAVDPNL---IISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFLTQSTQL 224

Query: 246 FGTVSEDKTLQVHDKR------VRLEPVKKLPTASPFNT--------------------- 278
           F +   D +++V D R      +  EP  + PTA                          
Sbjct: 225 FASCGGDGSVRVFDLRSLAHSTIIYEPSSQ-PTAGSSGDSSAASGGSGSGSNSASSGSNA 283

Query: 279 ---LSFSKHSRNLLAAAGVDSQ-IYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIIC 334
              L  S    N++A    DS  + + DMR   + +  + GH  +V  +++ P    ++ 
Sbjct: 284 LLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHNVLL 343

Query: 335 SSGSDRRAIIWDL 347
           + G D +A++WDL
Sbjct: 344 TCGDDCQALLWDL 356

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 118/277 (42%), Gaps = 42/277 (15%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A+ +  GTI I+D      +  + TL+ H  +   + +     G L SGS D TV +WD
Sbjct: 253 LASASKDGTIKIWD---TARRVCLYTLSGHSNSVACVKWGGE--GLLYSGSHDKTVRVWD 307

Query: 216 IEAAK--KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD-KRVRLEP-----V 267
           + +A   K  SIL +H   VN +           ++S D  L++       ++P      
Sbjct: 308 MNSATVGKCISILKNHAHWVNHL-----------SLSTDYALRIGPFDHTGVKPSTPAEA 356

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
           K+   A+       +  +  L+  A  D  ++L++ + ++ PL  M+GHQ  V  V FSP
Sbjct: 357 KRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSP 416

Query: 328 HTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQI 386
             DG  I S+  D    +W            D  DG  + +    GH + V + +++   
Sbjct: 417 --DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDC 460

Query: 387 PWLLASTEEDNVIQAWKVSMKLVNASPPAISDPSLLV 423
             LL S  +D  ++ W V  + ++   P   D    V
Sbjct: 461 R-LLVSCSKDTTLKVWDVRTRKLSVDLPGHQDEVFTV 496

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+ +   KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 378 MVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 436

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LL +   D+ + ++D+R  +  L V + GHQD 
Sbjct: 437 DGKFLSTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVR--TRKLSVDLPGHQDE 492

Query: 320 VTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   IW
Sbjct: 493 VFTVDWS--VDGKRVCSGGKDKMVRIW 517

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 82/182 (45%), Gaps = 20/182 (10%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF P  S  +++G+ D T  +WD +  + P + L  H + V  V W 
Sbjct: 133 SAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCD-TQTPLATLEGHSNWVLCVSWS 191

Query: 240 EFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP--------FNTLSFS------KHS 285
             +  V  T S D T+++ +   + +PV     +S           +LS+         +
Sbjct: 192 P-DGEVIATGSMDSTIRLWES-TKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGA 249

Query: 286 RNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
           +  LA+A  D  I ++D       L+ +SGH +SV  V++    +G++ S   D+   +W
Sbjct: 250 KPRLASASKDGTIKIWDTARRVC-LYTLSGHSNSVACVKWG--GEGLLYSGSHDKTVRVW 306

Query: 346 DL 347
           D+
Sbjct: 307 DM 308

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 3/137 (2%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD  +  KP S LT   D V +VK+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 195 IQLWD-SSRSKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDLRTN-SPTQKI 252

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
             +   N + ++         A  D   Y YDMR+MS  L+V   H  +V  V+FSP T 
Sbjct: 253 VQSMRSNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSP-TG 311

Query: 331 GIICSSGSDRRAIIWDL 347
             + +   D+   I+D+
Sbjct: 312 TELVTGSYDKTIRIYDI 328

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/270 (24%), Positives = 111/270 (41%), Gaps = 28/270 (10%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D +    +  + TL  H  +   + +     G L SGS D 
Sbjct: 247 PGSKPRLASASKDGTIRIWDSS---RRVCLMTLGGHTNSVSCVKWGGE--GILYSGSHDK 301

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           TV  WD++   K  +IL SH   VN +      +   G          + K  R + ++ 
Sbjct: 302 TVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQN 361

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
               +  N     KH   L+  A  D  ++L++    + P+  M+GHQ  V  V FSP  
Sbjct: 362 YEKVARKN----GKH-EELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP-- 414

Query: 330 DG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
           DG  I S+  D    +WD    G E +           +    GH + V + +++     
Sbjct: 415 DGKYIVSASFDNSIKLWD----GKEGT----------FLSTFRGHVASVYQVAWSSDCR- 459

Query: 389 LLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           LL S  +D  ++ W V  + ++   P   D
Sbjct: 460 LLVSCSKDTTLKVWDVKTRKLSVDLPGHQD 489

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 126/316 (39%), Gaps = 63/316 (19%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKEN 188
           SS AIA    H   ++ + + P  S+ + T  G  T  I+D   +  K    TL  H+  
Sbjct: 137 SSSAIAG---HGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKV---TLNGHRN- 189

Query: 189 GYGLAFNPHISGELL-SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW---HEFESN 244
            + L  +    GE++ +GS D T+ LWD E+ K     L  H   +  + W   H  E  
Sbjct: 190 -WVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPG 248

Query: 245 V---FGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSK-HSRNLLAAAGVDSQIYL 300
                 + S+D T+++ D   R   V  +      N++S  K     +L +   D  +  
Sbjct: 249 SKPRLASASKDGTIRIWDSSRR---VCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRA 305

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQI---GAEQSQD 357
           +DM+     ++++  H   V  +  S  TD  +       R   +D T +    A++++D
Sbjct: 306 WDMKQNGKCINILKSHAHWVNHLSLS--TDYAL-------RVGAFDYTGVKPANAKEARD 356

Query: 358 DA---------DDGAPELMMMHA----------------------GHRSPVNEFSFNPQI 386
            A          +G  E +M+ A                      GH+  VN  +F+P  
Sbjct: 357 KALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDG 416

Query: 387 PWLLASTEEDNVIQAW 402
            +++ S   DN I+ W
Sbjct: 417 KYIV-SASFDNSIKLW 431

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD-K 260
           +++ SDD T+ LW+     KP S +T H  +VN V +   +     + S D ++++ D K
Sbjct: 376 MVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP-DGKYIVSASFDNSIKLWDGK 434

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
                   +   AS +  +++S   R LL +   D+ + ++D++  +  L V + GHQD 
Sbjct: 435 EGTFLSTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVK--TRKLSVDLPGHQDE 490

Query: 320 VTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   +W
Sbjct: 491 VYTVDWS--VDGKRVCSGGKDKMMRLW 515

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 47/103 (45%), Gaps = 15/103 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + + G D  A IW            D 
Sbjct: 128 VFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVTGGGDNTARIW------------DC 175

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           D   P++ +   GHR+ V   S++     ++A+   DN I+ W
Sbjct: 176 DTQTPKVTL--NGHRNWVLCVSWSADGE-VIATGSMDNTIRLW 215

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/333 (21%), Positives = 138/333 (41%), Gaps = 49/333 (14%)

Query: 87  SLIFGTHTAGEEVNYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRA 146
           SL+ GT +   + N+   + + L + +A        D +   +S A+  KF  ++     
Sbjct: 22  SLVTGTASGTVDANFSSESALELWSLLAS-------DPSKPKASLAVDAKFNDLD----- 69

Query: 147 RYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGS 206
                +  IIA     G + +F  T +  K++ +    H+     + FN   +  L SG 
Sbjct: 70  --WSNDDKIIAGALDSGVVELFSSTGDSLKSE-ARFQQHQGAAKTVKFNSKQNNVLASGG 126

Query: 207 DDTTVALWDIEAAKK--------PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258
               + +WD+    K           + ++  + V  + W++  ++VF +        + 
Sbjct: 127 SKGEIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIW 186

Query: 259 DKRVRLEPVKKLPTASPFNTLS--------FSKHSRNLLAAAGVDSQ--IYLYDMRDMSS 308
           D + + E V  L  ASP   L           K+S  +  A G D++  I ++D+R+ ++
Sbjct: 187 DLKAKKE-VIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANT 245

Query: 309 PLHVMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELM 367
           PL V+S GH   + ++++    + ++ SSG D   ++W+  + G E +Q           
Sbjct: 246 PLQVLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN-PESGQELTQ----------- 293

Query: 368 MMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQ 400
                  +   +  F P+ P L AS   DN IQ
Sbjct: 294 --FPTRGNWCFKTKFAPEAPDLFASASFDNKIQ 324

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 114/273 (41%), Gaps = 34/273 (12%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D     S+    T++ H  +   + +     G L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDTV---SRVCQYTMSGHTNSVSCVKWGGQ--GLLYSGSHDR 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKW---HEFESNVFGTVSEDKTLQVHDKRVRLEP 266
           TV +WDI +  +  +IL SH   VN +     +      F    +  +     ++  LE 
Sbjct: 300 TVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKRPSTPEDAQKKALEN 359

Query: 267 VKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFS 326
            +K+           + +S  ++  A  D  ++L++    + P+  M+GHQ  V  V FS
Sbjct: 360 YEKI--------CKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAFS 411

Query: 327 PHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ 385
           P  DG  I S+  D    +W            D  DG  + +    GH + V + +++  
Sbjct: 412 P--DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSD 455

Query: 386 IPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
              LL S  +D  ++ W V  + ++   P   D
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P   L  H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGHYNWVLCVSWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +  V  T S D T+++ D +        L    K  T+  +  +   K  S+  LA++
Sbjct: 196 P-DGEVIATGSMDNTIRLWDPKTGECLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASS 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D        + MSGH +SV+ V++     G++ S   DR   +WD+   G
Sbjct: 255 SKDGTIKIWDTVSRVCQ-YTMSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDINSQG 310

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           D   P  M    GH + V   S++P    ++A+   DN I+ W
Sbjct: 174 DTQTP--MHTLKGHYNWVLCVSWSPDGE-VIATGSMDNTIRLW 213

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 112/280 (40%), Gaps = 50/280 (17%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A+ +  GTI ++D T    +  + TL+ H  +   + +       L +GS D T+ +WD
Sbjct: 250 LASASKDGTIKVWDTT---GRVCLYTLSGHTSSVSCVRWGGQ--NMLYTGSHDKTIRVWD 304

Query: 216 IEAAKKPKSILTSHDDIVNDVKW------------HEFESNVFGTVSEDKTLQVHDKRVR 263
           + +  +  +IL SH   VN +              H          + DK L+ ++K V+
Sbjct: 305 MNSNGRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVK 364

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                             + H+  L+  A  D  ++L++    + PL  M+GHQ  V  V
Sbjct: 365 K-----------------NGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHV 407

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
            FSP    I+ S+  D    +W            D  DG  + +    GH + V + +++
Sbjct: 408 AFSPDGRHIV-SASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWS 452

Query: 384 PQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPSLLV 423
                LL S  +D  ++ W V  K ++   P   D    V
Sbjct: 453 SDCR-LLVSCSKDTTLKVWDVRTKKLSVDLPGHQDEVFTV 491

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 81/154 (52%), Gaps = 10/154 (6%)

Query: 195 NPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKT 254
           N H    +++ SDD T+ LW+   + KP + +T H  +VN V +     ++  + S D +
Sbjct: 366 NGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPDGRHIV-SASFDNS 424

Query: 255 LQVHDKR-VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV- 312
           +++ D R  +     +   AS +  +++S   R LL +   D+ + ++D+R  +  L V 
Sbjct: 425 IKLWDGRDGKFISTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVR--TKKLSVD 480

Query: 313 MSGHQDSVTTVEFSPHTDG-IICSSGSDRRAIIW 345
           + GHQD V TV++S   DG  +CS G D+   +W
Sbjct: 481 LPGHQDEVFTVDWS--VDGKRVCSGGKDKMVRLW 512

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 82/180 (45%), Gaps = 14/180 (7%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF P+ S  +++G+ D T  LWD +  + P + L+ H + V  V W 
Sbjct: 136 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDCD-TQTPMATLSGHSNWVLCVAWS 194

Query: 240 EFESNVFGTVSEDKTLQVHDKRVRLEPV-------KKLPTASPFNTLSFSK-HSRNLLAA 291
             ++ V  T S D T+++ +  +  +P+        K  T+  +  L   K   +  LA+
Sbjct: 195 P-DAEVIATGSMDNTIRLWNG-INGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLAS 252

Query: 292 AGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
           A  D  I ++D       L+ +SGH  SV+ V +      ++ +   D+   +WD+   G
Sbjct: 253 ASKDGTIKVWDTTGRVC-LYTLSGHTSSVSCVRWGGQN--MLYTGSHDKTIRVWDMNSNG 309

>Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADR108C
          Length = 311

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 80/167 (47%), Gaps = 9/167 (5%)

Query: 199 SGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258
           S +LL+G  +  V ++D+E  +K +     H  +VN++     E ++FG+VS+D TL   
Sbjct: 66  SSQLLAGCANGKVCIYDVETGRKMRQWGGGHKRVVNEIV-GLCEEHLFGSVSDDGTLCWW 124

Query: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRN-----LLAAAGVDSQIYLYDMRDMSSPL-HV 312
           D RVR +PV ++    P  TL+  +          L  +GV+  +  YD+R  +  +   
Sbjct: 125 DSRVR-KPVGRVVGEFPLLTLALGRRGDGDERSPFLYTSGVEPVVRCYDLRKNTDLIAEC 183

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
            + H   V+++  S +    +CS G D      D+   G  +++ D 
Sbjct: 184 ETTHATGVSSLCVSSNGS-RVCSLGFDDNLQFHDIDASGKLKNRQDG 229

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 112/264 (42%), Gaps = 37/264 (14%)

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           IIA     G +  F     E    V+ LA H      + FN      L SG     + +W
Sbjct: 76  IIAGALENGVVEFF---APEEPRSVAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIW 132

Query: 215 D---IE----AAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D   IE    A   P + +T  D+I + + W++ +++VF +        + D + + E V
Sbjct: 133 DANKIETPGYAPFVPGTAMTPMDEIYS-LAWNQNQAHVFASAGSSGYASIWDLKAKKE-V 190

Query: 268 KKLPTASPF----NTLSF----SKHSRNLLAAAGVDS--QIYLYDMRDMSSPLHVMS-GH 316
             L  ASP     N LS       +S  +  A+G DS   I ++D+R+ + P+ V+S  H
Sbjct: 191 IHLSYASPVTGQRNQLSIVEWHPNNSTRIATASGNDSDPSILIWDLRNANVPMQVLSQPH 250

Query: 317 QDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSP 376
              V ++++    + ++ SSG D   ++W+      E+ Q          +  +    + 
Sbjct: 251 TKGVLSLDWCKQDETLLLSSGRDNVCVLWN-----PEEGQS---------LTQYPTRGNW 296

Query: 377 VNEFSFNPQIPWLLASTEEDNVIQ 400
             +  F PQ P L AS   DN I+
Sbjct: 297 CFKTKFAPQTPDLFASASFDNKIE 320

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 71/150 (47%), Gaps = 10/150 (6%)

Query: 206 SDDTTVALWDIEAAKK--PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           S ++T+ +W + +  +  P++ +T+ D   ND+ W    + + G + E+  ++       
Sbjct: 37  SSESTLEIWSLLSPHEATPQASITA-DAKFNDLDWSHDNAIIAGAL-ENGVVEFFAPEEP 94

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV--MSG----HQ 317
               K     +P  T++F+    N+L + G   +IY++D   + +P +   + G      
Sbjct: 95  RSVAKLAQHTTPVKTVTFNARQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPM 154

Query: 318 DSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           D + ++ ++ +   +  S+GS   A IWDL
Sbjct: 155 DEIYSLAWNQNQAHVFASAGSSGYASIWDL 184

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICS 335
           FN L +S H   ++A A  +  +  +   +  S +  ++ H   V TV F+     ++CS
Sbjct: 65  FNDLDWS-HDNAIIAGALENGVVEFFAPEEPRS-VAKLAQHTTPVKTVTFNARQHNVLCS 122

Query: 336 SGSDRRAIIWDLTQI 350
            GS     IWD  +I
Sbjct: 123 GGSKGEIYIWDANKI 137

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +K P S L+   D +  VK+++ E ++  +   D  + ++D R    P +K+
Sbjct: 194 IHLWDSNRSK-PISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDLRTN-SPTQKI 251

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++         A  D   Y YDMR+MS  LHV   H  +V  V+FSP  D
Sbjct: 252 IQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGD 311

Query: 331 GIICSS 336
            I+  S
Sbjct: 312 EIVTGS 317

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 81/180 (45%), Gaps = 20/180 (11%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFES- 243
           H++  Y +A N +   +L SGS D  +  W++   ++  S    +  +       E  S 
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREEFVSFKAHYGLVTGLCVTPEHTSK 125

Query: 244 ----NVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVD---- 295
               N   +  +DKT+++    V  +    + + +  NT    K      A  G+D    
Sbjct: 126 NKNENFMLSCGDDKTVKLWS--VNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHRE 183

Query: 296 --------SQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
                   +QI+L+D  + S P+  +S   D++T+V+F+ +   I+ S+GSD   +++DL
Sbjct: 184 ASTFVTGGAQIHLWDS-NRSKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDL 242

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 98/216 (45%), Gaps = 23/216 (10%)

Query: 152 NSNIIATINGKGTISIFDRTLEESKAQVSTLAF--HKENGYGLAFNPHISGELLSGSDDT 209
           N+ IIA     GT+ ++  T E +    ST  F  H  +   + FN      L SG ++ 
Sbjct: 73  NNEIIAGALDNGTLELYS-TNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNG 131

Query: 210 TVALWDIEAAKKPKSILT--------SHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
            + +WD+    +  S  T        S  D VN + W++  ++VF +        + D +
Sbjct: 132 EIFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 262 VRLEPVKKLPTASPFNTLS--------FSKHSRNLLAAAGVDS--QIYLYDMRDMSSPLH 311
            + E V  L   SP + +           K+S  +  A G D+   I ++D+R+ ++P+ 
Sbjct: 192 AKKE-VIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQ 250

Query: 312 VMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
            ++ GHQ  + ++++    + ++ SSG D   ++W+
Sbjct: 251 TLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 60/146 (41%), Gaps = 9/146 (6%)

Query: 265 EPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLY---DMRDMSSPLHVMSGHQDSVT 321
           +P+  L   S FN L +S H+  ++A A  +  + LY   +  D  S       H  SV 
Sbjct: 54  KPLASLQVDSKFNDLDWS-HNNEIIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVK 112

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFS 381
           TV+F+   D ++ S G++    IWD+ +    +S        P   M        VN  +
Sbjct: 113 TVKFNARQDNVLASGGNNGEIFIWDMNK--CTESPSTYTPLTPGQSMSSVDE---VNSLA 167

Query: 382 FNPQIPWLLASTEEDNVIQAWKVSMK 407
           +N  +  + AS    N    W +  K
Sbjct: 168 WNQSLAHVFASAGSSNFASIWDLKAK 193

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/223 (19%), Positives = 95/223 (42%), Gaps = 33/223 (14%)

Query: 201 ELLSGS-DDTTVALWDIEAAK---KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQ 256
           E+++G+ D+ T+ L+    A       +   SH   V  VK++  + NV  +   +  + 
Sbjct: 75  EIIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIF 134

Query: 257 VHDKR---------VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS 307
           + D             L P + + +    N+L++++   ++ A+AG  +   ++D++   
Sbjct: 135 IWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 308 SPLHVM-----SGHQDSVTTVEFSP-HTDGIICSSGSDR--RAIIWDLTQIGAEQSQDDA 359
             +H+      SG +  ++ VE+ P ++  +  ++GSD     ++WDL            
Sbjct: 195 EVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTP------ 248

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
                 +  ++ GH+  +    +  Q   LL S+  DN +  W
Sbjct: 249 ------MQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLW 285

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 100/210 (47%), Gaps = 21/210 (10%)

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
           A +P  +   ++GS+DTT+ +WD+ A  K ++ L  H   V D+   +    +F +VSED
Sbjct: 146 AIDPVNNEWFITGSNDTTMKVWDL-ATGKLRTTLAGHVMTVRDIAISDRHPYLF-SVSED 203

Query: 253 KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV 312
           KT++  D              S   T+S    + +L+A AG DS I L+D+R    P+  
Sbjct: 204 KTVKCWDLEKNQIIRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDIR-TRVPVIT 261

Query: 313 MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAG 372
           + GH+  +  V+ +P  D  I SS +D    +WD+               A + M +   
Sbjct: 262 LVGHKGPINQVQCTP-VDPQIVSSSTDATVRLWDVV--------------AGKAMKVLTH 306

Query: 373 HRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           H+  V   + +P+  + +AS   D+ I++W
Sbjct: 307 HKRSVRATALHPK-EFSVASACTDD-IRSW 334

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 88/208 (42%), Gaps = 22/208 (10%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGL 192
           I + + H+  V      P   ++IAT      I ++D     ++  V TL  HK     +
Sbjct: 217 IRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDI---RTRVPVITLVGHKGPINQV 272

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
              P +  +++S S D TV LWD+ A K  K +LT H   V     H  E +V    ++D
Sbjct: 273 QCTP-VDPQIVSSSTDATVRLWDVVAGKAMK-VLTHHKRSVRATALHPKEFSVASACTDD 330

Query: 253 KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV 312
                  +   L   +   T    NTLS ++   ++L A G +  +  YD +        
Sbjct: 331 IRSWGLVEGSLLTNFESEKTG-IINTLSINQD--DVLFAGGDNGILSFYDYK-------- 379

Query: 313 MSGHQ-DSVTTVEFSPHTDG---IICSS 336
            SGH+  S+ T E     +G   ++CS+
Sbjct: 380 -SGHKYQSLATKEMVGSLEGERSVLCST 406

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 69/153 (45%), Gaps = 4/153 (2%)

Query: 184 FHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFES 243
           FH E  +    +       ++G     + LWD     KP S L+   D V  VK+++ E+
Sbjct: 170 FHGEYAFQSIDHHRTKSTFVTGG--AQIELWDT-GRSKPVSNLSWGADNVTSVKFNQNET 226

Query: 244 NVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM 303
           ++  +   D ++ ++D R    P +K+      N + ++         A  D   Y YDM
Sbjct: 227 DILASTGSDNSVVLYDLRTN-SPTQKIVQTMRTNAICWNPMEAFNFVIANEDHNAYYYDM 285

Query: 304 RDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSS 336
           R+MS  L+V   H  +V  V+FSP  D I+  S
Sbjct: 286 RNMSRALNVFKDHVSAVMDVDFSPTGDEIVTGS 318

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 83/200 (41%), Gaps = 43/200 (21%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNP-HISGE-----LLSGSD 207
           N +AT +G G +  ++ +  E   ++ +   H     GL   P H+S       +LS  D
Sbjct: 81  NKLATASGDGVVKYWNMSTRE---ELCSFKAHYGLVTGLCVTPQHLSKNKNENYMLSCGD 137

Query: 208 DTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D  + LW + +           DD              F +  ++  L   D       +
Sbjct: 138 DKMIKLWSVNS-----------DD--------------FSSTRDNDELNTGDG-----LL 167

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
           K       F ++   + +++     G  +QI L+D    S P+  +S   D+VT+V+F+ 
Sbjct: 168 KTFHGEYAFQSIDHHR-TKSTFVTGG--AQIELWDT-GRSKPVSNLSWGADNVTSVKFNQ 223

Query: 328 HTDGIICSSGSDRRAIIWDL 347
           +   I+ S+GSD   +++DL
Sbjct: 224 NETDILASTGSDNSVVLYDL 243

>TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.276
           YPL247C
          Length = 531

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 82/190 (43%), Gaps = 36/190 (18%)

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +NP  +  L+S S DTT  +WD+++    K+ L +HD  V DV++    + +F +   D 
Sbjct: 251 WNPIDTNFLISSSIDTTCIVWDLQSNNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 310

Query: 254 TLQVHDKRV-----------------------RLEPVKKLPTASPFNTLSFSKHSR---- 286
           +++V D R                         ++    L T+S   ++  S  S     
Sbjct: 311 SVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVDHPGSLNTSSRVGSVDLSSKSNALLR 370

Query: 287 --------NLLAAAGVDSQ-IYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
                   N++A  G DS  + + DMR+  +P+  + GH   +  +++ P     I SS 
Sbjct: 371 LEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLTLDGHSAPINQIKWHPTKKNTILSSS 430

Query: 338 SDRRAIIWDL 347
            D + + W+L
Sbjct: 431 DDCQVLYWNL 440

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 29/147 (19%), Positives = 56/147 (38%), Gaps = 33/147 (22%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTLEES---------------------- 175
           H  EV   R++  ++ + A+  G G++ +FD R+L  S                      
Sbjct: 286 HDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYESAANTSMSNLSSGGMVD 345

Query: 176 -------KAQVSTLAFHKENGYGLAFNPHISGELL---SGSDDTTVALWDIEAAKKPKSI 225
                   ++V ++    ++   L   P  +   +    G+D  +V + D+     P   
Sbjct: 346 HPGSLNTSSRVGSVDLSSKSNALLRLEPSPTDPNVIATFGADSNSVLILDMRNPGTPVLT 405

Query: 226 LTSHDDIVNDVKWHEFESNVFGTVSED 252
           L  H   +N +KWH  + N   + S+D
Sbjct: 406 LDGHSAPINQIKWHPTKKNTILSSSDD 432

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +K P + L+   D ++ VK+++ E+++  +   D +L ++D R    P +K+
Sbjct: 195 IQLWDSNRSK-PLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTN-SPTQKI 252

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++         A  D   Y YDMR+MS  L+V   H  +V  V+FSP  D
Sbjct: 253 VQTMRTNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGD 312

Query: 331 GIICSS 336
            I+  S
Sbjct: 313 EIVTGS 318

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 86/192 (44%), Gaps = 22/192 (11%)

Query: 175 SKAQVSTLAF-HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIV 233
           +K  V  L + H++  Y +A N     +L +GS D  V  W++   ++  S    +  I 
Sbjct: 55  AKPFVGQLGYGHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLIT 114

Query: 234 NDVKWHEFES-----NVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS-FSKHSRN 287
                 E  S     N   + S+DKT+++    V  E    L  A   NT S   K   +
Sbjct: 115 GLCVTPEHLSKQKNENFMLSCSDDKTVKLWS--VNSEDYANLKNAEDINTASGLLKTYYS 172

Query: 288 LLAAAGVD------------SQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICS 335
             A  G+D            ++I L+D  + S PL  +S   D+++TV+F+ +   I+ S
Sbjct: 173 DFAFQGIDHHRSKSNFVTGGAKIQLWDS-NRSKPLTDLSWGADNISTVKFNQNETDILAS 231

Query: 336 SGSDRRAIIWDL 347
           +GSD   +++DL
Sbjct: 232 AGSDNSLVLYDL 243

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 88/184 (47%), Gaps = 15/184 (8%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234
           S + V + +F  EN + L   P     LL+G  +  + L D    K  + I  S +  +N
Sbjct: 3   SYSLVESNSFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKAS-ETAIN 60

Query: 235 DVK--WHEFESNVFGTVSEDKTLQVHDKRV--RLEPVKKLPTASPFNTLSFSKHSRNLLA 290
           D+K    +F +    + +    ++V D R   R+  ++     SPF +L  S+H   LLA
Sbjct: 61  DMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQN-EANSPFISLD-SRHG--LLA 116

Query: 291 AA----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
                 G+D+ +Y+YD+R   +PL  ++  H D VT ++F P    I+ S  +D    I+
Sbjct: 117 CGTELQGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIY 176

Query: 346 DLTQ 349
           DL Q
Sbjct: 177 DLKQ 180

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD+   K P S L+   D +  VK+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 201 IQLWDVNRVK-PVSNLSWGADNITSVKFNQNETDILASTGSDNSIVLYDLRTN-SPTQKI 258

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++         A  D   Y YDMR++S  L+V   H  +V  V+FSP  D
Sbjct: 259 VQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGD 318

Query: 331 GIICSS 336
            I+  S
Sbjct: 319 EIVTGS 324

 Score = 37.4 bits (85), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 60/146 (41%), Gaps = 32/146 (21%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +LS SDD TV LW I          + +D ++N       E  +  T   +   Q     
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKRSSDNDSVIN-------EEGLVRTFDGESAFQ----- 183

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
                                 H  N   A G  ++I L+D+ +   P+  +S   D++T
Sbjct: 184 ------------------GIDSHRVNSTFATG-GAKIQLWDV-NRVKPVSNLSWGADNIT 223

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDL 347
           +V+F+ +   I+ S+GSD   +++DL
Sbjct: 224 SVKFNQNETDILASTGSDNSIVLYDL 249

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 118/283 (41%), Gaps = 42/283 (14%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELL 203
           IR+     +   +AT      I I+D    E+K  V TL  H+++ Y L + P    +L+
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDL---ETKKIVMTLKGHEQDIYSLDYFPS-GNKLV 464

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV- 262
           SGS D TV +WD+       S+  S +D V  V     E       S D+T++V D    
Sbjct: 465 SGSGDRTVRIWDLTTGT--CSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTG 522

Query: 263 ----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLH----- 311
               RL+   +L T    +  S  F++  + +++ + +D  + L+++  +S         
Sbjct: 523 FLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGS-LDRSVKLWNLNGLSGQKSHAECE 581

Query: 312 -VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMH 370
              +GH+D V +V  +   D  I S   DR  + W            D   G P LM+  
Sbjct: 582 VTYTGHKDFVLSVA-TTQNDEYILSGSKDRGVLFW------------DTKSGNPLLMLQ- 627

Query: 371 AGHRSPV------NEFSFNPQIPWLLASTEEDNVIQAWKVSMK 407
            GHR+ V      N     P+   + A+   D   + WK S K
Sbjct: 628 -GHRNSVISVTVANGHPLGPEY-GVFATGSGDCKARIWKYSKK 668

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 126/295 (42%), Gaps = 49/295 (16%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE-L 202
           IR+     +   +AT      I I+D     ++  V TL  H+++ Y L + P  SG+ L
Sbjct: 473 IRSVCFSPDGKFLATGAEDKLIRIWDLA---TRRIVMTLQGHEQDIYSLDYFP--SGDKL 527

Query: 203 LSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
           +SGS D TV +WD+   +   S+  S +D V  V     +  +    S D+T+++ D   
Sbjct: 528 VSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSET 585

Query: 263 -----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMR----------- 304
                RL+   +L T    +  S  F++    +++ + +D  + L+++R           
Sbjct: 586 GFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGGTAEGKA 644

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAP 364
           + ++     +GH+D V +V  +   D  I S   DR  + W            D   G P
Sbjct: 645 NTAASEVTYTGHKDFVLSVATT-QNDEFILSGSKDRGVLFW------------DTPSGNP 691

Query: 365 ELMMMHAGHRSPV------NEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASP 413
            LM+   GHR+ V      N+    P+   + A+   D   + WK S +  NA P
Sbjct: 692 LLMLQ--GHRNSVISVAVANDHPLGPEY-GVFATGSGDCKARIWKYSKQTSNAEP 743

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 117/279 (41%), Gaps = 34/279 (12%)

Query: 146 ARYMPANSNIIATING-------KGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHI 198
            +Y P   N +A ++G        G + I D    + K   S     ++  + +A+N   
Sbjct: 14  VQYSPFFDNRLAVVSGSNFGLVGNGKLFILDID-PQGKIHESNSFLTQDCLFDVAWNELH 72

Query: 199 SGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258
             ++L    D ++ L+D + A+ P +I   H   V    W+    N F + S D T+++ 
Sbjct: 73  ENQVLVAQGDGSLRLFDTKLAQYPIAIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVKIW 132

Query: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQD 318
               R + +  L T  P  T++   HS N          I + + R+ +     ++ +++
Sbjct: 133 SP-TRKDSLLTL-TPQPLKTVNRVDHSMN----------IPMSNQRNHAD----ITRNKN 176

Query: 319 SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVN 378
            +   +FSPH   ++     +    I+DL Q  +  +Q +         + H+G  +   
Sbjct: 177 CIYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRN--------FLGHSGLEALTC 228

Query: 379 EFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAIS 417
           +  FN   P  +A+   DNVI+ W + M   N S P+I 
Sbjct: 229 D--FNKYRPHTIATGGVDNVIRIWDLRMTSKNNSSPSIC 265

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 51/124 (41%), Gaps = 9/124 (7%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHKENGYGLAFNPHISGE 201
           + +A++ P + N++   +G   I+IFD R       Q + L           FN +    
Sbjct: 178 IYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHT 237

Query: 202 LLSGSDDTTVALWDIEAAKKPKS--------ILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           + +G  D  + +WD+    K  S        ++  H+  V  V W    SN+F + S D 
Sbjct: 238 IATGGVDNVIRIWDLRMTSKNNSSPSICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDM 297

Query: 254 TLQV 257
           T  V
Sbjct: 298 TCCV 301

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 88/219 (40%), Gaps = 31/219 (14%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHI 198
           H +EV    +   N N   + +  GT+ I+  T ++S   ++       N    + N  +
Sbjct: 103 HQKEVFSCNWNLLNKNTFVSSSWDGTVKIWSPTRKDSLLTLTPQPLKTVNRVDHSMNIPM 162

Query: 199 SGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258
           S +                   +  + +T + + +   ++   + N+    S +  + + 
Sbjct: 163 SNQ-------------------RNHADITRNKNCIYQAQFSPHDPNLVMCCSGNSYITIF 203

Query: 259 DKRVRLEPV--KKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMR----DMSSPL 310
           D R    P   +     S    L+  F+K+  + +A  GVD+ I ++D+R    + SSP 
Sbjct: 204 DLRQPPSPTNQRNFLGHSGLEALTCDFNKYRPHTIATGGVDNVIRIWDLRMTSKNNSSPS 263

Query: 311 ----HVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
                V+ GH+ +V  V +SPH   I  S+  D    +W
Sbjct: 264 ICVNEVVGGHELAVRKVCWSPHHSNIFLSTSYDMTCCVW 302

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 112/273 (41%), Gaps = 34/273 (12%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +A+ +  GTI I+D     ++    TL+ H  +   + +     G L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDSV---NRVCQYTLSGHTNSVSCVKWGGQ--GLLYSGSHDR 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKW---HEFESNVFGTVSEDKTLQVHDKRVRLEP 266
           TV +WD+ +  +  +IL SH   VN +     +      F    +        ++  LE 
Sbjct: 300 TVRVWDMNSQGRCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKKPATSEEAQKKALEN 359

Query: 267 VKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFS 326
            +K+           +  S  ++  A  D  ++L++    + P+  M+GHQ  V  V FS
Sbjct: 360 YEKI--------CKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFS 411

Query: 327 PHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ 385
           P  DG  I S+  D    +W            D  DG  + +    GH + V + +++  
Sbjct: 412 P--DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSD 455

Query: 386 IPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
              LL S  +D  ++ W V  + ++   P   D
Sbjct: 456 CR-LLVSCSKDTTLKVWDVRTRKLSVDLPGHQD 487

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P   L  H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMHTLKGHFNWVLCVSWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +  V  T S D T+++ + +        L    K  T   +  +   K  S+  LA++
Sbjct: 196 P-DGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLASS 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D  +     + +SGH +SV+ V++     G++ S   DR   +WD+   G
Sbjct: 255 SKDGTIKIWDSVNRVCQ-YTLSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNSQG 310

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+   + KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 374 MVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 432

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LL +   D+ + ++D+R  +  L V + GHQD 
Sbjct: 433 DGKFISTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVR--TRKLSVDLPGHQDE 488

Query: 320 VTTVEFSPHTDG-IICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   +W
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMVRLW 513

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 44/103 (42%), Gaps = 15/103 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 126 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 173

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           D   P  M    GH + V   S++P    ++A+   DN I+ W
Sbjct: 174 DTQTP--MHTLKGHFNWVLCVSWSPDGE-VIATGSMDNTIRLW 213

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD+   K P S L+   D +  VK+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 201 IHLWDVNRLK-PVSNLSWGADNITSVKFNQSETDILASTGSDNSIVLYDLRTN-SPTQKI 258

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++         A  D   Y YDMR++S  L+V   H  +V  V+FSP  D
Sbjct: 259 VQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGD 318

Query: 331 GIICSS 336
            I+  S
Sbjct: 319 EIVTGS 324

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 89/199 (44%), Gaps = 30/199 (15%)

Query: 175 SKAQVSTLAF-HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI- 232
           +K  V  L + H++  Y +A N     +L +GS D  +  W++   ++  S    +  I 
Sbjct: 55  AKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLIT 114

Query: 233 ---VNDVKWHEFE-----SNVFGTVSEDKTLQV--------------HDKRVRLEP--VK 268
              V   ++H+ +      N   + S+DKT+++               +  V  E   V+
Sbjct: 115 GLCVTQPRFHDKKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVR 174

Query: 269 KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH 328
                S F  +    H  N   A G  ++I+L+D+  +  P+  +S   D++T+V+F+  
Sbjct: 175 TFDGESAFQGID--SHRENSTFATG-GAKIHLWDVNRLK-PVSNLSWGADNITSVKFNQS 230

Query: 329 TDGIICSSGSDRRAIIWDL 347
              I+ S+GSD   +++DL
Sbjct: 231 ETDILASTGSDNSIVLYDL 249

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 72/144 (50%), Gaps = 4/144 (2%)

Query: 213 LWDIE--AAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           +W++   ++K  + +L  H   + D+ +H  +  +  T S D      D R   +P  + 
Sbjct: 95  VWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRT 154

Query: 271 PT-ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
               S    + ++  + N+LA +  +  +Y++D+R  +SPL V+ GH  SV +++F+P  
Sbjct: 155 SNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFN 213

Query: 330 DGIICSSGSDRRAIIWDLTQIGAE 353
           +  I SSG+D     WD  ++  E
Sbjct: 214 ETEIMSSGNDGTVKFWDYNKVEDE 237

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 72/180 (40%), Gaps = 4/180 (2%)

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           +I+T N K  +    R+   SKA    L  H      + F+P     L + S DT    W
Sbjct: 85  VISTSNQKAIVWNLSRS--SSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAW 142

Query: 215 DIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTAS 274
           D+ + KKP    ++       VKW+   SNV  T S    + V D R    P+  L   S
Sbjct: 143 DMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLAT-SHSNIVYVWDVRKGTSPLSVLEGHS 201

Query: 275 -PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
              N++ F+  +   + ++G D  +  +D   +   L +    +  V    + P  DG  
Sbjct: 202 GSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDELQMTITTEFPVWRGRYLPFGDGYC 261

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 66/131 (50%), Gaps = 19/131 (14%)

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRD-MSSP--LHVMSGHQDSVTTVEFSPH-TDG 331
           FN +S +   R+++ A+     +Y+ D+ D  S P  LH ++  +  V  V++ PH    
Sbjct: 27  FNAVSINPSGRDVVLAS--RKGLYVVDLDDPFSEPRWLHHLTSWE--VADVQWCPHPAKH 82

Query: 332 IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391
               S S+++AI+W+L++  ++  +           ++H GH   + + +F+P  P +LA
Sbjct: 83  HWVISTSNQKAIVWNLSRSSSKAVE----------HVLH-GHFRAITDINFHPLQPEILA 131

Query: 392 STEEDNVIQAW 402
           ++  D    AW
Sbjct: 132 TSSIDTYALAW 142

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 56/139 (40%), Gaps = 15/139 (10%)

Query: 197 HISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQ 256
           H +  +L+ S    V +WD+     P S+L  H   VN + ++ F      +   D T++
Sbjct: 168 HKNSNVLATSHSNIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVK 227

Query: 257 VHD-KRVRLEPVKKLPTASPF---NTLSFSKHSRNLLAAAGVDSQIYL----YDMRDMSS 308
             D  +V  E    + T  P      L F      ++   G ++ +YL    +D  +  S
Sbjct: 228 FWDYNKVEDELQMTITTEFPVWRGRYLPFGD-GYCIMPMIGGNNSVYLANSFHDSGNSES 286

Query: 309 ------PLHVMSGHQDSVT 321
                 P +V  GH D VT
Sbjct: 287 RTTKLQPTYVFKGHTDRVT 305

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 47/115 (40%), Gaps = 14/115 (12%)

Query: 288 LLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           +LA + +D+    +DMR    P    S  +     V+++     ++ +S S+    +WD+
Sbjct: 129 ILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSNI-VYVWDV 187

Query: 348 TQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
            +            G   L ++  GH   VN   FNP     + S+  D  ++ W
Sbjct: 188 RK------------GTSPLSVLE-GHSGSVNSIDFNPFNETEIMSSGNDGTVKFW 229

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 145 RARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLS 204
           + ++   NSN++AT +    + ++D  + +  + +S L  H  +   + FNP    E++S
Sbjct: 163 QVKWNHKNSNVLAT-SHSNIVYVWD--VRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMS 219

Query: 205 GSDDTTVALWD 215
             +D TV  WD
Sbjct: 220 SGNDGTVKFWD 230

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 105/270 (38%), Gaps = 28/270 (10%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P     +A+ +  GTI I+D T    +  + TL+ H  +   + +       L S S D 
Sbjct: 243 PGEKPRLASASKDGTIKIWDTT---RRVCIYTLSGHTSSVSCIKWGGR--NVLYSASHDR 297

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           TV  WD+ A  K  +IL SH   VN +      +   G      T     +  +   ++ 
Sbjct: 298 TVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRN 357

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
               +  N          L+     D  +YL++    S P+  M+GHQ  V  V FSP  
Sbjct: 358 YEKVAKKNGTM-----EELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP-- 410

Query: 330 DG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
           DG  I S+  D    +W            D  DG  + +    GH + V + +++     
Sbjct: 411 DGRYIVSASFDNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR- 455

Query: 389 LLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           LL S  +D  ++ W V  + +    P  +D
Sbjct: 456 LLVSCSKDTTLKVWDVKTRKLTVDLPGHND 485

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 77/179 (43%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P   L  H + V  V W 
Sbjct: 135 SAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPLCTLKGHSNWVLCVAW- 192

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +  V  T S D T+++ D          L    K  T+  +  +   K   +  LA+A
Sbjct: 193 SADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASA 252

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       ++ +SGH  SV+ +++      ++ S+  DR    WD+   G
Sbjct: 253 SKDGTIKIWDTTRRVC-IYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAAGG 308

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 76/147 (51%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++GSDD T+ LW+     KP   +T H  +VN V +   +     + S D ++++ D R
Sbjct: 372 MVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 430

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LL +   D+ + ++D++  +  L V + GH D 
Sbjct: 431 DGKFIATFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVK--TRKLTVDLPGHNDE 486

Query: 320 VTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   +W
Sbjct: 487 VYTVDWS--VDGKRVCSGGKDKMVRLW 511

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 12/48 (25%), Positives = 24/48 (50%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           ++ +R ++     ++GH  ++    F+PHT   + +   D  A IWD 
Sbjct: 124 VFKVRPVTRSSSAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDC 171

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 112/276 (40%), Gaps = 40/276 (14%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P +   +AT +  GTI I+D T    +  + TL  H  +   + +       L SGS D 
Sbjct: 245 PGDKPRLATASKDGTIKIWDTT---RRVCLLTLCGHTSSVSCVKWGG--KNVLYSGSHDK 299

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           T+  WD+    K  +IL SH   VN +           ++S D  L++     + E    
Sbjct: 300 TIRCWDMNLNGKCINILKSHAHWVNHL-----------SLSTDYALRLGAFDHKGETPAS 348

Query: 270 LPTASPFNTLSFSKHSRN------LLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
              A      ++ K ++       L+  A  D  +YL++    + P+  M+GHQ  V  V
Sbjct: 349 PEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHV 408

Query: 324 EFSPHTDG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSF 382
            FSP  DG  I S+  D    +W            D  DG  + +    GH + V + ++
Sbjct: 409 AFSP--DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAW 452

Query: 383 NPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
           +     LL S  +D  ++ W V  + ++   P   D
Sbjct: 453 SSDCR-LLVSCSKDTTLKVWDVKTRKLSVDLPGHQD 487

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 78/147 (53%), Gaps = 10/147 (6%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +++ SDD T+ LW+   + KP + +T H  +VN V +   +     + S D ++++ D R
Sbjct: 374 MVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLWDGR 432

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV-MSGHQDS 319
             +     +   AS +  +++S   R LL +   D+ + ++D++  +  L V + GHQD 
Sbjct: 433 DGKFLSTFRGHVASVYQ-VAWSSDCR-LLVSCSKDTTLKVWDVK--TRKLSVDLPGHQDE 488

Query: 320 VTTVEFSPHTDGI-ICSSGSDRRAIIW 345
           V TV++S   DG  +CS G D+   IW
Sbjct: 489 VYTVDWS--VDGKRVCSGGKDKMVRIW 513

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF P+ S  +++G+ D T  +WD +   +    L  H + V    W 
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQTR-MCTLQGHHNWVLCCSWS 195

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSFSK-HSRNLLAAA 292
             +  +  T S D T+++ +          L    K  T+  +  +   K   +  LA A
Sbjct: 196 P-DGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATA 254

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       L  + GH  SV+ V++      ++ S   D+    WD+   G
Sbjct: 255 SKDGTIKIWDTTRRVC-LLTLCGHTSSVSCVKWGGKN--VLYSGSHDKTIRCWDMNLNG 310

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 46/107 (42%), Gaps = 17/107 (15%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQDD 358
           ++ ++ ++     ++GH  ++    F+P+T   + +   D  A IWD  TQ         
Sbjct: 126 IFKVKPVTRSSSAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCDTQT-------- 177

Query: 359 ADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
                   M    GH + V   S++P    L+A+   DN I+ W+ S
Sbjct: 178 -------RMCTLQGHHNWVLCCSWSPDGE-LIATGSMDNTIRLWESS 216

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/289 (24%), Positives = 125/289 (43%), Gaps = 49/289 (16%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE-L 202
           IR+     +   +AT      I I+D T   ++  V TL  H+++ Y L + P  SG+ L
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLT---TRRIVMTLQGHEQDIYSLDYFP--SGDKL 505

Query: 203 LSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
           +SGS D TV +WD+ A +   S+  S +D V  V     +  +    S D+T+++ D   
Sbjct: 506 VSGSGDRTVRIWDLRAGQ--CSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSET 563

Query: 263 -----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMR----------- 304
                RL+   +L T    +  S  F++    +++ + +D  + L+++R           
Sbjct: 564 GFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS-LDRSVKLWNLRSANGGSTEGKA 622

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAP 364
           + ++     +GH+D V +V  +   D  I S   DR  + W            D   G P
Sbjct: 623 NTAASEVTYTGHKDFVLSVA-TTQNDEFILSGSKDRGVLFW------------DTPSGNP 669

Query: 365 ELMMMHAGHRSPV------NEFSFNPQIPWLLASTEEDNVIQAWKVSMK 407
            LM+   GHR+ V      N+    P+   + A+   D   + WK + K
Sbjct: 670 LLMLQ--GHRNSVISVAVANDHPLGPEY-GVFATGSGDCKARIWKYTKK 715

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 72/142 (50%), Gaps = 10/142 (7%)

Query: 213 LWDI--EAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           LW++   ++   + +L  H   + D+ +H     +  T S D  +   D R    P +  
Sbjct: 95  LWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMR---SPRRAY 151

Query: 271 PTASPFNT----LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFS 326
            +AS ++     + ++  + N++A+A   + +Y++D+R   +PLHV+ GH +SV +++FS
Sbjct: 152 YSASVWSAGASQVKWNYKNSNVMASAH-SNDVYIWDLRKGCTPLHVLQGHVNSVNSIDFS 210

Query: 327 PHTDGIICSSGSDRRAIIWDLT 348
              +  I SS +D     WD +
Sbjct: 211 KFDETEIMSSSNDGTVKFWDYS 232

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 69/133 (51%), Gaps = 23/133 (17%)

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRD-MSSP--LHVMSGHQDSVTTVEFSPHTDG- 331
           FN +S S   R+++ A+     +Y+ D+ D  S+P  LH ++  +  V  V++SPH    
Sbjct: 27  FNAVSISPSGRDVVLAS--RQGLYVIDLDDPFSAPRWLHHITSWE--VADVQWSPHPSKP 82

Query: 332 --IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWL 389
             +I  S S+++A++W+L++        ++ D    ++    GH   + + +F+P  P +
Sbjct: 83  SWVI--STSNQKALLWNLSR--------NSSDAIEHVLH---GHSRAITDINFHPTHPEI 129

Query: 390 LASTEEDNVIQAW 402
           LA+   D  + AW
Sbjct: 130 LATCSIDAYVHAW 142

>CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q05583 Saccharomyces cerevisiae YDR267c
          Length = 337

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 112/236 (47%), Gaps = 27/236 (11%)

Query: 184 FHKENGYGLAFNPHISGELLSGSDDTTVALW-----DIEAAKKPK----SILTSHDDIVN 234
            HK+    +A+ PH S  L +GS D+T+++W     D+E   K +    +I+  H++ V 
Sbjct: 57  VHKKAVRSVAWRPH-SDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVK 115

Query: 235 DVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF-----NTLSFSKHSRNLL 289
            + W + +  +  T S DK++ + +     E  + +           + +  +KH  NLL
Sbjct: 116 GISWSQ-DGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKH--NLL 172

Query: 290 AAAGVDSQIYLY-DMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347
           A++  D  + ++ D  D      V++GH+ ++   +FS   D I   SGSD   + +W  
Sbjct: 173 ASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW-- 230

Query: 348 TQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
             IG +  +DD  +   E  + +A HRS +   +++P     +AS   D V+  +K
Sbjct: 231 KYIGDD--EDDQQEWVCESTLPNA-HRSQIYGVAWSPSGR--IASVGADGVLAVYK 281

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 18/182 (9%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF P+ S  +++G+ D T  +WD +  + PK+ LT H + V  V W 
Sbjct: 137 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCD-TQTPKATLTGHTNWVLCVSWC 195

Query: 240 EFESNVFGTVSEDKTLQVHDK----------RVRLEPVKKLPTASPFNTLSFSKHSRNLL 289
                V  T S D T+++ +           R  L+ +  L    P + +   +  R  L
Sbjct: 196 P-NGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSL-AWEPIHLVKAGEQPR--L 251

Query: 290 AAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349
           A+A  D  I ++D       L+ +SGH +SV+ +++     GI+ S   D+    WD+  
Sbjct: 252 ASASKDGTIKIWDTSRRVC-LYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWDMNS 308

Query: 350 IG 351
            G
Sbjct: 309 EG 310

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 112/275 (40%), Gaps = 40/275 (14%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A+ +  GTI I+D +    +  + TL+ H  +   + +     G L SGS D TV  WD
Sbjct: 251 LASASKDGTIKIWDTS---RRVCLYTLSGHTNSVSCIKWGGQ--GILYSGSHDKTVRAWD 305

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV----HDKRVRLEPVKKLP 271
           + +  +  ++L SH   VN +           ++S D  L+V    H       P     
Sbjct: 306 MNSEGRCINVLKSHAHWVNHL-----------SLSTDYALRVGPFDHTGVEPTSPEDARD 354

Query: 272 TASPFNTLSFSKHSR--NLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
            A         K+ R   L+  A  D  ++L++    + PL  M+GHQ  V  V FSP  
Sbjct: 355 KALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP-- 412

Query: 330 DG-IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
           DG  I S+  D    +W            D  DG  + +    GH + V + +++     
Sbjct: 413 DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSADCR- 457

Query: 389 LLASTEEDNVIQAWKVSMKLVNASPPAISDPSLLV 423
           LL S  +D  ++ W V  + ++   P   D    V
Sbjct: 458 LLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVFTV 492

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/154 (28%), Positives = 79/154 (51%), Gaps = 10/154 (6%)

Query: 195 NPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKT 254
           N  +   +++ SDD T+ LW+   + KP   +T H  +VN V +   +     + S D +
Sbjct: 367 NGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP-DGRYIVSASFDNS 425

Query: 255 LQVHDKR-VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV- 312
           +++ D R  +     +   AS +  +++S   R LL +   D+ + ++D+R  +  L V 
Sbjct: 426 IKLWDGRDGKFISTFRGHVASVYQ-VAWSADCR-LLVSCSKDTTLKVWDVR--TRKLSVD 481

Query: 313 MSGHQDSVTTVEFSPHTDG-IICSSGSDRRAIIW 345
           + GH+D V TV++S   DG  +CS G D+   IW
Sbjct: 482 LPGHKDEVFTVDWS--VDGKRVCSGGKDKMVRIW 513

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 105/262 (40%), Gaps = 34/262 (12%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           N +    G G++ +FD TL+  K  +     HK+      +N    G  +S S D  V +
Sbjct: 75  NQVLVAQGDGSLRLFDTTLQ--KYPIGIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKM 132

Query: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273
           W   +  + +S+LT                 +    SE  +   H++  ++ P      +
Sbjct: 133 W---SPLREQSLLT-----------------LLPKSSEQSSKINHNQIAKIPPHVNNNQS 172

Query: 274 SPF-------NTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMS--GHQDSVT-TV 323
           +P            FS H  NL+A    +S I L+D R+ ++  +  S   H    T T+
Sbjct: 173 TPILQNKDCVYQAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAHSGLETLTL 232

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMM--MHAGHRSPVNEFS 381
           +F+ +   ++ SSG+D    IWD+  I    S +     +  + M  +   H   V    
Sbjct: 233 DFNKYRPTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAHDLAVRRVV 292

Query: 382 FNPQIPWLLASTEEDNVIQAWK 403
           ++P    LL ST  D   + WK
Sbjct: 293 WSPHQSNLLLSTSYDMTSKVWK 314

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 20/148 (13%)

Query: 126 NDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFH 185
           N+ S+  + NK    + V +A++ P ++N+IA  +G   I++FD   + ++   ++   H
Sbjct: 169 NNQSTPILQNK----DCVYQAQFSPHDNNLIACCSGNSYITLFDTREQNNRFNNNSFIAH 224

Query: 186 KE-NGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKS---------------ILTSH 229
                  L FN +    L S   D ++ +WD+   +   S               I  +H
Sbjct: 225 SGLETLTLDFNKYRPTVLASSGADNSIKIWDMRMIRNNNSNNTVMPTSNPICMNEIRKAH 284

Query: 230 DDIVNDVKWHEFESNVFGTVSEDKTLQV 257
           D  V  V W   +SN+  + S D T +V
Sbjct: 285 DLAVRRVVWSPHQSNLLLSTSYDMTSKV 312

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/273 (20%), Positives = 111/273 (40%), Gaps = 35/273 (12%)

Query: 161 GKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAK 220
           G G + I D T + +  + ++    K+  + +A+N     ++L+   D ++ L+DI   +
Sbjct: 36  GNGRLFIMDLTAQGTMVESNSF-LTKDGLFDVAWNELHENQVLAAQGDGSLRLFDITLQQ 94

Query: 221 KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV----------------HDKRVRL 264
            P ++   H   V    W+    + F + S D T++V                 ++ V +
Sbjct: 95  YPIALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKVWTPARPQSMLTLLPAPANRSVMV 154

Query: 265 EP-VKKLPTAS------------PFNTLSFSKHSRNLLAAAGVDSQIYLYDMRD--MSSP 309
           EP  + LP ++                  FS H  NL+ +   +S + L+D+R    S+ 
Sbjct: 155 EPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQ 214

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
              ++       + +F+ +   +I + G D+   +WDL  +    +       AP  +  
Sbjct: 215 QRFIAHSGLEALSCDFNKYRPHVIATGGVDKMVKVWDLRMVRQTLTTSRT---APVSINE 271

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
             GH   V +  ++P    +L ST  D   +AW
Sbjct: 272 MQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAW 304

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/302 (20%), Positives = 117/302 (38%), Gaps = 63/302 (20%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           N +    G G++ +FD TL++    ++    H+   +   +N       +S S D TV +
Sbjct: 74  NQVLAAQGDGSLRLFDITLQQYP--IALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKV 131

Query: 214 WDIEAAKKPKSILT-------------------------------SHDDIVNDVKWHEFE 242
           W      +P+S+LT                                + D +   ++   +
Sbjct: 132 W---TPARPQSMLTLLPAPANRSVMVEPGARGLPLSNQQQHKDAADNKDCIYQAQFSPHD 188

Query: 243 SNVFGTVSEDKTLQVHDKRVRLEPV----KKLPTASPFNTLS--FSKHSRNLLAAAGVDS 296
            N+  + S +  + + D R   +P     ++    S    LS  F+K+  +++A  GVD 
Sbjct: 189 PNLVMSCSGNSYVSLFDLR---QPAASNQQRFIAHSGLEALSCDFNKYRPHVIATGGVDK 245

Query: 297 QIYLYDMR--------DMSSPLHV--MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW- 345
            + ++D+R          ++P+ +  M GH  +V  V +SPH   I+ S+  D     W 
Sbjct: 246 MVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYDMTCRAWH 305

Query: 346 DLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQI-----PWLLASTEEDNVIQ 400
           DL      Q     ++  P+    +    S  +EF F         P  +A+T  D  + 
Sbjct: 306 DLADGPGGQHSGRTNNSDPQRGCSYV--FSKHSEFVFGADWSLWGQPGYVATTGWDGQVC 363

Query: 401 AW 402
           AW
Sbjct: 364 AW 365

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 54/128 (42%), Gaps = 11/128 (8%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202
           + +A++ P + N++ + +G   +S+FD     +  Q   +A          FN +    +
Sbjct: 179 IYQAQFSPHDPNLVMSCSGNSYVSLFDLRQPAASNQQRFIAHSGLEALSCDFNKYRPHVI 238

Query: 203 LSGSDDTTVALWDIEAAKK--------PKSI--LTSHDDIVNDVKWHEFESNVFGTVSED 252
            +G  D  V +WD+   ++        P SI  +  H   V  V W    SN+  + S D
Sbjct: 239 ATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEMQGHSLAVRKVVWSPHHSNILLSTSYD 298

Query: 253 KTLQV-HD 259
            T +  HD
Sbjct: 299 MTCRAWHD 306

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 91/185 (49%), Gaps = 17/185 (9%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234
           S + V   +F  EN + L   P     LL+G  +  + L D    K  + I  S +  +N
Sbjct: 3   SYSLVDLNSFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRAS-ETAIN 60

Query: 235 DVKWHEFE---SNVFGTVSEDKTLQVHDKRVRLEPVKKL--PTASPFNTLSFSKHSRNLL 289
           D+K  + +    N+  + S D +++V D R   + V K+   T SPF +L  S+H   LL
Sbjct: 61  DMKIIDSDFVAGNLISSASID-SVKVFDIRSN-DCVAKINNETNSPFLSLD-SRHG--LL 115

Query: 290 AAA----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAII 344
           A      G+D+ I++YD+R   +PL  ++  H D VT ++F P    ++ S  +D    I
Sbjct: 116 ACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175

Query: 345 WDLTQ 349
           +DL Q
Sbjct: 176 YDLKQ 180

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 98/201 (48%), Gaps = 21/201 (10%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+DTTV +WD+ A+ K K  L  H   V DV   +    +F + SEDK ++  D    
Sbjct: 133 TGSNDTTVKIWDL-ASGKLKLTLAGHVMTVRDVAISQRHPYLF-SASEDKMVKCWDLEKN 190

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                     S  +T+     + +L+A+AG D  + L+D+R  ++ + ++ GH+  +T V
Sbjct: 191 QIIRDYHGHLSGVHTVDIHP-TLDLIASAGRDGVVKLWDIRSRTAVMTLI-GHKSPITKV 248

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
              P  +  + SS +D    +WD+T             G    ++ H  H+  V +FS +
Sbjct: 249 HCLP-VNPQVVSSSTDATVRLWDVTA------------GKSYKILTH--HKRSVRDFSLH 293

Query: 384 PQIPWLLASTEEDNVIQAWKV 404
           P    ++++  +D  I++WK+
Sbjct: 294 PSEFSMVSACTDD--IRSWKL 312

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 87/197 (44%), Gaps = 28/197 (14%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKE---NGYGLAFNPHISGELLSGSDDTT 210
           ++IA+    G + ++D     S+  V TL  HK      + L  NP    +++S S D T
Sbjct: 213 DLIASAGRDGVVKLWD---IRSRTAVMTLIGHKSPITKVHCLPVNP----QVVSSSTDAT 265

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED-KTLQVHDKRVRLEPVKK 269
           V LWD+ A K  K ILT H   V D   H  E ++    ++D ++ ++ +  +      +
Sbjct: 266 VRLWDVTAGKSYK-ILTHHKRSVRDFSLHPSEFSMVSACTDDIRSWKLPEGALLTNFASE 324

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP-- 327
             +    NTLS ++   ++L A G D  +  YD +         SGH+      +  P  
Sbjct: 325 --STGIINTLSVNQD--DVLFAGGDDGMLSFYDYK---------SGHKYQTMATQEVPGS 371

Query: 328 -HTDGIICSSGSDRRAI 343
             ++  I +S  DR  +
Sbjct: 372 LESERAILTSAFDRTGL 388

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           + V++GH   V  ++  P  +    +  +D    IWDL               + +L + 
Sbjct: 108 IRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDL--------------ASGKLKLT 153

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
            AGH   V + + + + P+L  S  ED +++ W
Sbjct: 154 LAGHVMTVRDVAISQRHPYLF-SASEDKMVKCW 185

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 120/316 (37%), Gaps = 73/316 (23%)

Query: 152 NSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTV 211
           N N      G G++ +FD TL+  K  V+    H++      ++       +S   D  V
Sbjct: 72  NENQCLVAQGDGSLRLFDTTLD--KYPVAVYQEHRDEVASCNWSLIGRNTFVSSGWDGLV 129

Query: 212 ALWDIEAAKKPKSILT---------------------SHDDIVNDVKWHEFESNVFGTVS 250
            +W +    +P S++T                     +  D V   K+   + ++    S
Sbjct: 130 KVWSV---GRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCS 186

Query: 251 EDKTLQVHDKRVRL---EPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMRD 305
            D T+ + D R       P  +    S   TLS  F+K+  N++A  GVD++I ++D+R 
Sbjct: 187 GDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRM 246

Query: 306 M-SSPL--------------------HVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAII 344
           + + PL                     ++ GH+ +V  V +SPH+   + S+  D    I
Sbjct: 247 LRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYDMTCCI 306

Query: 345 W-------DLTQ-----IGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ-----IP 387
           W       D T+      G    + +A D    L+     H     EF F+        P
Sbjct: 307 WQDMGYATDRTRGNNSGYGVTTGRTNASDLRNGLVSRFTAH----TEFVFDGDWSLWGAP 362

Query: 388 WLLASTEEDNVIQAWK 403
             +A+T  D  +  WK
Sbjct: 363 GFVATTGWDGNVFVWK 378

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 94/245 (38%), Gaps = 31/245 (12%)

Query: 190 YGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTV 249
           + LA++     + L    D ++ L+D    K P ++   H D V    W     N F + 
Sbjct: 64  FDLAWSELNENQCLVAQGDGSLRLFDTTLDKYPVAVYQEHRDEVASCNWSLIGRNTFVSS 123

Query: 250 SEDKTLQVH-----DKRVRLEPVKKLPTA---SPFNT-----------LSFSKHSRNLLA 290
             D  ++V      +  + L+P  +  TA    P  T             FS H  +L+ 
Sbjct: 124 GWDGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMV 183

Query: 291 AAGVDSQIYLYDMRDM---SSPLHVMSGHQDSVT-TVEFSPHTDGIICSSGSDRRAIIWD 346
               DS + L+D+R       P H    H  S T +V+F+ +   +I + G D +  IWD
Sbjct: 184 CCSGDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWD 243

Query: 347 LTQ-----IGAEQSQDDADDGAPELMMMH---AGHRSPVNEFSFNPQIPWLLASTEEDNV 398
           L       +       +   GA ++   +    GH   V + +++P     L ST  D  
Sbjct: 244 LRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYDMT 303

Query: 399 IQAWK 403
              W+
Sbjct: 304 CCIWQ 308

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 58/140 (41%), Gaps = 27/140 (19%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESK-AQVSTLAFHKENG---YGLAFNPHI 198
           V +A++ P + +++   +G  T+S+FD  L  S+  Q  T  F   +G     + FN + 
Sbjct: 169 VYQAKFSPHDDSLMVCCSGDSTVSLFD--LRASQPGQGPTHQFMAHSGSETLSVDFNKYR 226

Query: 199 SGELLSGSDDTTVALWDI------------------EAAKKPKS---ILTSHDDIVNDVK 237
           +  + +G  D  + +WD+                    AK+ +    I+  H+  V  V 
Sbjct: 227 TNVIATGGVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQVQCTNEIVGGHELAVRKVN 286

Query: 238 WHEFESNVFGTVSEDKTLQV 257
           W    SN   + S D T  +
Sbjct: 287 WSPHSSNYLLSTSYDMTCCI 306

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 113/275 (41%), Gaps = 38/275 (13%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P     +AT +  GTI I+D T    +    TL+ H  +   + +       L SGS D 
Sbjct: 242 PGERPRLATSSKDGTIKIWDTT---RRVCTMTLSGHTSSVSCVKWGGQ--NFLYSGSHDK 296

Query: 210 TVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKK 269
           TV +WD++ + +  +IL +H   VN +           ++S D  L+V       E    
Sbjct: 297 TVRVWDMKNSGRCINILKNHAHWVNHL-----------SLSTDYALRVGPFDYTGEQPAT 345

Query: 270 LPTASPFNTLSFSKHSRN------LLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
              A      ++ K ++       L+  A  D  ++L+D    + P+  M+GHQ  V  V
Sbjct: 346 PEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHV 405

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
            FSP    I+ S+  D    +W            D+ DG  + +    GH + V + +++
Sbjct: 406 AFSPDGRHIV-SASFDNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWS 450

Query: 384 PQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISD 418
                LL S  +D  ++ W +  + ++   P   D
Sbjct: 451 SDCR-LLVSCSKDTTLKVWDIRTRKLSVDLPGHKD 484

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 77/179 (43%), Gaps = 12/179 (6%)

Query: 180 STLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
           S +A H       AF PH S  +++G+ D T  +WD +  + P + LT H + V  V W 
Sbjct: 134 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCD-TQTPMATLTGHHNWVLCVSWS 192

Query: 240 EFESNVFGTVSEDKTLQVHDKRV------RLEPVKKLPTASPFNTLSF-SKHSRNLLAAA 292
             +  +  T S D T+++ + +        L    K  T+  +  +   +   R  LA +
Sbjct: 193 P-DGELIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATS 251

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
             D  I ++D       +  +SGH  SV+ V++       + S   D+   +WD+   G
Sbjct: 252 SKDGTIKIWDTTRRVCTM-TLSGHTSSVSCVKWGGQN--FLYSGSHDKTVRVWDMKNSG 307

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 15/104 (14%)

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           ++ ++ ++     ++GH  ++    F+PHT   + +   D  A IW            D 
Sbjct: 123 VFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIW------------DC 170

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           D   P  M    GH + V   S++P    L+A+   DN ++ W+
Sbjct: 171 DTQTP--MATLTGHHNWVLCVSWSPDGE-LIATGSMDNTVRLWE 211

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD+   K P S L+   D +  +K+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 201 IHLWDVNRLK-PVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTN-SPTQKI 258

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++         A  D   Y YDMR++S  L+V   H  +V  V+FSP  D
Sbjct: 259 VQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGD 318

Query: 331 GIICSS 336
            I+  S
Sbjct: 319 EIVTGS 324

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 32/146 (21%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +LS SDD TV LW I          + +D + N       E  +  T   +   Q     
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTN-------EEGLIRTFDGESAFQ----- 183

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
                                 H  N   A G  ++I+L+D+  +  P+  +S   D++T
Sbjct: 184 ------------------GIDSHRENSTFATG-GAKIHLWDVNRLK-PVSDLSWGADNIT 223

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDL 347
           +++F+ +   I+ S+GSD   +++DL
Sbjct: 224 SLKFNQNETDILASTGSDNSIVLYDL 249

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/183 (28%), Positives = 86/183 (46%), Gaps = 13/183 (7%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234
           S + V + +F  EN + L   P     LL+G  +  + L D  + +  + I  S   I N
Sbjct: 3   SYSLVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-N 60

Query: 235 DVKW--HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA-SPFNTLSFSKHSRNLLAA 291
           D+K    +F +    + +    ++V D R      K    A SPF +L  S+H   LLA 
Sbjct: 61  DLKVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLD-SRHG--LLAC 117

Query: 292 A----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
                G+D+ +Y+YD+R   +PL  ++  H D VT ++F P    ++ S  +D    I+D
Sbjct: 118 GTELQGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYD 177

Query: 347 LTQ 349
           L Q
Sbjct: 178 LKQ 180

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 107/283 (37%), Gaps = 51/283 (18%)

Query: 161 GKGTISIFDRTLEESKAQVSTLAFHKENG-YGLAFNPHISGELLSGSDDTTVALWDIEAA 219
           G G + I D  +  +   V + +F  ++G + LA+N     + L    D ++ L+DI+  
Sbjct: 36  GNGKLIILD--IMPNGQLVESNSFLTQDGLFDLAWNESHENQCLVAQGDGSLRLFDIKLK 93

Query: 220 KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT- 278
             P +I   H   V    W+  +  +F + S D  +    K   L   + L T SP +T 
Sbjct: 94  DYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKV----KLWSLMRPQSLMTMSPNDTN 149

Query: 279 ------------------------------------LSFSKHSRNLLAAAGVDSQIYLYD 302
                                                +FS H  NL+  +  +S I LYD
Sbjct: 150 AASTLSRTSAVAPVRVPMSNQKEHQHADGNKECIYQATFSPHDPNLVLCSSGNSFISLYD 209

Query: 303 MR--DMSSPLHVMSGHQD-SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           +R  +   P H   GH      T +F+ +   II + G D+   +WDL       SQ   
Sbjct: 210 LRVPNNGLPQHQFLGHGGFEALTCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQ 269

Query: 360 DDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
                E+     GH   V + +++P    +L ST  D   + W
Sbjct: 270 PININEI----QGHELAVRKVTWSPHHSNMLLSTSYDMTCRVW 308

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 63/144 (43%), Gaps = 26/144 (18%)

Query: 278 TLSFSKHSRNLLAAAGVDSQIYLYDMRDMSS-------PLHV--MSGHQDSVTTVEFSPH 328
           T  F+K+  +++A  GVD  I ++D+R           P+++  + GH+ +V  V +SPH
Sbjct: 232 TCDFNKYRPHIIATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPH 291

Query: 329 TDGIICSSGSDRRAIIW-DLTQIG----AEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
              ++ S+  D    +W DL+  G     + +  D   G   + M H+       EF F 
Sbjct: 292 HSNMLLSTSYDMTCRVWTDLSDDGHGLTGKTNSIDPAHGCRFIFMEHS-------EFVFG 344

Query: 384 PQ-----IPWLLASTEEDNVIQAW 402
                   P  +AST  D  +  W
Sbjct: 345 ADWSLWGTPGFVASTGWDGQVCIW 368

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 16/130 (12%)

Query: 141 EEVIRARYMPANSNIIATINGKGTISIFD-RTLEESKAQVSTLAFHKENGYGLAFN---P 196
           E + +A + P + N++   +G   IS++D R       Q   L           FN   P
Sbjct: 181 ECIYQATFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRP 240

Query: 197 HISGELLSGSDDTTVALWDIEAAKK-------PKSI--LTSHDDIVNDVKWHEFESNVFG 247
           HI   + +G  D  + +WD+   +K       P +I  +  H+  V  V W    SN+  
Sbjct: 241 HI---IATGGVDKMIKVWDLRMCRKMLSQGHQPININEIQGHELAVRKVTWSPHHSNMLL 297

Query: 248 TVSEDKTLQV 257
           + S D T +V
Sbjct: 298 STSYDMTCRV 307

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD+   K P S L+   D +  V++++ E+++  +   D ++ ++D R    P +K+
Sbjct: 201 IHLWDVNRLK-PISNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTN-SPTQKI 258

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++         A  D   Y YDMR++S  L V   H  +V  V+FSP  D
Sbjct: 259 VQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDFSPTGD 318

Query: 331 GIICSS 336
            I+  S
Sbjct: 319 EIVTGS 324

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 59/146 (40%), Gaps = 32/146 (21%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +LS SDD TV LW I          + +D + N       E  +  T   +   Q     
Sbjct: 136 MLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTN-------EEGLVRTFDGESAFQ----- 183

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
                                 H  N   A G  ++I+L+D+  +  P+  +S   D++T
Sbjct: 184 ------------------GIDSHRENSTFATG-GAKIHLWDVNRLK-PISNLSWGADNIT 223

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDL 347
           +V F+ +   I+ S+GSD   +++DL
Sbjct: 224 SVRFNQNETDILASTGSDNSIVLYDL 249

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWDI   +KP S L+   D +  VK+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 197 IELWDINR-RKPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDLRTN-SPTQKI 254

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N++ ++         A  D   Y YDMR+MS  LHV   H  ++  V+ SP  +
Sbjct: 255 VQTMKTNSMCWNPMEPFNFVTANEDQNAYYYDMRNMSRALHVFKDHVSAIMDVDISPTGE 314

Query: 331 GIICSS 336
            I+  S
Sbjct: 315 EIVTGS 320

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 53/220 (24%), Positives = 90/220 (40%), Gaps = 49/220 (22%)

Query: 168 FDRTLEESKAQVST-------------LAF-HKENGYGLAFNPHISGELLSGSDDTTVAL 213
           F+R  E +KA  +T             L + H++  Y +A N ++   L S S D  V  
Sbjct: 35  FERAREYTKALTATKLERMFAKPFVGQLGYGHRDGCYVIAKNYNVLNRLASASADGVVKY 94

Query: 214 WDIEAAKK-----------------PKSI--------LTSHDDIVNDVKWHEFESNVFGT 248
           W+I   ++                 P+ I        L+  DD +  VK    +S  F  
Sbjct: 95  WNISTREELCSFKAHYGLVTGLCVSPQHIGNQSDSYMLSCGDDKM--VKMWSVDSGDFNN 152

Query: 249 VSED-KTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS 307
           V +D K L   D       +K       F  +   K + + +      +QI L+D+ +  
Sbjct: 153 VKDDTKVLHPSDGN---GLIKTFYGEHAFQGIDHHKENTSFVTGG---AQIELWDI-NRR 205

Query: 308 SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
            PL  +S   D++T V+F+ +   ++ SSGSD   +++DL
Sbjct: 206 KPLSNLSWGIDNITAVKFNQNEADLLLSSGSDNSVVLYDL 245

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 85/173 (49%), Gaps = 7/173 (4%)

Query: 183 AFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFE 242
           A H+    GL ++P     LLSG  D  V LWD+ +    +  L  H   V+ VK H   
Sbjct: 212 AAHEGKIGGLDWHPD-GNHLLSGGGDNLVKLWDMTSNSFEE--LRGHAGRVSRVKVHP-S 267

Query: 243 SNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
             +  + S D T  + D   ++E   +   +    T++F      LLA+AG+D+   ++D
Sbjct: 268 GRLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDG-ALLASAGLDAVCAIWD 326

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQS 355
           +R    P+  + GH  +++ V++SP+    + ++G+D    +WD+  +G E +
Sbjct: 327 LRS-GEPIMKLEGHAGAISGVDWSPNGY-QLATAGADGTVRVWDIRNVGTESA 377

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 22/189 (11%)

Query: 179 VSTLAF--HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILT--------S 228
           VST  F  H  +   + FN      L SG ++  + +WD+    +  S  T        S
Sbjct: 99  VSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPGQSMS 158

Query: 229 HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS-------- 280
             D VN + W++  ++VF +        + D + + E V  L   SP + +         
Sbjct: 159 SVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKE-VIHLSYTSPNSGIKQQLSVVEW 217

Query: 281 FSKHSRNLLAAAGVDS--QIYLYDMRDMSSPLHVMS-GHQDSVTTVEFSPHTDGIICSSG 337
             K+S  +  A G D+   I ++D+R+ ++PL  +S GHQ  + ++++    + ++ SSG
Sbjct: 218 HPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSG 277

Query: 338 SDRRAIIWD 346
            D   ++W+
Sbjct: 278 RDNTVLLWN 286

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 59/146 (40%), Gaps = 9/146 (6%)

Query: 265 EPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLY---DMRDMSSPLHVMSGHQDSVT 321
           +P+  L   S FN L +S H+   +A A  +  + LY   D  D        S H  SV 
Sbjct: 54  KPMASLQVDSKFNDLDWS-HNNKTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVK 112

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFS 381
           TV+F+   D ++ S G++    IWD+ +    +S        P   M        VN  +
Sbjct: 113 TVKFNSKQDNVLASGGNNGEIFIWDMNK--CTESPSSYTPLTPGQSMSSVDE---VNSLA 167

Query: 382 FNPQIPWLLASTEEDNVIQAWKVSMK 407
           +N  +  + AS    N    W +  K
Sbjct: 168 WNQSLAHVFASAGSSNFASIWDLKAK 193

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 95/228 (41%), Gaps = 36/228 (15%)

Query: 195 NPHISGELLSGSDDTTVALWDIEAAKK---PKSILTSHDDIVNDVKWHEFESNVFGTVSE 251
           N  I+G L    D+ T+ L+ I  A       +  ++H   V  VK++  + NV  +   
Sbjct: 74  NKTIAGAL----DNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGN 129

Query: 252 DKTLQVHDKR---------VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
           +  + + D             L P + + +    N+L++++   ++ A+AG  +   ++D
Sbjct: 130 NGEIFIWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWD 189

Query: 303 MRDMSSPLHVM-----SGHQDSVTTVEFSP-HTDGIICSSGSDR--RAIIWDLTQIGAEQ 354
           ++     +H+      SG +  ++ VE+ P ++  +  ++GSD     ++WDL       
Sbjct: 190 LKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTP- 248

Query: 355 SQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
                      L  +  GH+  +    +  Q   LL S+  DN +  W
Sbjct: 249 -----------LQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLW 285

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 124/272 (45%), Gaps = 39/272 (14%)

Query: 152 NSNIIATI-NGKGTISIFDRTLE--ESKAQVSTLAFHKENGYGLAFNPHISGELLSGSD- 207
           N NI   + NG   +  FD   +  +S   +S    HK +   L FN   S  L+SGSD 
Sbjct: 74  NINIAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDK 133

Query: 208 DTTVALWDIEAAKK----PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +  + +WD+    K    P   +T  ++I + + W++  S+VF   S    + + D + +
Sbjct: 134 NGEILIWDLNNLDKTPLTPGMPMTPTNEITS-LAWNKSLSHVFSCSSNTSNVSIFDLKAK 192

Query: 264 LEPVKKLPTASPFNTLS--FSK---HSRN--LLAAAGVDS------QIYLYDMRDMSSPL 310
            E V  L   +P N +   FS    H +N   +A A +++       I+++D+R+  +PL
Sbjct: 193 KE-VIHLNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPL 251

Query: 311 HVMS--GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMM 368
            ++S  GH + + ++++    + ++ SSG D   ++W            + ++G  E + 
Sbjct: 252 QILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLW------------NPENG--ESLT 297

Query: 369 MHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQ 400
            +   R+   +  F P  P + A+   D  I+
Sbjct: 298 KYPSRRNWCFKTKFAPAFPDVFATASFDGKIE 329

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +  P S L+   D +  VK+++ E+++F +   D ++ ++D R    P +K+
Sbjct: 195 IQLWDSNRST-PLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVLYDLRTN-SPTQKI 252

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N + ++            D   Y YDMR+MS  ++V   H  +V  V+FSP  D
Sbjct: 253 VQTMRTNAICWNPMEAFNFVIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFSPTGD 312

Query: 331 GIICSS 336
            I+  S
Sbjct: 313 EIVTGS 318

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 87/202 (43%), Gaps = 43/202 (21%)

Query: 152 NSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNP-HISGE-----LLSG 205
           N N +AT +  G I  ++ +   ++ +V +   H     GL   P H+S       +LS 
Sbjct: 79  NLNKLATGSADGVIKYWNMS---TRDEVCSFKAHYGLITGLCVTPEHLSKNKNDNFMLSC 135

Query: 206 SDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLE 265
           SDD TV LW + +           +D VN              + +D+ L          
Sbjct: 136 SDDKTVKLWSVNS-----------EDYVN--------------LKDDEQLNTTSG----- 165

Query: 266 PVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEF 325
            +K   +   F  +   + + N +      +QI L+D  + S+PL  +S   D++TTV+F
Sbjct: 166 LLKTFYSDIAFQGIDHHRSNSNFVTGG---AQIQLWDS-NRSTPLSNLSWGADNITTVKF 221

Query: 326 SPHTDGIICSSGSDRRAIIWDL 347
           + +   I  S+GSD   +++DL
Sbjct: 222 NQNETDIFASAGSDNSIVLYDL 243

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 101/216 (46%), Gaps = 23/216 (10%)

Query: 152 NSNIIATINGKGTISIFDRT-LEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTT 210
           N+ IIA     G++ ++    + ++ + ++  + H  +   + FN      L SG ++  
Sbjct: 73  NNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGE 132

Query: 211 VALWDIEAAKK---------PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           + +WD+    +         P   ++S D+ VN + W++  ++VF +        + D +
Sbjct: 133 IFIWDMNKCTESPANYTPLTPGQSMSSVDE-VNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 262 VRLEPVKKLPTASPFNTLS--------FSKHSRNLLAAAGVDS--QIYLYDMRDMSSPLH 311
            + E V  L   SP + +           K+S  +  A G D+   I ++D+R+ ++PL 
Sbjct: 192 AKKE-VIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQ 250

Query: 312 VMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
            ++ GHQ  + ++++    + ++ SSG D   ++W+
Sbjct: 251 TLNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 64/146 (43%), Gaps = 9/146 (6%)

Query: 265 EPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLY---DMRDMSSPLHVMSGHQDSVT 321
           +P+  L   S FN L +S H+  ++A A  +  + LY   ++ D  S +   S H  SV 
Sbjct: 54  KPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVK 112

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFS 381
           TV+F+   D ++ S G++    IWD+ +    +S  +     P   M        VN  +
Sbjct: 113 TVKFNAKQDNVLASGGNNGEIFIWDMNK--CTESPANYTPLTPGQSMSSVDE---VNSLA 167

Query: 382 FNPQIPWLLASTEEDNVIQAWKVSMK 407
           +N  +  + AS    N    W +  K
Sbjct: 168 WNQSLAHVFASAGSSNFASIWDLKAK 193

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/194 (19%), Positives = 82/194 (42%), Gaps = 29/194 (14%)

Query: 226 LTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD---------KRVRLEPVKKLPTASPF 276
            ++H   V  VK++  + NV  +   +  + + D             L P + + +    
Sbjct: 104 FSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPANYTPLTPGQSMSSVDEV 163

Query: 277 NTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVM-----SGHQDSVTTVEFSP-HTD 330
           N+L++++   ++ A+AG  +   ++D++     +H+      SG +  ++ VE+ P ++ 
Sbjct: 164 NSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLCYTSPNSGIKQQLSVVEWHPKNST 223

Query: 331 GIICSSGSDR--RAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPW 388
            +  ++GSD     ++WDL                  L  ++ GH+  +    +  Q   
Sbjct: 224 RVATATGSDNDPSILVWDLRNANTP------------LQTLNQGHQKGILSLDWCHQDEN 271

Query: 389 LLASTEEDNVIQAW 402
           LL S+  DN +  W
Sbjct: 272 LLLSSGRDNTVLLW 285

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/294 (20%), Positives = 116/294 (39%), Gaps = 40/294 (13%)

Query: 146 ARYMPANSNIIATINGK-----GTISIFDRTLEESKAQVSTLAFHKENG-YGLAFNPHIS 199
            +Y P   N +A   G      G   +F   ++     + T +F  ++G + +A+N    
Sbjct: 14  VQYSPFFDNKVAVATGSNFGLVGNGKLFIIDIDNQGRMLETKSFVTQDGLFDVAWNELHE 73

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
             +L    D ++ L+DI+    P +I   H+  V    W+     +F + S D T++V  
Sbjct: 74  NHVLVAQGDGSLRLFDIQLNDYPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWT 133

Query: 260 --KRVRLEPVKKLPTASPFNTLS--------------------------FSKHSRNLLAA 291
             ++  L  +   P  +  + LS                          FS H  N++ +
Sbjct: 134 PMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQSQFSPHDPNIVMS 193

Query: 292 AGVDSQIYLYDMRD--MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349
              +S + ++D+R    ++    M+ +     T +F+ +   II + G D    +WDL  
Sbjct: 194 CAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATGGVDNMVKVWDLRM 253

Query: 350 IGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           +     +  A+   P  +    GH   + + S++P    +L ST  D   + W+
Sbjct: 254 V----RKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202
           + ++++ P + NI+ +  G   +++FD     +  Q S +A +        FN + S  +
Sbjct: 178 IYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHII 237

Query: 203 LSGSDDTTVALWDIEAAKK-------PKSI--LTSHDDIVNDVKWHEFESNVFGTVSEDK 253
            +G  D  V +WD+   +K       P S+  +  HD  +  V W    SN+  + S D 
Sbjct: 238 ATGGVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDM 297

Query: 254 TLQV 257
           T +V
Sbjct: 298 TCRV 301

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 72/148 (48%), Gaps = 4/148 (2%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           G ++S S D  + LWD  +     +IL     ++  VK+     N+   +S+DK+ +V D
Sbjct: 218 GLIISASKDNLIKLWDPRSGNCVSTILKFKHTVL-KVKFQPTGGNMIAAISKDKSCRVFD 276

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM-RDMSSPLHVMS-GHQ 317
            R  ++ +  +     + TL ++  + ++      D  I  +D+ +D++ P HV+   H 
Sbjct: 277 IRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYAHD 336

Query: 318 DSVTTVEFSPHTDGIICSSGSDRRAIIW 345
             VT++ ++P  + I+ S+  DR    W
Sbjct: 337 KCVTSLSYNPMGN-ILASASKDRTVRFW 363

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 97/236 (41%), Gaps = 19/236 (8%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H E    +AF+ + S + +S SDD  + +W+    K  + +L+ H   V    WH  E  
Sbjct: 162 HTECIRDVAFSGNDS-KFVSCSDDNILKIWNFSNGKLER-VLSGHHWDVKSCDWHP-EMG 218

Query: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
           +  + S+D  +++ D R        L        + F     N++AA   D    ++D+R
Sbjct: 219 LIISASKDNLIKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIR 278

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAP 364
                L  +    D +T + ++P  + +      D     +DL Q          D   P
Sbjct: 279 HSMKELLCVRDEVDYMTLL-WNPINESMFTVGNYDGSIKHFDLLQ----------DLTKP 327

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420
             ++ +A H   V   S+NP +  +LAS  +D  ++ W  +  +    P A  DP+
Sbjct: 328 THVIPYA-HDKCVTSLSYNP-MGNILASASKDRTVRFWTRASPI---DPNAYDDPT 378

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 136 KFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGY-GLAF 194
           KF H   V++ ++ P   N+IA I+   +  +FD  +  S  ++  L    E  Y  L +
Sbjct: 245 KFKH--TVLKVKFQPTGGNMIAAISKDKSCRVFD--IRHSMKEL--LCVRDEVDYMTLLW 298

Query: 195 NPHISGELLSGSDDTTVALWD-IEAAKKPKSIL-TSHDDIVNDVKWHEFESNVFGTVSED 252
           NP        G+ D ++  +D ++   KP  ++  +HD  V  + ++    N+  + S+D
Sbjct: 299 NPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYAHDKCVTSLSYNPM-GNILASASKD 357

Query: 253 KTLQVHDKRVRLEP 266
           +T++   +   ++P
Sbjct: 358 RTVRFWTRASPIDP 371

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 99/214 (46%), Gaps = 23/214 (10%)

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSE 251
           +  +P  +    +GS+D+T+ +WD+ A  K K  L  H   V D+        +F + S+
Sbjct: 119 VCVDPVDNAWFATGSNDSTIRVWDL-ATGKLKVTLQGHIMTVRDICISARHPYMF-SASQ 176

Query: 252 DKTLQVHDKRVRLEPVKKL-PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPL 310
           DK ++  D   R   V+    T S  +++     S +L+ +AG DS + ++D+R  S  L
Sbjct: 177 DKLVKCWDLE-RNTVVRDFHGTLSGVHSVDLHP-SLDLIVSAGRDSVVRVWDIRSRSCVL 234

Query: 311 HVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMH 370
             ++GH+  +  V   P  D  I S  +D    +WDL              G P   + H
Sbjct: 235 -TLAGHRGPINKVRCLP-VDPQIVSCSTDATVKLWDLVA------------GKPMKTLTH 280

Query: 371 AGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
             H+  V + +FNP   +  AS   D+ I++WK+
Sbjct: 281 --HKRNVRDLAFNP-TEFSFASACTDD-IRSWKL 310

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 2/79 (2%)

Query: 174 ESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIV 233
            S++ V TLA H+     +   P +  +++S S D TV LWD+  A KP   LT H   V
Sbjct: 228 RSRSCVLTLAGHRGPINKVRCLP-VDPQIVSCSTDATVKLWDL-VAGKPMKTLTHHKRNV 285

Query: 234 NDVKWHEFESNVFGTVSED 252
            D+ ++  E +     ++D
Sbjct: 286 RDLAFNPTEFSFASACTDD 304

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +K   ++    D+I + VK+++ +SN+  +   D ++ ++D R    P +K+
Sbjct: 194 IQLWDTSRSKSTSNLSWGADNITS-VKFNQNDSNILASTGSDNSIVLYDLRTN-SPTQKI 251

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N+L ++            D   Y YDMR M+  L+V   H  +V  V+F+P  D
Sbjct: 252 VQQMRTNSLCWNPMEPFNFVTGNEDHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPTGD 311

Query: 331 GIICSS 336
            I+  S
Sbjct: 312 EIVTGS 317

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 110/263 (41%), Gaps = 48/263 (18%)

Query: 179 VSTLAF-HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVK 237
           V  L + H++  Y +A + H   ++ +GS D  V  W++ ++++  S   +H  IV  + 
Sbjct: 59  VGQLGYGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEELCS-FKAHYGIVTGL- 116

Query: 238 WHEFESNVFGTVSEDKTLQV-----HDKRVRLEPV-----------KKLPTASPFNTL-- 279
                S V    S++K LQ       DK V+L  V           + L T     T   
Sbjct: 117 ---CVSPVLA--SKNKNLQYMLSCGDDKTVKLWSVDTDDYADVKDDQNLNTRGLLKTFYG 171

Query: 280 --SFS--KHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICS 335
             SF    H R+  A     +QI L+D     S  ++  G  D++T+V+F+ +   I+ S
Sbjct: 172 DHSFQGIDHHRSNSAFVTGGAQIQLWDTSRSKSTSNLSWG-ADNITSVKFNQNDSNILAS 230

Query: 336 SGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEE 395
           +GSD   +++DL               +P   ++    +   N   +NP  P+   +  E
Sbjct: 231 TGSDNSIVLYDLRT------------NSPTQKIV---QQMRTNSLCWNPMEPFNFVTGNE 275

Query: 396 DNVIQAWKVSMKLVNASPPAISD 418
           D+   A+   M+ +N +     D
Sbjct: 276 DH--NAYYYDMRKMNRALNVFKD 296

>KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 429

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 19/180 (10%)

Query: 176 KAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVND 235
           K +++    HK     L F P     LLSG +D  + LWD    ++       H   + D
Sbjct: 125 KTKIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKD 184

Query: 236 VKWHEFESNVFGTVSEDKTLQVH-------DKRVRLEPVKKLPTASPFNTLSFSKHSRNL 288
           + + +   + F + S DK +++        DKR+R   V         N ++F    +N 
Sbjct: 185 LNFTD-NGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVP--------NCITFHPKDKNQ 235

Query: 289 LAAAGVDSQIYLYDMR--DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
           L     +S+I  YD+R  +    +     HQ S+  +++ P    +I SS  D+   IW+
Sbjct: 236 LVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLI-SSSEDKTVRIWE 294

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 105/222 (47%), Gaps = 29/222 (13%)

Query: 188 NGY--GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNV 245
           NG+   +A +P  +    +GS+DTT+ +WD+ A  K K  L+ H   V D+   +    +
Sbjct: 129 NGWVRTVAVDPIDNEWFATGSNDTTIKIWDL-ATGKLKLTLSGHIMTVKDICISKRHPYM 187

Query: 246 FGTVSEDKTLQVHD---KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
           F + SEDK ++  D    RV  +    L   S  +T+     + NL+A AG DS + L+D
Sbjct: 188 F-SASEDKLVKCWDLEKNRVIRDYHGHL---SGVHTVDIHP-TLNLIATAGRDSVVRLWD 242

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG 362
           +R    P+  M+GH+  +  V+  P  D  + S  +D    +WD+T              
Sbjct: 243 IR-TKLPVMTMAGHKSPINRVKCLP-VDPQVVSCSADATVRLWDIT-------------- 286

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
           A + + +   H+  V +   +P    + ++  +D  I++WK+
Sbjct: 287 AGKTLKVLTHHKRSVRDIGIHPGEFSISSACTDD--IRSWKL 326

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 42/100 (42%), Gaps = 15/100 (15%)

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           + V++GH   V TV   P  +    +  +D    IWDL                 +L + 
Sbjct: 122 MRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDL--------------ATGKLKLT 167

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLV 409
            +GH   V +   + + P++ +++ ED +++ W +    V
Sbjct: 168 LSGHIMTVKDICISKRHPYMFSAS-EDKLVKCWDLEKNRV 206

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 114/294 (38%), Gaps = 41/294 (13%)

Query: 146 ARYMPANSNIIATINGK-----GTISIFDRTLEESKAQVSTLAFHKENG-YGLAFNPHIS 199
            +Y P   N +A   G      G   +F   ++     V + +F  ++G + +A+N   +
Sbjct: 14  VQYSPFYDNKLAVATGSNFGLVGNGKLFILDIDPHGRMVESNSFLTQDGLFDVAWNEGHA 73

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV-- 257
            ++L+   D ++ L+DI   + P SI   H   V    W+      F + S D T+++  
Sbjct: 74  NQVLAAQGDGSLRLFDINLPQYPISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKIWS 133

Query: 258 ---HDKRVRLEPV------------KKLPTASPFN------------TLSFSKHSRNLLA 290
               +    L P+              +P ++  N               FS H  NL+ 
Sbjct: 134 PMRQESLTTLVPIPMERSPLVEAKAGGIPLSNQQNHSIISKNKDCIYQAQFSPHDPNLIM 193

Query: 291 AAGVDSQIYLYDMRD--MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT 348
               +S + L+D+R    ++  + MS       T +F+ +   I+ + G D+   IWDL 
Sbjct: 194 CCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATGGVDKLVKIWDLR 253

Query: 349 QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
            +    +         E+     GH   + + S++P    L+ ST  D   + W
Sbjct: 254 MVRKFSNPLQQPMSINEI----PGHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/262 (19%), Positives = 106/262 (40%), Gaps = 48/262 (18%)

Query: 128 HSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKE 187
           H     +N F   + +    +   ++N +    G G++ +FD  L +    +S    H++
Sbjct: 48  HGRMVESNSFLTQDGLFDVAWNEGHANQVLAAQGDGSLRLFDINLPQYP--ISIFQEHQK 105

Query: 188 NGYGLAFNPHISGELLSGSDDTTVALWD--------------------IEAA-------- 219
             +   +N       +S S D TV +W                     +EA         
Sbjct: 106 EVFSCNWNLVNKQTFVSSSWDGTVKIWSPMRQESLTTLVPIPMERSPLVEAKAGGIPLSN 165

Query: 220 KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV----KKLPTASP 275
           ++  SI++ + D +   ++   + N+    + +  + + D R   +P     +   +   
Sbjct: 166 QQNHSIISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLR---QPTNTNQQNFMSHGG 222

Query: 276 FNTLS--FSKHSRNLLAAAGVDSQIYLYDMR---DMSSPLHV------MSGHQDSVTTVE 324
             TL+  F+K+  +++A  GVD  + ++D+R     S+PL        + GH+ ++  V 
Sbjct: 223 LETLTCDFNKYRPHIVATGGVDKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVS 282

Query: 325 FSPHTDGIICSSGSDRRAIIWD 346
           +SPH   ++ S+  D    +WD
Sbjct: 283 WSPHHSNLVLSTSYDMTCRVWD 304

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 72/151 (47%), Gaps = 7/151 (4%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           G ++SGS D  + LWD    +   +IL     ++   K+   + N+   VS+DK+++++D
Sbjct: 218 GLIVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIK-TKFQPTQGNLLAVVSKDKSIKIYD 276

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQI----YLYDMRDMSSPLHVMS- 314
            R  +  ++ +     + +LS+   +  + +    +  I     L+D  + +   H +  
Sbjct: 277 MRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKHFDLLHDNSNSTPACHTIPY 336

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
            H+ SVT++ +SP    I+ S+  DR    W
Sbjct: 337 AHEKSVTSLAYSP-VGHILASAAKDRTIRFW 366

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 104/218 (47%), Gaps = 31/218 (14%)

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSE 251
           +A +P  +    +GS+D+T+ +WD  A+ K K  L+ H   V D+   +    +F + SE
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDF-ASGKLKLTLSGHVMGVRDLVVSKRHPYMF-SASE 171

Query: 252 DKTLQVHDKRVRLEPVKKLPTASPFNTLS----FSKH-SRNLLAAAGVDSQIYLYDMRDM 306
           DK ++  D    LE  K  P    F  LS       H + +L+A+AG DS + L+D+R  
Sbjct: 172 DKLVKCWD----LE--KNAPIRDYFGHLSGVHTVDIHPTLSLIASAGRDSVVKLWDIRSK 225

Query: 307 SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPEL 366
            + +  + GH+  + +V+ +P  D  I S  +D   I WDL               A + 
Sbjct: 226 KAVI-TLVGHKSPINSVKCTP-ADPQIISCSNDTTVITWDLV--------------AAKP 269

Query: 367 MMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
           M +   HR  V + + +P   + +AS    N I++WK+
Sbjct: 270 MKVITHHRKAVRDIAVHPG-EFSVASCST-NDIRSWKL 305

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 75/178 (42%), Gaps = 21/178 (11%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGL 192
           I + F H+  V      P  S +IA+      + ++D     SK  V TL  HK     +
Sbjct: 186 IRDYFGHLSGVHTVDIHPTLS-LIASAGRDSVVKLWDI---RSKKAVITLVGHKSPINSV 241

Query: 193 AFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSED 252
              P    +++S S+DTTV  WD+ AA KP  ++T H   V D+  H  E +V       
Sbjct: 242 KCTP-ADPQIISCSNDTTVITWDLVAA-KPMKVITHHRKAVRDIAVHPGEFSV------- 292

Query: 253 KTLQVHDKRVRLEPVKKLPT------ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
            +   +D R    P   L T      +   NTL  ++   ++L A   D  +  YD R
Sbjct: 293 ASCSTNDIRSWKLPEGSLLTNFESQNSGIINTLCVNQD--DVLFAGADDGTLSFYDYR 348

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 85/213 (39%), Gaps = 44/213 (20%)

Query: 221 KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS 280
           K   ++  H   V  +     ++  F T S D T++V D             AS    L+
Sbjct: 99  KLSKVINGHLGWVRCIAMDPVDNEWFATGSNDSTIKVWD------------FASGKLKLT 146

Query: 281 FSKHS---RNLLAA--------AGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHT 329
            S H    R+L+ +        A  D  +  +D+ + ++P+    GH   V TV+  P T
Sbjct: 147 LSGHVMGVRDLVVSKRHPYMFSASEDKLVKCWDL-EKNAPIRDYFGHLSGVHTVDIHP-T 204

Query: 330 DGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWL 389
             +I S+G D    +WD+    A              ++   GH+SP+N     P  P +
Sbjct: 205 LSLIASAGRDSVVKLWDIRSKKA--------------VITLVGHKSPINSVKCTPADPQI 250

Query: 390 LASTEEDNVIQAWKV----SMKLVNASPPAISD 418
           ++ + +  VI  W +     MK++     A+ D
Sbjct: 251 ISCSNDTTVI-TWDLVAAKPMKVITHHRKAVRD 282

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 74/159 (46%), Gaps = 18/159 (11%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILT-----------SHDDIVNDVKWHEFESNVFGTVS 250
            L+G+++ TV+LW+++       IL            SH   +ND+KW+  +  +F T  
Sbjct: 64  FLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFFTCG 123

Query: 251 EDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQI-YLYDMRDMSSP 309
            DK +++ D   +   V+ L     FN+  F   + N      +D     L D+R+M+  
Sbjct: 124 NDKFVKLWDTN-KFINVQDL----EFNSNLFQMDTANQFILVTLDDYYPRLIDLRNMNLG 178

Query: 310 LHVMSGHQDSVT-TVEFSPHTDGIICSSGSDRRAIIWDL 347
           + +   H +S T   + +P  D +I SS +D    IWD+
Sbjct: 179 ITIFGKHLNSKTLCCKINPVRDNLIASSDNDGMIRIWDV 217

>Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247C -
           Hypothetical ORF [contig 164] FULL
          Length = 418

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 80/180 (44%), Gaps = 29/180 (16%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           ++S S DTT  +WD+++    K+ L +HD  V DVK+    + +F +   D +++V D R
Sbjct: 181 IISSSIDTTCTVWDLQSPNYVKTQLIAHDSEVYDVKFLAQSTQLFASCGGDGSVRVFDLR 240

Query: 262 -VRLEPVKKLPTASPFNTLSFSKHSR--------------------------NLLAAAGV 294
            +    +   P      TLS S+ S                           N++A    
Sbjct: 241 SLAHSTIIYEPNGQSAATLSQSQDSGGASGTSRDGSNSDNALLRLEPSPFDPNVVATFAH 300

Query: 295 D-SQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL-TQIGA 352
           D S + + DMR   + +  + GH  +V  +++      ++ +   D +A++WDL TQ+ A
Sbjct: 301 DSSNVLILDMRYPGAAVLTLEGHSGAVNQIQWHQSRQNVLITCADDCQALLWDLNTQLTA 360

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 71/177 (40%), Gaps = 32/177 (18%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFD-RTL-------EESKAQVSTLAFHKENGY 190
           H  EV   +++  ++ + A+  G G++ +FD R+L       E +    +TL+  +++G 
Sbjct: 208 HDSEVYDVKFLAQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPNGQSAATLSQSQDSGG 267

Query: 191 GLA-------------------FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDD 231
                                 F+P++        D + V + D+         L  H  
Sbjct: 268 ASGTSRDGSNSDNALLRLEPSPFDPNVVATF--AHDSSNVLILDMRYPGAAVLTLEGHSG 325

Query: 232 IVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNL 288
            VN ++WH+   NV  T ++D    + D   +L        +S +N    SK +R++
Sbjct: 326 AVNQIQWHQSRQNVLITCADDCQALLWDLNTQLTAAATPSVSSKWNN---SKTARSI 379

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 60/263 (22%), Positives = 109/263 (41%), Gaps = 35/263 (13%)

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           I+A     G +  F     E    V+ +  H      L FN   S  L+SG     + +W
Sbjct: 76  ILAGALDNGVVEFFK---PEELRSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVW 132

Query: 215 DIEAAKK-------PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D             P   +T  ++ V  + W++  ++VF +        + D + + E +
Sbjct: 133 DTNKIATQGYSPFGPGVAMTPIEE-VQSLAWNQTLAHVFASAGSSGFASIWDLKAKKEVI 191

Query: 268 K---KLPTASPFNTLSFSK----HSRNLLAAAGVDSQ--IYLYDMRDMSSPLHVMS-GHQ 317
                 PT+   N LS  +    +S  +  A G D++  I ++D+R+ ++PL V+S GH 
Sbjct: 192 HLSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNAPLKVLSQGHS 251

Query: 318 DSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPV 377
             + ++++    D ++ SSG D   I+W+      E++Q          +       +  
Sbjct: 252 KGILSLDWCQQDDKLMISSGRDNTCILWN-----PEEAQK---------LTQFPTRGNWC 297

Query: 378 NEFSFNPQIPWLLASTEEDNVIQ 400
            +  F P+ P L AS   DN +Q
Sbjct: 298 FKTKFAPEAPDLFASASFDNKVQ 320

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 96/203 (47%), Gaps = 21/203 (10%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
            ++GS+DTT+ +WD+ A+ K K  L+ H   V DV   E    +F + SEDK ++  D  
Sbjct: 102 FVTGSNDTTLKVWDL-ASGKLKLTLSGHTMGVRDVAVSERHPYMF-SASEDKLVKCWDLE 159

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
                       S  +T+     + +L+A  G D+ + L+D+R   + +  + GH+  +T
Sbjct: 160 KNTAIRDYYGHLSGVHTVDIHP-TLDLIATGGRDAVVKLWDIRTRKA-VKTLVGHKAPIT 217

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFS 381
            V+ +P  D  + SS +D    +WD+               A + M +   H+  V   +
Sbjct: 218 KVKCTP-VDPQVVSSSTDTTVRLWDIV--------------AGKSMKVLTHHKRAVRSIA 262

Query: 382 FNPQIPWLLASTEEDNVIQAWKV 404
            +P   + LAS   D+V ++W++
Sbjct: 263 LHPG-EFSLASACTDDV-RSWRL 283

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 6/121 (4%)

Query: 132 AIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYG 191
           AI + + H+  V      P   ++IAT      + ++D     ++  V TL  HK     
Sbjct: 163 AIRDYYGHLSGVHTVDIHPT-LDLIATGGRDAVVKLWD---IRTRKAVKTLVGHKAPITK 218

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSE 251
           +   P +  +++S S DTTV LWDI A K  K +LT H   V  +  H  E ++    ++
Sbjct: 219 VKCTP-VDPQVVSSSTDTTVRLWDIVAGKSMK-VLTHHKRAVRSIALHPGEFSLASACTD 276

Query: 252 D 252
           D
Sbjct: 277 D 277

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 87/183 (47%), Gaps = 20/183 (10%)

Query: 188 NGYGLAFNP--HISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW--HEFES 243
           N +   F P    +G LLS S+     L D    +  +SI  S+  I ND+K    +F  
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCL-DFGTCQSKQSIRVSNLSI-NDLKILNSDFHC 74

Query: 244 NVFGTVSEDKTLQVHDKRVRLEPVKKLPTAS--PFNTLSFSKHSRNLLAAA----GVDSQ 297
               + +  +++++ D      P+  L      PF +L  S+H   LLA      GVD+Q
Sbjct: 75  GSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLD-SRHG--LLAMGTELQGVDAQ 131

Query: 298 IYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQ 356
           I +YD+R   +PL  ++  H D VT ++F P    ++ S  +D    ++DLTQ    Q +
Sbjct: 132 INIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----QDE 187

Query: 357 DDA 359
           DDA
Sbjct: 188 DDA 190

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 98/220 (44%), Gaps = 10/220 (4%)

Query: 142 EVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQV-STLAFHKENGYGLAFNPHISG 200
           E IR      N +   T +    + I++     S  QV  TL+ H  +     ++P + G
Sbjct: 175 ECIRDISFSNNDSKFVTCSDDNVLKIWNF----SNGQVERTLSGHHWDIKSCDWHPEM-G 229

Query: 201 ELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
            ++S S D  V LWD  + +   +I+     ++   ++     N+   +S+DK+ +V D 
Sbjct: 230 LIVSASKDNLVKLWDPRSGQCISTIIKFKHTVLK-TRFQPTRGNLLAAISKDKSCRVFDI 288

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM-RDMSSPLHVMS-GHQD 318
           R  ++ +  +     + TL+++  + ++      D  +  +D+ +D+  P HV+   H  
Sbjct: 289 RHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIPYAHDK 348

Query: 319 SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDD 358
            VT++ ++P    I+ S+  DR    W   +     + DD
Sbjct: 349 CVTSMAYNP-AGNILASASKDRTIRFWTRAKPVDPNAYDD 387

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 86/186 (46%), Gaps = 20/186 (10%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKK-------PKSILTSHDD 231
           V+ L  H  +   L FN      L+SGS+   + +WD   AK+       P + +T  ++
Sbjct: 99  VAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWDTNKAKQTDYVPMTPGTAMTPLEE 158

Query: 232 IVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS--------FSK 283
           I + + W++  ++VF +        + D + + E V  L   SP   L            
Sbjct: 159 ITS-LSWNQSLAHVFASAGATVYASIWDLKAKKE-VIHLSYTSPATGLKSQLSVVEWHPN 216

Query: 284 HSRNLLAAAGVDS--QIYLYDMRDMSSPLHVM-SGHQDSVTTVEFSPHTDGIICSSGSDR 340
           +S  +  A G D+   I ++D+R+ ++PL V+  GH   + ++++    + ++ SSG D 
Sbjct: 217 NSTRVATATGNDNDPSILVWDLRNANTPLQVLDQGHSKGIISLDWCHEDESLMLSSGRDN 276

Query: 341 RAIIWD 346
             ++W+
Sbjct: 277 TVLLWN 282

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 4/85 (4%)

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQI--YLYDMRDMSSPLHVMSGHQDSVT 321
           ++PV  + T + FN L +S  ++ +  A  +D+ I    Y   D  + +  ++ H  SV 
Sbjct: 53  VKPVASISTDTKFNDLDWSYDNKTI--AGALDNGIIELFYLSNDQLTSVAKLTTHTSSVK 110

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWD 346
           T++F+   + ++ S  +     +WD
Sbjct: 111 TLKFNSKQENVLVSGSNKGEIFVWD 135

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 32/133 (24%)

Query: 233 VNDVKWHEFESN-VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAA 291
           +N VK ++ +SN    T++ DK                    SPF +L  S+H  ++LA 
Sbjct: 79  LNSVKIYDIKSNDCIATITNDK-------------------KSPFLSLD-SRH--DMLAC 116

Query: 292 A----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
                GVD+++Y+YD+R+ SSP+   +  H D +T ++F P     + S  +D    ++D
Sbjct: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176

Query: 347 LTQIGAEQSQDDA 359
           LTQ    Q +DDA
Sbjct: 177 LTQ----QEEDDA 185

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 208 DTTVALWDIEAAKKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           D  + ++D+     P KS + SH D + D+K+H  +SN   + S D    V+D
Sbjct: 124 DAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +  P S L+   D V +VK+++ E ++  +   D ++ ++D R    P +K+
Sbjct: 194 IELWDSNRSN-PISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTN-SPTQKI 251

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
                 N+L ++         A  D   Y YDMR MS  L+V   H  +V  V+FSP   
Sbjct: 252 VQTMRTNSLCWNPMEAFNFVTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFSPTGQ 311

Query: 331 GIICSS 336
            I+  S
Sbjct: 312 EIVTGS 317

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 28/43 (65%)

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           + S+P+  +S   D+VT V+F+ +   I+ S+GSD   +++DL
Sbjct: 200 NRSNPISNLSWGADNVTNVKFNQNEHDILASTGSDNSIVLYDL 242

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 94/198 (47%), Gaps = 19/198 (9%)

Query: 171 TLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHD 230
           T   S +++ ++ F   N + L   P  +  LL+   +  V L D    K    I T H 
Sbjct: 17  TYSMSYSKLESIEF-GPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQT-HA 74

Query: 231 DIVND---VKWHEFESNVFGTVSEDKTLQVHD-KRVRLEPVKKLPTASPFNTLSFSKHSR 286
             VND   +       ++  T +ED  ++++D K        K   ++PF +L  S+H  
Sbjct: 75  TSVNDMVIINNDRMNGSLIATAAED-AVKIYDLKSNDCVATLKNGKSAPFLSLD-SRH-- 130

Query: 287 NLLAA----AGVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRR 341
            LL      +GVD+++++YD+R    PL  ++  H D +T+++F P    ++ S  +D  
Sbjct: 131 GLLGCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGY 190

Query: 342 AIIWDLTQIGAEQSQDDA 359
             I+DLTQ    Q +DDA
Sbjct: 191 VNIYDLTQ----QEEDDA 204

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 79/170 (46%), Gaps = 5/170 (2%)

Query: 178 QVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVK 237
           Q   L+ H  +     ++P + G ++SGS D  V LWD  + +   ++L     ++   +
Sbjct: 200 QERVLSGHHWDVRSCDWHPEL-GLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLK-TR 257

Query: 238 WHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQ 297
           +   + N+   +S+DK+ +V D R  +  +  +     F  L +S  + ++      D  
Sbjct: 258 FQPTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGS 317

Query: 298 IYLYDM-RDMSSPLHVMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
           +  +D+ +D   P+H++   H+  ++ + ++P    I+ ++  DR    W
Sbjct: 318 LKHFDLGQDTEKPIHIIPFAHEKCISAIAYNP-VGHILATAAKDRTIRFW 366

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 12/177 (6%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHD-DIVNDVKWHEFES 243
           H +    LA N H    L S S D TV LWD+   +  +S+   H    V+  +WH  + 
Sbjct: 270 HTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLDAVHSATAVSSSQWHPSDG 329

Query: 244 NVFGTVSEDKTLQVHDKRVR----LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDS-QI 298
           ++  T   D  + + D R+     +    K+       + +F   +  L   AG DS  +
Sbjct: 330 SILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFL---AGTDSGNV 386

Query: 299 YLYDMRDM--SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDLTQIGA 352
           Y +D+R+   S+PL  ++ H   ++++  SP    ++ +S    + I +W     GA
Sbjct: 387 YSFDLRNGEDSAPLWTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKTPAEGA 443

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 311 HVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQD 357
           HV + H D+V ++  + H   ++ S+ +D    +WDL    A +S D
Sbjct: 265 HVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHGRAARSLD 311

>SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q75A19 Ashbya gossypii ADR108C ADR108Cp
          Length = 334

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 76/156 (48%), Gaps = 25/156 (16%)

Query: 201 ELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++++GS DTT+++ D E   K KS L  H  I+N VK     +    +V +D  L+V D 
Sbjct: 102 KIITGSSDTTLSILDFETGMKLKS-LPGHSSIINQVK--PLSNTTIASVGDDGMLKVWDV 158

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
           R R + V    T  P  TL+ +   ++++  +G++  I ++D+R         S  +D  
Sbjct: 159 RTR-KAVWSATTEFPLFTLA-TTGEKHMVYTSGLEPVIRIWDLR---------SSQKDDT 207

Query: 321 TTVEFSPHTDGII----------CSSGSDRRAIIWD 346
            ++E +PHTD I+          CS G D     +D
Sbjct: 208 LSIE-TPHTDSILSLDLTNRSKMCSLGFDNTLHFYD 242

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 111/281 (39%), Gaps = 48/281 (17%)

Query: 161 GKGTISIFDRTLEESKAQVSTLAFHKENG-YGLAFNPHISGELLSGSDDTTVALWDIEAA 219
           G G +SI D  +  +   + T +F  ++  + +A+N     +++    D ++ L+DI+ A
Sbjct: 36  GNGRLSILD--IAPNGQLIETKSFLTQDCLFDIAWNEQHEKQVVVAQGDGSLRLFDIDLA 93

Query: 220 KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV-----HDKRVRLEPV----KKL 270
           K P +I   H   V    W+     +F + S D T+++      +  + L P     K L
Sbjct: 94  KYPIAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESLLTLRPTPKWKKHL 153

Query: 271 PTASPF-----NTL-----------------------SFSKHSRNLLAAAGVDSQIYLYD 302
            +  P      N +                        FS H  NLL     DS   ++D
Sbjct: 154 DSMEPIIPKRRNNIQIQPSHKINMPNNNNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFD 213

Query: 303 MRD-MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADD 361
           +RD  ++  + +S     V + +F+ +   ++ ++G D    IWD   + A        D
Sbjct: 214 LRDPYNTQRNFLSHAGMEVLSADFNKYRPNVLATAGVDNSIRIWDFRMLVAR-------D 266

Query: 362 GAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
            A  +  +   H   V +  ++P    +L ST  D   + W
Sbjct: 267 AAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSCKIW 307

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 80/193 (41%), Gaps = 28/193 (14%)

Query: 231 DIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS--FSKHSRNL 288
           D +   ++   + N+    S D    + D R      +   + +    LS  F+K+  N+
Sbjct: 185 DCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSADFNKYRPNV 244

Query: 289 LAAAGVDSQIYLYDMR-----DMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRA 342
           LA AGVD+ I ++D R     D +  ++ +++ H  +V  V +SPH   I+ S+  D   
Sbjct: 245 LATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSC 304

Query: 343 IIW-DLT-------QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQI-----PWL 389
            IW DL+       + G   S D   +G   +M  H        EF F         P  
Sbjct: 305 KIWNDLSYDPIQQRKTGKTNSLDFTGNGCRFIMNQHT-------EFVFGADWSMWGQPGY 357

Query: 390 LASTEEDNVIQAW 402
           +AST  D  +  W
Sbjct: 358 VASTGWDGNVFIW 370

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 40/211 (18%), Positives = 84/211 (39%), Gaps = 33/211 (15%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202
           + ++++ P + N++   +G    +IFD   +    Q + L+          FN +    L
Sbjct: 187 IYQSQFSPHDPNLLICCSGDSYTTIFDLR-DPYNTQRNFLSHAGMEVLSADFNKYRPNVL 245

Query: 203 LSGSDDTTVALWDI------EAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQ 256
            +   D ++ +WD       +AA     I+ +HD  V  V W    S++  + S D + +
Sbjct: 246 ATAGVDNSIRIWDFRMLVARDAAICINEIVNAHDLAVRKVVWSPHHSDILLSTSYDMSCK 305

Query: 257 VHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGH 316
           + +  +  +P+++  T    N+L F+ +                           +M+ H
Sbjct: 306 IWND-LSYDPIQQRKTGKT-NSLDFTGNGCRF-----------------------IMNQH 340

Query: 317 QDSVTTVEFSPHTD-GIICSSGSDRRAIIWD 346
            + V   ++S     G + S+G D    IW+
Sbjct: 341 TEFVFGADWSMWGQPGYVASTGWDGNVFIWN 371

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 113/255 (44%), Gaps = 31/255 (12%)

Query: 123 DEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTL 182
           D+ N   S     KF  I+  I  +Y       IA     G + +F    +++   +  L
Sbjct: 51  DKLNPVVSVEANAKFNDIDWSIDNKY-------IAGALDNGMVELFKTNSKDTLKSIKKL 103

Query: 183 AFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA----------KKPKSILTSHDDI 232
           + H  +   + FN      L SGS +  + +WD+               P   +T  ++I
Sbjct: 104 SKHGTSVTTVNFNAKQENVLASGSKNGEIFIWDLNKCIDQSNDSYSPLTPGMAMTPVEEI 163

Query: 233 VNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS--------FSKH 284
            + + W++  S+VF +        + D + + E V  L   SP ++L           ++
Sbjct: 164 TS-LAWNQSLSHVFASAGNTSYASIWDLKAKKE-VIHLSYTSPSSSLKPQLSVVEWHPEN 221

Query: 285 SRNLLAAAGVDSQ--IYLYDMRDMSSPLHVM-SGHQDSVTTVEFSPHTDGIICSSGSDRR 341
           S  +  A+  D++  I ++D+R+ ++PL ++ +G+   + ++++  H   ++ SSG D  
Sbjct: 222 STRVATASNSDNEPIILIWDLRNANTPLQILENGNSKGILSLDWCKHDSNLLLSSGRDNT 281

Query: 342 AIIWDLTQIGAEQSQ 356
           A++W+  + G E +Q
Sbjct: 282 AVLWNPEE-GKELTQ 295

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 67/151 (44%), Gaps = 15/151 (9%)

Query: 263 RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDS---QIYLYDMRDMSSPLHVMSGHQDS 319
           +L PV  +   + FN + +S  ++ +  A  +D+   +++  + +D    +  +S H  S
Sbjct: 52  KLNPVVSVEANAKFNDIDWSIDNKYI--AGALDNGMVELFKTNSKDTLKSIKKLSKHGTS 109

Query: 320 VTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNE 379
           VTTV F+   + ++ S   +    IWDL +   +QS D      P + M      +PV E
Sbjct: 110 VTTVNFNAKQENVLASGSKNGEIFIWDLNKC-IDQSNDSYSPLTPGMAM------TPVEE 162

Query: 380 ---FSFNPQIPWLLASTEEDNVIQAWKVSMK 407
               ++N  +  + AS    +    W +  K
Sbjct: 163 ITSLAWNQSLSHVFASAGNTSYASIWDLKAK 193

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 83/182 (45%), Gaps = 10/182 (5%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234
           S   V+ + F  +N + L   P  S  LL  S + +V L D  +    K       +I +
Sbjct: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 235 -DVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAG 293
             V  ++FE+      +   +++++D R    PV  +      N++  S  SR+ +   G
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDK--NSVFLSLESRHDMLVCG 118

Query: 294 -----VDSQIYLYDMRDMSSPLHV-MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
                VD+++++YD+R  S P+   +  H D +T ++F P    I+ S  +D    I+DL
Sbjct: 119 TELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDL 178

Query: 348 TQ 349
            Q
Sbjct: 179 AQ 180

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/293 (19%), Positives = 112/293 (38%), Gaps = 40/293 (13%)

Query: 147 RYMPANSNIIATINGK-----GTISIFDRTLEESKAQVSTLAFHKENG-YGLAFNPHISG 200
           +Y P   N +A   G      G   +F   +          +F  ++G + +A+N     
Sbjct: 15  QYSPFFDNRLAVATGSNFGLVGNGKLFIVDINNQGIMTEAKSFLTQDGLFDVAWNELHEN 74

Query: 201 ELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD- 259
           ++L    D ++ L+D +    P +I   H+  V    W+     +F + S D T++V   
Sbjct: 75  QVLVAQGDGSLRLFDTQLTDYPIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSP 134

Query: 260 ---------------KRVRLEPVKKLPTASPFNTLS------------FSKHSRNLLAAA 292
                           +  L P K +P ++  N  S            FS H  N++ + 
Sbjct: 135 TRPKSLATLTPKPMAAQNPLMPSKDIPMSNQQNHTSLSKNKNCIYQSQFSPHDPNVIMSC 194

Query: 293 GVDSQIYLYDMRD--MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQI 350
             +S + ++D+R    ++    ++ +     T +F+ +   I+ + G D    +WDL  +
Sbjct: 195 AGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIVATGGVDNMIKVWDLRMV 254

Query: 351 GAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
               S         E+     GH   + + S++P    +L ST  D   + W+
Sbjct: 255 RKAASNSRQPMSVNEI----CGHDLAIRKVSWSPHHSNMLLSTSYDMTCRVWQ 303

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202
           + ++++ P + N+I +  G   +++FD        Q S LA +        FN + S  +
Sbjct: 178 IYQSQFSPHDPNVIMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFNKYRSHIV 237

Query: 203 LSGSDDTTVALWDIEAAKK-------PKSI--LTSHDDIVNDVKWHEFESNVFGTVSEDK 253
            +G  D  + +WD+   +K       P S+  +  HD  +  V W    SN+  + S D 
Sbjct: 238 ATGGVDNMIKVWDLRMVRKAASNSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDM 297

Query: 254 TLQV 257
           T +V
Sbjct: 298 TCRV 301

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 98/222 (44%), Gaps = 24/222 (10%)

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           IIA     G++ +F    +  K++ +    HK       FN      L +G     + +W
Sbjct: 76  IIAGALDNGSVELFSYNADSLKSE-AKFQRHKTTAKVARFNAKQFNVLATGGTKGEIFIW 134

Query: 215 DIEAAKK---------PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLE 265
           D+    +         P + +T  ++I + + W++  ++VF +        + D + + E
Sbjct: 135 DVNKCLENPNDYTPLTPGNSMTPVEEITS-LAWNQSLAHVFASAGSTSYASIWDLKAKKE 193

Query: 266 PVKKLPTASPFNTLS--------FSKHSRNLLAAAGVDS--QIYLYDMRDMSSPLHVMS- 314
            V  L   SP   L           K+S  +  A G D+   I ++D+R+ ++PL V+S 
Sbjct: 194 -VIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVLSQ 252

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQ 356
           GH   V ++++    + ++ SSG D   ++W+  Q G E +Q
Sbjct: 253 GHSKGVLSLDWCNQDENLLLSSGRDNTVVLWN-PQEGQELTQ 293

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 100/223 (44%), Gaps = 18/223 (8%)

Query: 151 ANSNIIATINGKGTISIF-----DRTLE----ESKAQVSTLAFHKENGYGLAFNPHISGE 201
           A++  I  I+  GT S F     D  L+     +  Q STL+ H  +     ++P + G 
Sbjct: 165 AHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTM-GL 223

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           + SGS D  V LWD  A +   +IL     I++  K+   + N+   +S+DK+ ++ D R
Sbjct: 224 IASGSKDNLVKLWDPRAGQCISTILGCKHTIIS-TKFQPTKGNMLAVISKDKSCRIFDIR 282

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM----RDMSSPL--HVMSG 315
             ++ +      S + +L++   + ++      D  +  +D+    +D SS    ++   
Sbjct: 283 QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYA 342

Query: 316 HQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDD 358
           H   +T++ ++P    I+ S+  DR    W   +     S DD
Sbjct: 343 HDKCITSLAYNP-VGHILASASKDRTIRFWTRARPYDPNSFDD 384

>KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {ON}
           similar to uniprot|P07834 Saccharomyces cerevisiae
           YFL009W CDC4 F-box protein required for G1/S and G2/M
           transition associates with Skp1p and Cdc53p to form a
           complex SCFCdc4 which acts as ubiquitin-protein ligase
           directing ubiquitination of the phosphorylated CDK
           inhibitor Sic1p
          Length = 647

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 116/278 (41%), Gaps = 45/278 (16%)

Query: 153 SNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELL-SGSDDTTV 211
           +N I T      I+++D    E+   +  L  H+   + L F   + G++L SGS D +V
Sbjct: 270 NNYIITGADDKKINVYD---AENDLFLLELNGHEGGVWALKF---VDGKILVSGSTDRSV 323

Query: 212 ALWDIEAAKKPKSILTSHDDIVNDVKWHEF-ESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
            +W+IE   K   +   H   V  ++  E+ +S    T S D TL V     +L P+K+L
Sbjct: 324 RIWNIETG-KCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVW----KLPPMKEL 378

Query: 271 ------------PTASPF----------NTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSS 308
                       P  +P+          +  + S H R ++ +   D  + ++D+  M  
Sbjct: 379 DKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR-IVISGSYDHNLMVWDIISMKL 437

Query: 309 PLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAP---- 364
            L++++GH D V +  +    +  I S+  D   +IWDL  I    +    +DGA     
Sbjct: 438 -LYILTGHTDRVYSTIYDYKRNRCI-SASMDTTVMIWDLENIENNGTTTTINDGASIKVV 495

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
             M    GH + V     + +    L S   D  I+ W
Sbjct: 496 GSMKCLYGHTALVGLLCLSNK---FLVSAAADGSIRGW 530

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 81/207 (39%), Gaps = 34/207 (16%)

Query: 220 KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTL 279
           K  ++ L  H    N V   +FE+N   T ++DK + V+D    L              L
Sbjct: 249 KPGRTCLDGHS--TNVVTCLQFENNYIITGADDKKINVYDAENDLF------------LL 294

Query: 280 SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPL---------HVMSGHQDSVTTVEFSPHTD 330
             + H   + A   VD +I +    D S  +         HV  GH  +V  +E   + D
Sbjct: 295 ELNGHEGGVWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGD 354

Query: 331 GIICSSGS-DRRAIIWDLTQIGA--EQSQDDADDGAPE----LMMMHAGHRSPVNEFSFN 383
                +GS D    +W L  +    + SQ+      PE     + +  GH S V   S +
Sbjct: 355 SKYIVTGSRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGH 414

Query: 384 PQIPWLLASTEEDNVIQAWK-VSMKLV 409
            +I   + S   D+ +  W  +SMKL+
Sbjct: 415 GRI---VISGSYDHNLMVWDIISMKLL 438

>NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 12/194 (6%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A   G G + I+D      +  V TL+ H +    L++N HI   L SGS D  +   D
Sbjct: 346 LAVGQGNGLVEIYDVV---KRKCVRTLSGHVDRVACLSWNGHI---LTSGSRDHNILHRD 399

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +         L +H   V  ++W+  E N   +   D  + V+D   R   +K +   + 
Sbjct: 400 VRMPDPFFERLNTHSQEVCGLQWNT-EENKLASGGNDNVVCVYDGTSRNPMIKFIEHKAA 458

Query: 276 FNTLSFSKHSRNLLAAAG--VDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
              L++S H R +LA  G  VD ++  +++        V +G Q  V  + +S +TD I+
Sbjct: 459 VKALAWSPHKRGILATGGGTVDRRLKTWNVNTSMKLSDVDTGSQ--VCNMIWSKNTDEIV 516

Query: 334 CSSG-SDRRAIIWD 346
            S G S     +WD
Sbjct: 517 TSHGYSKYHLTLWD 530

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 109/271 (40%), Gaps = 22/271 (8%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           N +    G G++ +FD TL+  K  ++    H +  Y   +N       +S S D  V +
Sbjct: 74  NQVVVAQGDGSLRLFDTTLQ--KFPIAMFHEHSKEVYSCNWNLVSKSNFVSSSWDGQVKI 131

Query: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273
           W   +  +  S++T             F  +          L    +R +L P +     
Sbjct: 132 W---SPNRKASLIT-------------FSPHPIDVSRALDNLPEVSQRDKLSPNQVAQNR 175

Query: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDM--SSPLHVMSGHQDSVTTVEFSPHTDG 331
           +     +FS H  NL+     +S + L+D+R    ++  + ++       + +F+ +   
Sbjct: 176 NCIYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPN 235

Query: 332 IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391
           II +SG D    IWD+  +    +Q     G     +++A H   V +  ++P    +L 
Sbjct: 236 IIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNA-HDLAVKKVCWSPHHSDILL 294

Query: 392 STEEDNVIQAWKVSMKLVNASPPAISDPSLL 422
           ST  D   + WK  + + N  P   ++ SLL
Sbjct: 295 STSYDMSCKIWK-DVSVQNNVPTGKTNGSLL 324

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/192 (18%), Positives = 74/192 (38%), Gaps = 35/192 (18%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGEL 202
           + +A + P + N+I    G   +++FD        Q + +A   +      FN +    +
Sbjct: 178 IYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKYRPNII 237

Query: 203 LSGSDDTTVALWDI------------EAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVS 250
            +   D ++ +WDI            +       I+ +HD  V  V W    S++  + S
Sbjct: 238 ATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAHDLAVKKVCWSPHHSDILLSTS 297

Query: 251 EDKTLQVHDKRVRLEPVKKLPTASPFNTL-------SFSKHSRNLLAA------------ 291
            D + ++  K V ++    +PT     +L       +F  H+  +  A            
Sbjct: 298 YDMSCKIW-KDVSVQ--NNVPTGKTNGSLLSNGLLSNFKHHTEFVFGADWSLWGIPGYVA 354

Query: 292 -AGVDSQIYLYD 302
            AG DS +++++
Sbjct: 355 TAGWDSNVFIWN 366

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 87/194 (44%), Gaps = 12/194 (6%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A     G + I+D      +  + TL+ HK+    L++N HI   L SGS D  +   D
Sbjct: 307 LAIGQANGLVEIYDVV---KRKCIRTLSGHKDRVACLSWNNHI---LTSGSRDRRILHRD 360

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +         + +H   V  +KW+  ESN   +   D  + V+D   R   +K     + 
Sbjct: 361 VRVPDSFFERIETHSQEVCGLKWNP-ESNKLASGGNDNMVYVYDGTSRSPVLKFEEHTAA 419

Query: 276 FNTLSFSKHSRNLLAAAG--VDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
              L++S H R +LA+ G   D ++  +++        V +G Q  V  + +S +TD I+
Sbjct: 420 VKALAWSPHKRGILASGGGTADRKLKTWNVNTGFKVNEVDTGSQ--VCNMIWSKNTDEIV 477

Query: 334 CSSGSDRRAI-IWD 346
            S G  R  + +WD
Sbjct: 478 TSHGYSRYNLTLWD 491

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 101/217 (46%), Gaps = 25/217 (11%)

Query: 152 NSNIIATINGKGTISIFDRTLEESKAQVSTLAF--HKENGYGLAFNPHISGELLSGSDDT 209
           N+ IIA     G++ ++  T E + A  S   F  H  +   + FN      L SG ++ 
Sbjct: 73  NNKIIAGALDNGSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 210 TVALWDIEAAKK---------PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
            + +WD+    +         P   ++S D++++ + W++  ++VF +        + D 
Sbjct: 132 EIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVIS-LAWNQSLAHVFASAGSSNFASIWDL 190

Query: 261 RVRLEPVKKLPTASPFNTLS--------FSKHSRNLLAAAGVDS--QIYLYDMRDMSSPL 310
           + + E V  L   SP + +           K+S  +  A G D+   I ++D+R+ ++PL
Sbjct: 191 KAKKE-VIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPL 249

Query: 311 HVMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
             ++ GHQ  + ++++    + ++ SSG D   ++W+
Sbjct: 250 QTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 265 EPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVM---SGHQDSVT 321
           +P+  L   S FN L +S H+  ++A A  +  + LY   + ++ ++ M   S H  SV 
Sbjct: 54  KPIASLQVDSKFNDLDWS-HNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVK 112

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQI 350
           TV+F+   D ++ S G++    IWD+ + 
Sbjct: 113 TVKFNAKQDNVLASGGNNGEIFIWDMNKC 141

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 50/251 (19%), Positives = 94/251 (37%), Gaps = 56/251 (22%)

Query: 206 SDDTTVALWDIEAAKKPKSILTSH-DDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRL 264
           S D+++ LW + AA   K I +   D   ND+ W      + G + ++ +L+++      
Sbjct: 37  STDSSLELWSLLAADSEKPIASLQVDSKFNDLDWSHNNKIIAGAL-DNGSLELYSTNEAN 95

Query: 265 EPVKKLPT----ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS---------SPLH 311
             +  +      +S   T+ F+    N+LA+ G + +I+++DM   +         +P  
Sbjct: 96  NAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQ 155

Query: 312 VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL------------------------ 347
            MS   D V ++ ++     +  S+GS   A IWDL                        
Sbjct: 156 SMSS-VDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSV 214

Query: 348 --------TQIGAEQSQD--------DADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391
                   T++      D        D  +    L  ++ GH+  +    +  Q   LL 
Sbjct: 215 VEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLL 274

Query: 392 STEEDNVIQAW 402
           S+  DN +  W
Sbjct: 275 SSGRDNTVLLW 285

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 7/203 (3%)

Query: 149 MPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDD 208
           +  N   +A  +  G + I D    E  A     A H +   GL ++   S  L++G  D
Sbjct: 190 LSPNQKSVACGSWHGDVKIIDSETLEILASFD--AIHDDKIGGLDWSSD-STLLVTGGAD 246

Query: 209 TTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVK 268
             V +W   +     ++L  H+  V  VK+H  +  V  + S D T ++ D   ++E   
Sbjct: 247 RIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYV-ASASFDMTWRLWDVERQVELQL 305

Query: 269 KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH 328
           +   A     L F +   +LL +AG+DS   ++DMR   S L ++ GH   +  V +SP+
Sbjct: 306 QEGHAKEVYCLDF-QCDGSLLCSAGLDSIGRIWDMRSGQS-LMILEGHAKPIYGVSWSPN 363

Query: 329 TDGIICSSGSDRRAIIWDLTQIG 351
              +   S +D    +WD+ ++G
Sbjct: 364 GHHVATGS-ADGTVKVWDIRKVG 385

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 182 LAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEF 241
           L  H +  YG++++P+    + +GS D TV +WDI     P SIL +H++IV+DVK+ + 
Sbjct: 348 LEGHAKPIYGVSWSPN-GHHVATGSADGTVKVWDIRKVGNPFSIL-AHNNIVSDVKFDKV 405

Query: 242 ESNVFGTVSEDKTLQVH--DKRVRLEPVK 268
                 + S DKT+ V   D  +RL  +K
Sbjct: 406 SGRTLVSSSYDKTVSVFASDSWLRLASLK 434

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 64/129 (49%), Gaps = 8/129 (6%)

Query: 225 ILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT----LS 280
           +L  H   + D+ ++    ++  T S D  +   D R    P +   T S + +    + 
Sbjct: 112 VLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMR---SPHRPFYTTSAWRSGASQVK 168

Query: 281 FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR 340
           ++    N+LA+A   + IY++D+R  S+PLH + GH  SV +++F+      I SS +D 
Sbjct: 169 WNYKDSNILASAH-SNDIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDG 227

Query: 341 RAIIWDLTQ 349
               WD+++
Sbjct: 228 TVKFWDISK 236

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 19/131 (14%)

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSP---LHVMSGHQDSVTTVEFSPH-TDG 331
           FN +S +   R+++ A+   + +Y+ D+ D  SP   L  ++  Q  V  V++SPH    
Sbjct: 30  FNAVSINPSGRDVVLAS--RNGLYIIDLDDPFSPPRWLQHITPWQ--VADVQWSPHPAKP 85

Query: 332 IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391
               S S+++A+IW+L    A  S D  D       ++H GH   + + +FNP+ P +LA
Sbjct: 86  YWVVSTSNQKALIWNL----ARTSSDAID------HVLH-GHSRAITDINFNPENPDILA 134

Query: 392 STEEDNVIQAW 402
           +   D  + AW
Sbjct: 135 TCSVDTYVHAW 145

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 60/140 (42%), Gaps = 14/140 (10%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS 338
           ++F+  + ++LA   VD+ ++ +DMR    P +  S  +   + V+++ + D  I +S  
Sbjct: 123 INFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWN-YKDSNILASAH 181

Query: 339 DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398
                IWDL              G+  L  +  GH S VN   FN      + S+  D  
Sbjct: 182 SNDIYIWDLRM------------GSTPLHKL-VGHDSSVNSIDFNRFKSSEIMSSSNDGT 228

Query: 399 IQAWKVSMKLVNASPPAISD 418
           ++ W +S    N +    +D
Sbjct: 229 VKFWDISKGSDNCTSTVSTD 248

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 51/121 (42%), Gaps = 3/121 (2%)

Query: 139 HIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHI 198
           H   +    + P N +I+AT +    +  +D  +        T +  +     + +N + 
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWD--MRSPHRPFYTTSAWRSGASQVKWN-YK 172

Query: 199 SGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVH 258
              +L+ +    + +WD+     P   L  HD  VN + ++ F+S+   + S D T++  
Sbjct: 173 DSNILASAHSNDIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFW 232

Query: 259 D 259
           D
Sbjct: 233 D 233

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 3/72 (4%)

Query: 145 RARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLS 204
           + ++   +SNI+A+ +    I I+D  L      +  L  H  +   + FN   S E++S
Sbjct: 166 QVKWNYKDSNILASAHS-NDIYIWD--LRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMS 222

Query: 205 GSDDTTVALWDI 216
            S+D TV  WDI
Sbjct: 223 SSNDGTVKFWDI 234

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 108/255 (42%), Gaps = 35/255 (13%)

Query: 163 GTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD---IE-- 217
           G +  F  +  +S   ++ LA H      + FN      L SG     + +WD   IE  
Sbjct: 84  GVVEFFSPSEYKS---IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETP 140

Query: 218 --AAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTAS- 274
             A   P + +T  D+I + + W++ + +VF +        + D + + E +    T+S 
Sbjct: 141 GYAPFVPGTAMTPMDEIYS-LAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTSSI 199

Query: 275 --PFNTLSF----SKHSRNLLAAAGVDS--QIYLYDMRDMSSPLHVMS-GHQDSVTTVEF 325
               N LS       +S  +  A+G DS   I ++D+R+ + PL  +S GH   V ++++
Sbjct: 200 TGQKNQLSIVEWHPNNSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDW 259

Query: 326 SPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQ 385
               + ++ SSG D   ++W+      E  Q+         +       +   +  F PQ
Sbjct: 260 CKQDETLLLSSGRDNSCVLWN-----PESGQN---------LTQFPTRGNWCFKTKFAPQ 305

Query: 386 IPWLLASTEEDNVIQ 400
            P L AS   DN I+
Sbjct: 306 APDLFASASFDNKIE 320

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 70/150 (46%), Gaps = 10/150 (6%)

Query: 206 SDDTTVALWDIEAAKK--PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           S D+T+ +W + +  +  P+  + S D   ND+ W  ++++V     ++  ++       
Sbjct: 37  SSDSTLEIWSLLSPHEATPQGSV-SADAKFNDLDW-SYDNSVLTGALDNGVVEFFSPSEY 94

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHV--MSGH----Q 317
               K    ++P  T+ F+    N+L + G   +IY++D   + +P +   + G      
Sbjct: 95  KSIAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPM 154

Query: 318 DSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           D + ++ ++ +   +  S+GS   A IWDL
Sbjct: 155 DEIYSLAWNQNQGHVFASAGSSGFASIWDL 184

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICS 335
           FN L +S +  ++L  A  +  +  +   +  S +  ++ H   V TV F+     ++CS
Sbjct: 65  FNDLDWS-YDNSVLTGALDNGVVEFFSPSEYKS-IAKLAQHSTPVKTVRFNAKQHNVLCS 122

Query: 336 SGSDRRAIIWDLTQI 350
            GS     IWD  +I
Sbjct: 123 GGSKGEIYIWDANKI 137

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 62/126 (49%), Gaps = 2/126 (1%)

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWD   +  P + L+   D +  +K+++ E+++  +   D ++ ++D R    P +K+
Sbjct: 201 IELWDNNRST-PLTNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLRTN-SPTQKI 258

Query: 271 PTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTD 330
             +   N + ++         A  D   Y YDMR+MS  L+V   H  +V  V+FSP  D
Sbjct: 259 VQSMRTNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDFSPTGD 318

Query: 331 GIICSS 336
            I+  S
Sbjct: 319 EIVTGS 324

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 85/206 (41%), Gaps = 45/206 (21%)

Query: 152 NSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGY--GLAFNPH---ISG-----E 201
           N N +AT +G G I  ++ +  E       ++F    G   GL   P    + G      
Sbjct: 79  NLNKLATASGDGVIKYWNMSTREE-----YVSFKGHYGLVTGLCVTPEGLSVGGLSNQNH 133

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +LS  DD T+ LW I           ++DD  N     E  +   G+ +  KT       
Sbjct: 134 MLSCGDDKTIKLWSI-----------NNDDFANIKSDEELITKTNGSGALLKTFYGEHAF 182

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
             ++  ++ P                L    G  ++I L+D  + S+PL  +S   D++T
Sbjct: 183 QGIDHHREKP----------------LFVTGG--AKIELWD-NNRSTPLTNLSWGADNIT 223

Query: 322 TVEFSPHTDGIICSSGSDRRAIIWDL 347
           +++F+     I+ S+GSD   +++DL
Sbjct: 224 SLKFNQSETDIVASAGSDNSVVLYDL 249

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/248 (22%), Positives = 97/248 (39%), Gaps = 29/248 (11%)

Query: 161 GKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAK 220
           G G + I D T  + K   S     K+  + +A+N     ++L+   D ++ L+DI   K
Sbjct: 37  GNGKLFILDIT-PQGKIVESNSFLTKDGLFDVAWNELHENQVLAAQGDGSLRLFDINLQK 95

Query: 221 KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS 280
            P +I   H+  V    W+  +   F + S D T+++     +      LPT +    L 
Sbjct: 96  YPVAIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKIWSPARKQSLRTLLPTPTNNTVL- 154

Query: 281 FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSD 339
                        VDS +   D+   +   H   S ++D +    +SPH   ++ S   +
Sbjct: 155 -------------VDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDSNLVMSCSGN 201

Query: 340 RRAIIWDLTQ-IGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398
               I+D+ Q +  EQ    A  G   L               FN   P ++A+   D +
Sbjct: 202 SYVSIFDIRQPVNTEQQSFIAHRGLEALTC------------DFNKYRPHIVATGGVDKL 249

Query: 399 IQAWKVSM 406
           I+ W + M
Sbjct: 250 IKVWDLRM 257

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 97/242 (40%), Gaps = 52/242 (21%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           N +    G G++ +FD  L+  K  V+    H+   +   +N       LS S D TV +
Sbjct: 75  NQVLAAQGDGSLRLFDINLQ--KYPVAIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKI 132

Query: 214 WDIEAAKKPKSIL------------------------------TSHDDIVNDVKWHEFES 243
           W     +  +++L                              +++ D +    +   +S
Sbjct: 133 WSPARKQSLRTLLPTPTNNTVLVDSTVLKQDVPVSNQAQHKYSSNNKDCIYQALYSPHDS 192

Query: 244 NVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFN------TLSFSKHSRNLLAAAGVDSQ 297
           N+  + S +  + + D R   +PV     +   +      T  F+K+  +++A  GVD  
Sbjct: 193 NLVMSCSGNSYVSIFDIR---QPVNTEQQSFIAHRGLEALTCDFNKYRPHIVATGGVDKL 249

Query: 298 IYLYDMRDM--------SSPLHV--MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW-D 346
           I ++D+R +        SSP+ +  M GH  +V  V +SPH   ++ S+  D     W D
Sbjct: 250 IKVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLSTSYDMTCRTWQD 309

Query: 347 LT 348
           LT
Sbjct: 310 LT 311

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 16/127 (12%)

Query: 143 VIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFN---PHIS 199
           + +A Y P +SN++ + +G   +SIFD     +  Q S +A          FN   PHI 
Sbjct: 182 IYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTEQQSFIAHRGLEALTCDFNKYRPHI- 240

Query: 200 GELLSGSDDTTVALWDIEAAKK--------PKSI--LTSHDDIVNDVKWHEFESNVFGTV 249
             + +G  D  + +WD+   ++        P SI  +  H   V  V W    S++  + 
Sbjct: 241 --VATGGVDKLIKVWDLRMVRQSLLHTRSSPVSINEMQGHSLAVRRVFWSPHHSDMLLST 298

Query: 250 SEDKTLQ 256
           S D T +
Sbjct: 299 SYDMTCR 305

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 88/181 (48%), Gaps = 15/181 (8%)

Query: 174 ESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT-TVALWDIEAAKKPKSILTSHDDI 232
            ++  + T +  K+  Y  +F     G+LL   D T  V+++D   +  P++IL S +  
Sbjct: 69  RTRQVIKTFSRFKDVVYSASFRS--DGKLLCAGDATGLVSVYD---SYNPRTILLSMNAS 123

Query: 233 VNDV---KWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF-NTLSFSKHSRNL 288
            +     K+H  +S +  T S+D+  ++ D     EP  +L  A+ +  TLSF   + +L
Sbjct: 124 THPTHVTKFHTQDSKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHL 183

Query: 289 LAAAGVDSQIYLYDMRDM-SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           +A    D  + LYD R   S+P++ ++  Q     +  SP    I+   GS+ +  +WDL
Sbjct: 184 IATGSYDGLVRLYDTRSSGSTPIYSLNHDQPIENVIAVSP--TQIVSCGGSNFK--VWDL 239

Query: 348 T 348
           T
Sbjct: 240 T 240

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 10/133 (7%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD----RTLEESKAQVSTLAFHKEN 188
           +   F   ++V+ +    ++  ++   +  G +S++D    RT+  S    ST   H   
Sbjct: 73  VIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLS-MNASTHPTHVTK 131

Query: 189 GYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGT 248
                F+   S  L + SDD    LWDI  A +P+  LT   D V  + +     ++  T
Sbjct: 132 -----FHTQDSKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLIAT 186

Query: 249 VSEDKTLQVHDKR 261
            S D  ++++D R
Sbjct: 187 GSYDGLVRLYDTR 199

>Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W
           (REAL)
          Length = 322

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 90/235 (38%), Gaps = 37/235 (15%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVND---VKWHEFESNVFGTVSEDKTLQ 256
           G L+SGS D TV +WDI+       +   HD  V     +K++  +  V G  S D TL 
Sbjct: 32  GILVSGSTDKTVRIWDIKRG-CCTYVFNGHDSTVRCLDVLKYNNTKYIVSG--SRDNTLH 88

Query: 257 V-----------HDKRVRLEPVKKLPTASPFNTLSFSKHSR---------NLLAAAGVDS 296
           V           H        V + P  +P+       H+          N++ +A  DS
Sbjct: 89  VWKLPEGSSTADHQAEHDYPLVFRTPEENPYFVGILRGHTASIRTVSGHGNIVISASYDS 148

Query: 297 QIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQ 356
            + ++D+  M   L+++SGH D V    +       I S+G+D    IWDL  I      
Sbjct: 149 TLIVWDIAQMKC-LYILSGHTDRVYAAIYDHERKRCI-SAGTDSTIRIWDLENIRNNGEC 206

Query: 357 DDADDGAP------ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
            +  + A       E M    GH + V     + +    L S   D  I  W  S
Sbjct: 207 SNTTNCASPCTKVLESMYALQGHTALVGLLELSDR---FLVSAAADGTIIGWDAS 258

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           G ++SGS D  V  WD  + +   +IL     ++   ++     N    +S+DK+ +V D
Sbjct: 222 GLIVSGSKDNLVKFWDPRSGQCVSTILNFKHTVLR-TRFQPTRGNYLLGISKDKSCRVFD 280

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD-MRDMSSPLHVMS-GHQ 317
            R   + +  +     F TLS+   + ++   A  D  I  +D + D+  P+H +   H+
Sbjct: 281 IRNHTKELLTVRDEVDFMTLSWHPINESVFTLANYDGSIKHFDILEDLEKPIHTIPFAHE 340

Query: 318 DSVTTVEFSPHTDGIICSSGSDRRAIIW 345
             +T + ++P    I+ S+  DR    W
Sbjct: 341 KCITAMSYNP-IGHILASASKDRTIRFW 367

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 122/303 (40%), Gaps = 50/303 (16%)

Query: 126 NDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFH 185
           ND +SF  A K    +  IR+     +   +AT      I I+D      K  V  L  H
Sbjct: 361 NDVNSFVTA-KSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIA---KKQIVMVLQGH 416

Query: 186 KENGYGLAFNPHISGE-LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           +++ Y L + P  SG+ L+SGS D TV +WD+   +   S+  S +D V  V     +  
Sbjct: 417 EQDIYSLDYFP--SGDKLVSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVSPGDGK 472

Query: 245 VFGTVSEDKTLQVHDKRV-----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQ 297
                S D+ ++V D        RL+   +L T    +  S  F++   N + +  +D  
Sbjct: 473 FIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDG-NGVVSGSLDRS 531

Query: 298 IYLYDMR------DMSSPLH-----VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
           + L+++R          P         +GH+D V +V  +   D  I S   DR  + W 
Sbjct: 532 VKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVA-TTQNDQYILSGSKDRGVLFW- 589

Query: 347 LTQIGAEQSQDDADDGAPELMMMHAGHRSPV------NEFSFNPQIPWLLASTEEDNVIQ 400
                      D   G P LM+   GHR+ V      N F   PQ   + A+   D   +
Sbjct: 590 -----------DTQSGNPLLMLQ--GHRNSVISVAVANGFPLGPQY-GVFATGSGDCKAR 635

Query: 401 AWK 403
            WK
Sbjct: 636 IWK 638

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 86/183 (46%), Gaps = 13/183 (7%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234
           S + V +  F  EN + L   P     LL+G  +  + L D    K  ++I  S +  +N
Sbjct: 3   SYSLVESNFFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKAS-ETAIN 60

Query: 235 DVKW--HEFESNVFGTVSEDKTLQVHDKRVR-LEPVKKLPTASPFNTLSFSKHSRNLLAA 291
           D+K    +F +    + +    ++V D R        +  + SPF +L  S+H   LLA 
Sbjct: 61  DLKVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLD-SRHG--LLAC 117

Query: 292 A----GVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
                G+D+ +++YD+R   +PL  ++  H D VT ++F P    I+ S  +D    I+D
Sbjct: 118 GTELQGIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD 177

Query: 347 LTQ 349
           L Q
Sbjct: 178 LKQ 180

>Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {ON}
           YGL003C (CDH1) - protein required for Clb2 and Ase1
           degradation [contig 206] FULL
          Length = 590

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 92/195 (47%), Gaps = 14/195 (7%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A     G ++IFD    E K  + T+  H +    L++N HI   L SGS D  +   D
Sbjct: 341 LAVGQTNGLVNIFD---VEKKKCIRTIPGHIDRVACLSWNNHI---LTSGSRDRRILHRD 394

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +   +     + +H+  V  +KW+  E N   +   D  + V+D   RL  +K     + 
Sbjct: 395 VRTPQSSFEEIRTHNQEVCGLKWN-VEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAA 453

Query: 276 FNTLSFSKHSRNLLAAAG--VDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGI 332
              +++S H R +LA  G   D ++ +++++  S  LH V +  Q  V  + +S +T+ I
Sbjct: 454 VKAMAWSPHRRGILATGGGTADKRLKIWNVK-TSVKLHDVDTASQ--VCNMIWSKNTNEI 510

Query: 333 ICSSGSDRRAI-IWD 346
           I S G  +  + +WD
Sbjct: 511 ITSHGYSKYNLTLWD 525

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 101/219 (46%), Gaps = 33/219 (15%)

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSE 251
           +A +P  +   ++GS+D T+ +WD+ A    K  L  H   V D+   E    +F + SE
Sbjct: 128 VAVDPIDNEWFVTGSNDATIKIWDL-AKGHLKLTLAGHAMTVRDIAISERHPYMF-SASE 185

Query: 252 DKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHS------RNLLAAAGVDSQIYLYDMRD 305
           DK ++  D       ++K      ++      HS       +L+A AG DS + L+D+R 
Sbjct: 186 DKLVKCWD-------LEKNTAIRDYHGHLSGVHSVDIHPTLDLIATAGRDSVVRLWDIRA 238

Query: 306 MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPE 365
             S + ++ GH+  +  V   P  D  I S  +D    +WD+              G   
Sbjct: 239 RVSVMTLI-GHKSPINKVHCLP-VDPQIVSCSTDATIRLWDIIA------------GKSR 284

Query: 366 LMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
            ++ H  H+  V + SF+P+   +++++ +D  I++W++
Sbjct: 285 KVLTH--HKKSVRDMSFHPREFSMVSASTDD--IRSWRL 319

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 83/196 (42%), Gaps = 39/196 (19%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHK---ENGYGLAFNPHISGELLSGSDDTT 210
           ++IAT      + ++D     ++  V TL  HK      + L  +P I    +S S D T
Sbjct: 220 DLIATAGRDSVVRLWD---IRARVSVMTLIGHKSPINKVHCLPVDPQI----VSCSTDAT 272

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWDI A K  K +LT H   V D+ +H  E ++    ++D         +R   + + 
Sbjct: 273 IRLWDIIAGKSRK-VLTHHKKSVRDMSFHPREFSMVSASTDD---------IRSWRLPEG 322

Query: 271 PTASPFNTL------SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVE 324
              + FN+       S S +  N+L A G +  +  YD +         SGH+      +
Sbjct: 323 ALLTNFNSEKSGIINSLSVNQDNVLCAGGDNGTLSFYDYK---------SGHKYQTLATK 373

Query: 325 FSPHT----DGIICSS 336
             P +     GI+CS+
Sbjct: 374 EIPGSLGSERGILCST 389

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 73/151 (48%), Gaps = 7/151 (4%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           G ++SGS D  +  WD    +   +IL     I+   K+   + N+   V++DK+ +++D
Sbjct: 218 GLIVSGSKDNLIKFWDPRTGRNVSTILGLKHTIIK-TKFQPTQGNLLAVVAKDKSTKIYD 276

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD-MRDMSSPL---HVMS- 314
            R  +  ++ +     + +L +   +  + +    +  I  +D + D +SP+   H ++ 
Sbjct: 277 IRQNMRELQTIRDDVDYMSLVWHPINETMFSVGCYNGAIKHFDLLHDNNSPVPSSHTITY 336

Query: 315 GHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
            H+ SVT++ +SP    I+ S+  DR    W
Sbjct: 337 AHEKSVTSLAYSP-VGHILASAAKDRTIRFW 366

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 106/237 (44%), Gaps = 35/237 (14%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN--VFGT 248
           G+AF+P     +L     +T+ LWD        ++L   +D    V+  +F     +F +
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMG----TLLHRFEDHEGPVRGLDFHPTQPIFVS 70

Query: 249 VSEDKTLQVHDKRVRLEPVKKLPTASP----FNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
             +D T++V      L+  K L T S       T+ F +    +++A+  D  I +++ +
Sbjct: 71  AGDDYTIKVWS----LDTNKCLYTLSGHLDYVRTVFFHRELPWIISASD-DQTIRIWNWQ 125

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT---------------- 348
           +    +  ++GH   V   +F P TD +I S+  D    IWD++                
Sbjct: 126 NRKE-IACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPSNNSFEE 183

Query: 349 QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           Q+ A+Q+  D   G   +  +  GH   VN  SF+P +P L+ S  +D  ++ W++S
Sbjct: 184 QLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 104/249 (41%), Gaps = 58/249 (23%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           V T+ FH+E  +           ++S SDD T+ +W+ +  +K  + LT H+  V   ++
Sbjct: 98  VRTVFFHRELPW-----------IISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQF 145

Query: 239 HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS------------------ 280
           H  + ++  + S D+T+++ D    +  ++K  +A   N+                    
Sbjct: 146 HPTD-DLIVSASLDETIRIWD----ISGLRKRHSAPSNNSFEEQLNAQQNLLDGSLGDCV 200

Query: 281 ----FSKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVE 324
                  H+R            L+ +A  D Q+ L+ M    +  +    GH ++V +V 
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

Query: 325 FSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVN 378
           F PH + +I S G D+   +WDL  +   +Q + + D        P + +  A H S + 
Sbjct: 261 FHPHQN-LIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIM 319

Query: 379 EFSFNPQIP 387
            F  + + P
Sbjct: 320 VFKLDRERP 328

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++S SDD  V LW + A K         H + V+ V +H  + N+  +V EDKTL+V D 
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDL 282

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
             R  PVK+    +    L  +    NL  AA  DS I ++ + D   P  V+  HQ+ +
Sbjct: 283 DKR-TPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKL-DRERPCSVI--HQNQL 337

Query: 321 TTV 323
             V
Sbjct: 338 FFV 340

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 99/244 (40%), Gaps = 31/244 (12%)

Query: 190 YGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTV 249
           Y +A+N     ++L    D ++ L+D    K P +I   H   V    W+      F + 
Sbjct: 65  YDVAWNELHENQVLVAQGDGSLRLFDTSLQKFPIAIFKEHSKEVLSCNWNLINKQTFVSS 124

Query: 250 SEDKTLQVHD-------KRVRLEPVKK--------LPTASPFNTLS----------FSKH 284
           S D T+++         + ++++PV +          T     T+S          FS H
Sbjct: 125 SWDGTVKIWTPNRKESLRTLQVQPVMQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPH 184

Query: 285 SRNLLAAAGVDSQIYLYDMR--DMSSPLHVMSGHQDSVT-TVEFSPHTDGIICSSGSDRR 341
             NL+     +S + L+D+R  + ++       H  S T T +F+ +   ++ +SG D  
Sbjct: 185 DENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNKYRPTVVATSGVDSS 244

Query: 342 AIIWDLTQIG--AEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI 399
             IWD+  +     QSQ   +  A  +  +   H   V + +++P  P +L S   D   
Sbjct: 245 IRIWDIRMLVNLGPQSQ-HINSSAACINEITRAHELAVRKVAWSPHHPNVLLSASYDMTC 303

Query: 400 QAWK 403
             W+
Sbjct: 304 SVWQ 307

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 68/330 (20%), Positives = 123/330 (37%), Gaps = 89/330 (26%)

Query: 118 QGDEEDEANDHS--SFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIF------- 168
           QGD      D S   F IA    H +EV+   +   N     + +  GT+ I+       
Sbjct: 81  QGDGSLRLFDTSLQKFPIAIFKEHSKEVLSCNWNLINKQTFVSSSWDGTVKIWTPNRKES 140

Query: 169 ---------------DRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
                          D T+ ++     T++ +K   Y   F+PH    ++  S ++ V L
Sbjct: 141 LRTLQVQPVMQSQLVDNTIAKTNGSRGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTL 200

Query: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA 273
           +D+   ++P S                                 ++K+ R        T 
Sbjct: 201 FDL---RQPNS---------------------------------NNKQQRFLAHNGSETL 224

Query: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSS----PLHVMS----------GHQDS 319
               T  F+K+   ++A +GVDS I ++D+R + +      H+ S           H+ +
Sbjct: 225 ----TCDFNKYRPTVVATSGVDSSIRIWDIRMLVNLGPQSQHINSSAACINEITRAHELA 280

Query: 320 VTTVEFSPHTDGIICSSGSDRRAIIW-DLTQIGAEQS-QDDADDGAPELMMMHAGHRSPV 377
           V  V +SPH   ++ S+  D    +W DL+  G+  + + ++ D +   +    GH    
Sbjct: 281 VRKVAWSPHHPNVLLSASYDMTCSVWQDLSYDGSRFTMKTNSIDSSKGFIKRFTGH---- 336

Query: 378 NEFSFNPQI-----PWLLASTEEDNVIQAW 402
           +EF F         P  +A+T  D  +  W
Sbjct: 337 SEFVFGADWSLWGQPGFIATTGWDGNVFLW 366

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 76/194 (39%), Gaps = 24/194 (12%)

Query: 154 NIIATINGKGTISIFD--RTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTV 211
           N +A      T+S+FD  R  +   A VS+LA H  +     FN   +  L+SG  D  V
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 212 ALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLP 271
            +WDI     P  I+ + D  +N           FG++ + K +  ++            
Sbjct: 265 KIWDIRT-NNPTKIVNTCDVRIN---------TTFGSIRDIKWMPGYNF----------- 303

Query: 272 TASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG 331
           + +  N      H     A+      +  +DMR  + P   ++ H      + + PH D 
Sbjct: 304 SGNDRNYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPHQD- 362

Query: 332 IICSSGSDRRAIIW 345
            I S G D +  +W
Sbjct: 363 YIASGGRDGKCCLW 376

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 100/226 (44%), Gaps = 23/226 (10%)

Query: 181 TLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE 240
           TL  H +  Y + F+P  +  LLSGS D T  LW  +  K   S    H+  + DV +  
Sbjct: 755 TLVGHSDAVYSVNFSP-CNRFLLSGSGDKTARLWSTDTYKGLVS-YKGHEKPIWDVNFSP 812

Query: 241 FESNVFGTVSEDKTLQVHDKRVRLEPVKKLPT-ASPFNTLSFSKHSRNLLAAAGVDSQIY 299
             +N+F T S D T +V     R+ PV+ L    S  + +SF  + + +   +  D    
Sbjct: 813 TGNNLFATASSDNTARVWSCD-RVYPVRILAGHLSDVDCVSFHPNGQYVFTGSS-DKTSR 870

Query: 300 LYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGI-ICSSGSDRRAIIWDLTQIGAEQSQDD 358
           ++D+    S + +  GH  +VT    SP  DG  + ++  D    +WD   IG+      
Sbjct: 871 MWDLSSGDS-VRLFIGHSSAVTATAVSP--DGRWLSTANEDGTITVWD---IGS------ 918

Query: 359 ADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
                 +L  M    ++ +   S+N +   +L S+  DN ++ W +
Sbjct: 919 ----GKKLKSMRGHGKNSIYSLSYN-KTGNILVSSGADNSVRVWDI 959

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 30/144 (20%)

Query: 272 TASPFNTLSFSKHSRNLLAAAGV-DSQIYLYDMRDMS------------SPLHVMSGHQD 318
           T    ++L FS  S   LAA G  DS I ++ +   S            S    + GH D
Sbjct: 704 TEKNMSSLDFS--SDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSD 761

Query: 319 SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVN 378
           +V +V FSP    ++  SG D+ A +W            D   G    ++ + GH  P+ 
Sbjct: 762 AVYSVNFSPCNRFLLSGSG-DKTARLWST----------DTYKG----LVSYKGHEKPIW 806

Query: 379 EFSFNPQIPWLLASTEEDNVIQAW 402
           + +F+P    L A+   DN  + W
Sbjct: 807 DVNFSPTGNNLFATASSDNTARVW 830

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 17/128 (13%)

Query: 278 TLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSG 337
           +++FS  +R LL+ +G D    L+   D    L    GH+  +  V FSP  + +  ++ 
Sbjct: 765 SVNFSPCNRFLLSGSG-DKTARLWST-DTYKGLVSYKGHEKPIWDVNFSPTGNNLFATAS 822

Query: 338 SDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDN 397
           SD  A +W   ++                + + AGH S V+  SF+P   ++   +  D 
Sbjct: 823 SDNTARVWSCDRVYP--------------VRILAGHLSDVDCVSFHPNGQYVFTGS-SDK 867

Query: 398 VIQAWKVS 405
             + W +S
Sbjct: 868 TSRMWDLS 875

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 106/237 (44%), Gaps = 35/237 (14%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN--VFGT 248
           G+AF+P     +L     +T+ LWD        ++L   +D    V+  +F     +F +
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMG----TLLHRFEDHEGPVRGLDFHPTQPIFVS 70

Query: 249 VSEDKTLQVHDKRVRLEPVKKLPTASP----FNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
             +D T++V      L+  K L T S       T+ F +    +++A+  D  I +++ +
Sbjct: 71  AGDDYTIKVWS----LDTNKCLYTLSGHLDYVRTVFFHRELPWIISASD-DQTIRIWNWQ 125

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT---------------- 348
           +    +  ++GH   V   +F P TD +I S+  D    IWD++                
Sbjct: 126 NRKE-IACLTGHNHFVMCAQFHP-TDDLIVSASLDETIRIWDISGLRKRHSAPGTNSFEE 183

Query: 349 QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           Q+ A+Q+  D   G   +  +  GH   VN  SF+P +P L+ S  +D  ++ W++S
Sbjct: 184 QMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQVKLWRMS 239

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 104/249 (41%), Gaps = 58/249 (23%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           V T+ FH+E  +           ++S SDD T+ +W+ +  +K  + LT H+  V   ++
Sbjct: 98  VRTVFFHRELPW-----------IISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQF 145

Query: 239 HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS------------------ 280
           H  + ++  + S D+T+++ D    +  ++K  +A   N+                    
Sbjct: 146 HPTD-DLIVSASLDETIRIWD----ISGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCV 200

Query: 281 ----FSKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVE 324
                  H+R            L+ +A  D Q+ L+ M    +  +    GH ++V +V 
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

Query: 325 FSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVN 378
           F PH + +I S G D+   +WDL  +   +Q + + D        P + +  A H S + 
Sbjct: 261 FHPHQN-LIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIM 319

Query: 379 EFSFNPQIP 387
            F  + + P
Sbjct: 320 VFKLDRERP 328

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++S SDD  V LW + A K         H + V+ V +H  + N+  +V EDKTL+V D 
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDL 282

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
             R  PVK+    +    L  +    NL  AA  DS I ++ + D   P   +  HQ+ +
Sbjct: 283 DKR-TPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKL-DRERPCSFI--HQNQL 337

Query: 321 TTV 323
             V
Sbjct: 338 FFV 340

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 72/144 (50%), Gaps = 5/144 (3%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+DTT+ +WD+ A+ K K  LT H   V  V   +    +F + SEDK ++  D    
Sbjct: 139 TGSNDTTIKVWDM-ASGKLKLTLTGHVMTVRSVAVSQRHPLMF-SASEDKMVKCWDLERN 196

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                     S  NT+     + +L+A+AG D+ + L+D+R    P+  ++GH+  +  V
Sbjct: 197 AAIRDYHGHFSGVNTVDVHP-TLDLIASAGRDAVVRLWDIR-TRLPVMTLAGHKSPINQV 254

Query: 324 EFSPHTDGIICSSGSDRRAIIWDL 347
           +  P  D  I S  SD    +WD+
Sbjct: 255 KCFP-VDPQIMSCSSDATVRLWDI 277

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 81/185 (43%), Gaps = 28/185 (15%)

Query: 225 ILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKH 284
           ++  H+  V  V     ++  F T S D T++V D  +    +K   T       S +  
Sbjct: 116 VINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWD--MASGKLKLTLTGHVMTVRSVAVS 173

Query: 285 SRN-LLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI 343
            R+ L+ +A  D  +  +D+ + ++ +    GH   V TV+  P  D +I S+G D    
Sbjct: 174 QRHPLMFSASEDKMVKCWDL-ERNAAIRDYHGHFSGVNTVDVHPTLD-LIASAGRDAVVR 231

Query: 344 IWDL-TQIGAEQSQDDADDGAPELMMMHAGHRSPVNE---FSFNPQIPWLLASTEEDNVI 399
           +WD+ T++                +M  AGH+SP+N+   F  +PQI     S   D  +
Sbjct: 232 LWDIRTRLP---------------VMTLAGHKSPINQVKCFPVDPQI----MSCSSDATV 272

Query: 400 QAWKV 404
           + W +
Sbjct: 273 RLWDI 277

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           ++IA+      + ++D     ++  V TLA HK     +   P +  +++S S D TV L
Sbjct: 219 DLIASAGRDAVVRLWDI---RTRLPVMTLAGHKSPINQVKCFP-VDPQIMSCSSDATVRL 274

Query: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNV 245
           WDI A K  K ILT H   V  +  H  ES+V
Sbjct: 275 WDIRAGKATK-ILTHHSKSVRAIAAHPAESSV 305

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 59/141 (41%), Gaps = 4/141 (2%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           + S S+D  V  WD+E     +     H   VN V  H    ++  +   D  +++ D R
Sbjct: 179 MFSASEDKMVKCWDLERNAAIRD-YHGHFSGVNTVDVHP-TLDLIASAGRDAVVRLWDIR 236

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321
            RL  +      SP N +        +++ +  D+ + L+D+R       +++ H  SV 
Sbjct: 237 TRLPVMTLAGHKSPINQVKCFPVDPQIMSCSS-DATVRLWDIR-AGKATKILTHHSKSVR 294

Query: 322 TVEFSPHTDGIICSSGSDRRA 342
            +   P    +  +S SD R+
Sbjct: 295 AIAAHPAESSVATASTSDVRS 315

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 101/234 (43%), Gaps = 29/234 (12%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVS 250
           G+AF+P     +L     +T+ LWD             HD  V  + +H  +  +F +  
Sbjct: 16  GIAFHPS-RPLVLVALFSSTIQLWDYRMGTLLHR-FEGHDGPVRGIDFHPTQP-IFASTG 72

Query: 251 EDKTLQVHDKRVRLEPVKKLPTASP---FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMS 307
           +D T+++      L+  K L T +    +    F  H    L +A  D  I +++ ++  
Sbjct: 73  DDATIRIWS----LDTNKCLYTFTGHLDYVRTVFFHHELPWLISASDDQTIRIWNWQNRK 128

Query: 308 SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT----------------QIG 351
             +  ++GH   V   +F P T+ ++ S+  D    +WD++                Q+ 
Sbjct: 129 E-IACLTGHNHFVMCAQFHP-TEDLVVSASLDETVRVWDISGLRKKHSAPGAMSMEDQMI 186

Query: 352 AEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           A+Q+  D   G   +  +  GH   VN  SF+P +P L+ S  +D  ++ W++S
Sbjct: 187 AQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 95/226 (42%), Gaps = 47/226 (20%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           L+S SDD T+ +W+ +  +K  + LT H+  V   ++H  E  V  + S D+T++V D  
Sbjct: 110 LISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTEDLVV-SASLDETVRVWD-- 165

Query: 262 VRLEPVKKLPTASPFNTLS----------------------FSKHSRN-----------L 288
             +  ++K  +A    ++                          H+R            L
Sbjct: 166 --ISGLRKKHSAPGAMSMEDQMIAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPL 223

Query: 289 LAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           + + G D Q+ L+ M    +  +    GH ++V  V F P  + +I S+G D+   +WDL
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNVDCVIFHPQQN-LIISAGEDKTLRVWDL 282

Query: 348 -TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVNEFSFNPQIP 387
             ++  +Q + + D        P + +  A H S +  F  + + P
Sbjct: 283 DKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSGIMIFKLDRERP 328

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 202 LLSGSDDTTVALWDIEAAKKPK-SILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV--H 258
           ++SG DD  V LW + + K  +      H + V+ V +H  + N+  +  EDKTL+V   
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNVDCVIFHP-QQNLIISAGEDKTLRVWDL 282

Query: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQD 318
           DKRV   PVK+    +    L  +  + NL  AA  DS I ++ + D   P  V+  HQ+
Sbjct: 283 DKRV---PVKQFKRENDRFWLVAAHPTINLFGAAH-DSGIMIFKL-DRERPCSVI--HQN 335

Query: 319 SVTTV 323
            +  V
Sbjct: 336 QLLFV 340

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 104/261 (39%), Gaps = 69/261 (26%)

Query: 165 ISIFDRTLEESKAQVSTL--AFHKENG--YGLAFNPHISGELLSGSDDTTVALWDIEAAK 220
           +++F  T++    ++ TL   F    G   GL F+P      +S  DD T+ +W ++  K
Sbjct: 28  VALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHP-TQPIFVSAGDDYTIKVWSLDTNK 86

Query: 221 KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS 280
              + LT H D V  V +H  E     + S+D+T+++ + + R E               
Sbjct: 87  CLYT-LTGHLDYVRTVFFHR-ELPWIISASDDQTIRIWNWQNRKE--------------- 129

Query: 281 FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR 340
                                        +  ++GH   V   +F P TD +I S+  D 
Sbjct: 130 -----------------------------IACLTGHNHFVMCAQFHP-TDDLIVSASLDE 159

Query: 341 RAIIWDLT----------------QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNP 384
              IWD++                Q+ A+Q+  D   G   +  +  GH   VN  SF+P
Sbjct: 160 TIRIWDISGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHP 219

Query: 385 QIPWLLASTEEDNVIQAWKVS 405
            +P L+ S  +D  ++ W++S
Sbjct: 220 TLP-LIVSASDDRQVKLWRMS 239

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 104/249 (41%), Gaps = 58/249 (23%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           V T+ FH+E  +           ++S SDD T+ +W+ +  +K  + LT H+  V   ++
Sbjct: 98  VRTVFFHRELPW-----------IISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQF 145

Query: 239 HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS------------------ 280
           H  + ++  + S D+T+++ D    +  ++K  +A   N+                    
Sbjct: 146 HPTD-DLIVSASLDETIRIWD----ISGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCV 200

Query: 281 ----FSKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVE 324
                  H+R            L+ +A  D Q+ L+ M    +  +    GH ++V +V 
Sbjct: 201 VKFILEGHTRGVNWASFHPTLPLIVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

Query: 325 FSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVN 378
           F PH + +I S G D+   +WDL  +   +Q + + D        P + +  A H S + 
Sbjct: 261 FHPHQN-LIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIM 319

Query: 379 EFSFNPQIP 387
            F  + + P
Sbjct: 320 VFKLDRERP 328

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++S SDD  V LW + A K         H + V+ V +H  + N+  +V EDKTL+V D 
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDL 282

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQ 317
             R  PVK+    +    L  +    NL  AA  DS I ++ + D   P   +  +Q
Sbjct: 283 DKR-TPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKL-DRERPCSFIHQNQ 336

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 118/284 (41%), Gaps = 48/284 (16%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE-L 202
           IR+     +   +AT      I I+D      K  V  L  H+++ Y L + P  SG+ L
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIA---QKKIVMVLQGHEQDIYSLDYFP--SGDKL 519

Query: 203 LSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
           +SGS D TV +WD+   +   S+  S +D V  V     +       S D+ ++V D   
Sbjct: 520 VSGSGDRTVRIWDLRNGQ--CSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSET 577

Query: 263 -----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMR---------DM 306
                RL+   +L T    +  S  F++   N+++ + +D  + L+++R         ++
Sbjct: 578 GFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGS-LDRSVKLWNLRGDNNQDVKPNV 636

Query: 307 SSPLHVM-SGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPE 365
                V  +GH+D V +V  +   D  I S   DR  + W            D   G P 
Sbjct: 637 PGTCEVTYTGHKDFVLSVATT-QNDEYILSGSKDRGVLFW------------DTKSGNPL 683

Query: 366 LMMMHAGHRSPV------NEFSFNPQIPWLLASTEEDNVIQAWK 403
           LM+   GHR+ V      N F   P +  + A+   D   + WK
Sbjct: 684 LMLQ--GHRNSVISVAVANGFPLGPNV-GVFATGSGDCKARIWK 724

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 96/246 (39%), Gaps = 65/246 (26%)

Query: 159 INGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEA 218
           IN K + S FDR  +++    STL  H    Y  +F+P  +  L+SGS+D TV LW ++ 
Sbjct: 508 INPKYSSSQFDRFSQDN--TCSTLVGHSGTVYSTSFSPD-NMYLVSGSEDKTVKLWSMDT 564

Query: 219 AKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT 278
                +    H+  V DVK+     + F + S       HD+  RL              
Sbjct: 565 HTALVN-YKGHNHPVWDVKFSPL-GHYFASAS-------HDQTARLWAC----------- 604

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGS 338
                              IY         PL + +GH + V TV F P+   +   S S
Sbjct: 605 -----------------DHIY---------PLRIFAGHTNDVDTVSFHPNGCYVFTGS-S 637

Query: 339 DRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNV 398
           D+   +WD++                + + +  GH +PV     +P   W LA+  ED V
Sbjct: 638 DKTCRMWDVS--------------TGDSVRLFLGHTAPVLSTQVSPDGRW-LATGSEDGV 682

Query: 399 IQAWKV 404
           I  W +
Sbjct: 683 ICLWDI 688

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           L +GS+D  + LWDI   K+ K +     + V+ + +++ E NV  +   D +++V D
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNK-EGNVLISGGADHSVRVWD 730

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 65/129 (50%), Gaps = 10/129 (7%)

Query: 226 LTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT----LSF 281
           L  H   + D+ ++    ++  T S D  +   D R    P +   T S + +    + +
Sbjct: 111 LHGHSRAITDINFNSQHPDILATCSIDTYVHAWDMR---SPHRPFYTTSSWRSSASQVKW 167

Query: 282 SKHSRNLLAAA-GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR 340
           +    N+LA++ G D  ++++D+R  S+PLH ++GH   V +++FS   +  I SS +D 
Sbjct: 168 NFKDSNILASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDG 225

Query: 341 RAIIWDLTQ 349
               WDL++
Sbjct: 226 TVKFWDLSK 234

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 16/128 (12%)

Query: 279 LSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSS-G 337
           ++F+    ++LA   +D+ ++ +DMR    P +  S  + S + V+++     I+ SS G
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSNILASSHG 180

Query: 338 SDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDN 397
           +D    IWDL              G+  L  +  GH S VN   F+      + S+  D 
Sbjct: 181 ND--VFIWDLRH------------GSTPLHKL-TGHNSGVNSIDFSRFEENKIMSSSNDG 225

Query: 398 VIQAWKVS 405
            ++ W +S
Sbjct: 226 TVKFWDLS 233

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 4/150 (2%)

Query: 155 IIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALW 214
           I++T N K  I   ++    S A    L  H      + FN      L + S DT V  W
Sbjct: 86  IVSTSNQKAIIWNLNKP--SSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAW 143

Query: 215 DIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPT-A 273
           D+ +  +P    +S     + VKW+  +SN+  + S    + + D R    P+ KL    
Sbjct: 144 DMRSPHRPFYTTSSWRSSASQVKWNFKDSNILAS-SHGNDVFIWDLRHGSTPLHKLTGHN 202

Query: 274 SPFNTLSFSKHSRNLLAAAGVDSQIYLYDM 303
           S  N++ FS+   N + ++  D  +  +D+
Sbjct: 203 SGVNSIDFSRFEENKIMSSSNDGTVKFWDL 232

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 53/137 (38%), Gaps = 19/137 (13%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           +L+ S    V +WD+     P   LT H+  VN + +  FE N   + S D T++  D  
Sbjct: 174 ILASSHGNDVFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLS 233

Query: 262 VRLEPVKKLPTASPF---NTLSFSKHSRNLLAAAGVDSQIYLYDMR-------------- 304
              +  + + T  P      L F  H   ++   G ++ +YL D+               
Sbjct: 234 KEEKCQQAITTEFPIWRGRYLPFG-HGYCVMPMIGGNNSVYLMDLDVYDEEKELENPESR 292

Query: 305 -DMSSPLHVMSGHQDSV 320
            +   P+    GH D V
Sbjct: 293 IEKLKPVQTFKGHSDRV 309

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 63/139 (45%), Gaps = 23/139 (16%)

Query: 270 LPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSP---LHVMSGHQDSVTTVEFS 326
           L     FN +S +   R+++ A      +Y+ D+ D   P   LH     Q  V  V++S
Sbjct: 22  LKVEGGFNAVSINPSGRDVVLAG--RQGLYIIDLDDPFRPPRWLHHKMPWQ--VADVQWS 77

Query: 327 PHTDG---IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
           PH      I+  S S+++AIIW+L +  +   +            +H GH   + + +FN
Sbjct: 78  PHPAKPHWIV--STSNQKAIIWNLNKPSSNAIE----------YALH-GHSRAITDINFN 124

Query: 384 PQIPWLLASTEEDNVIQAW 402
            Q P +LA+   D  + AW
Sbjct: 125 SQHPDILATCSIDTYVHAW 143

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 3/77 (3%)

Query: 152 NSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTV 211
           +SNI+A+ +G     +F   L      +  L  H      + F+     +++S S+D TV
Sbjct: 171 DSNILASSHGN---DVFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTV 227

Query: 212 ALWDIEAAKKPKSILTS 228
             WD+   +K +  +T+
Sbjct: 228 KFWDLSKEEKCQQAITT 244

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 11/168 (6%)

Query: 183 AFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFE 242
           ++H  N    A +       ++GS DT +AL D+E  +  +  L  H  +VN V+     
Sbjct: 54  SYHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQLLRG-LAGHRRVVNQVR--ALG 110

Query: 243 SNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
            + F +V +D  L+V D      PV +  +  P   ++    + +L+ A+G++  I  YD
Sbjct: 111 ESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIRAYD 170

Query: 303 MRDMSSPLHVMS----GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
           +R   S  H  S     H D+VT+++ S    G +C+   D +  + D
Sbjct: 171 LR--RSADHAFSSWPAAHSDAVTSLDVS--ASGKLCTLAFDHQIHVSD 214

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 103/244 (42%), Gaps = 49/244 (20%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           + T+ FHKE  +           ++S SDD T+ +W+ +  +K  + +T H+  V   ++
Sbjct: 98  IRTVFFHKELPW-----------IISASDDQTIRIWNWQN-RKELACITGHNHFVMCAQF 145

Query: 239 HEFESNVFGTVSEDKTLQVHD----KRVRLEPVKKLPTA---------SPFN----TLSF 281
           H  E  V  + S D+T++V D    ++    PV +L            S F         
Sbjct: 146 HPTEDLVV-SASLDETVRVWDISALRKKHSAPVDRLEEMMIQQQNLLDSGFGDYVVKFIL 204

Query: 282 SKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVEFSPHT 329
             H+R            L+ +   D Q+ L+ M    +  +    GH ++V  V F PH 
Sbjct: 205 EGHTRGVNWATFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHSNNVDCVIFHPHQ 264

Query: 330 DGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVNEFSFN 383
           + +I S+G D+   +WDL  ++  +Q + D D        P + +  A H S +  F  +
Sbjct: 265 N-LIISAGEDKTLRVWDLDKRMPVKQFKRDDDRFWLIAAHPHINLFGAAHDSGIMIFKLD 323

Query: 384 PQIP 387
            + P
Sbjct: 324 RERP 327

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 285 SRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAII 344
           SR  +  A   S I L+D R M + LH   GH+  V  ++F P T  I  SSG D    +
Sbjct: 22  SRPWVLVALFSSTIQLWDYR-MGTLLHRFEGHEGPVRGIDFHP-TQPIFASSGDDSTIKL 79

Query: 345 WDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           W L                 + +    GH   +    F+ ++PW+++++ +D  I+ W
Sbjct: 80  WSLD--------------TNKCLYTFTGHLDYIRTVFFHKELPWIISAS-DDQTIRIW 122

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/261 (20%), Positives = 106/261 (40%), Gaps = 70/261 (26%)

Query: 165 ISIFDRTLEESKAQVSTLAFHKENGY-----GLAFNPHISGELLSGSDDTTVALWDIEAA 219
           +++F  T++    ++ TL  H+  G+     G+ F+P       S  DD+T+ LW ++  
Sbjct: 28  VALFSSTIQLWDYRMGTL-LHRFEGHEGPVRGIDFHP-TQPIFASSGDDSTIKLWSLDT- 84

Query: 220 KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTL 279
            K     T H D +  V +H+ E     + S+D+T+++ + + R E              
Sbjct: 85  NKCLYTFTGHLDYIRTVFFHK-ELPWIISASDDQTIRIWNWQNRKE-------------- 129

Query: 280 SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSD 339
                                         L  ++GH   V   +F P T+ ++ S+  D
Sbjct: 130 ------------------------------LACITGHNHFVMCAQFHP-TEDLVVSASLD 158

Query: 340 RRAIIWDLTQIGAE-------------QSQDDADDGAPELMM--MHAGHRSPVNEFSFNP 384
               +WD++ +  +             Q Q+  D G  + ++  +  GH   VN  +F+P
Sbjct: 159 ETVRVWDISALRKKHSAPVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWATFHP 218

Query: 385 QIPWLLASTEEDNVIQAWKVS 405
            +P L+ S  +D  ++ W++S
Sbjct: 219 TLP-LIVSGSDDRQVKLWRMS 238

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKKPK-SILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++SGSDD  V LW + A K  +      H + V+ V +H  + N+  +  EDKTL+V D 
Sbjct: 223 IVSGSDDRQVKLWRMSATKAWEVDTCRGHSNNVDCVIFHPHQ-NLIISAGEDKTLRVWDL 281

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
             R+ PVK+         L  +    NL  AA  DS I ++ + D   P +V+  HQ+ +
Sbjct: 282 DKRM-PVKQFKRDDDRFWLIAAHPHINLFGAAH-DSGIMIFKL-DRERPPNVV--HQNQL 336

Query: 321 TTV 323
             V
Sbjct: 337 IFV 339

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 86/216 (39%), Gaps = 56/216 (25%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A   G G + I+D      +  + TL  H +    L++N HI   L SGS D T+   D
Sbjct: 322 LAVGQGNGIVEIYDVV---KRKCIRTLPGHVDRTSCLSWNNHI---LSSGSRDHTILHRD 375

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +  A+     + +H   V  +KW+         V E+K                      
Sbjct: 376 VRMAEPFFERIKTHSQEVCGLKWN---------VDENK---------------------- 404

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICS 335
                        LA+ G D+ +Y+YD    SSP+  ++ H+ +V  + +SPH  G + +
Sbjct: 405 -------------LASGGNDNMVYVYDGTS-SSPVFKITEHKAAVKAMAWSPHKRGTLAT 450

Query: 336 SGS--DRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
            G   DR+  IW+   I       D D G+    M+
Sbjct: 451 GGGTVDRKLKIWN---INTSTKTSDIDTGSQVCNMV 483

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 93/212 (43%), Gaps = 22/212 (10%)

Query: 151 ANSNIIATINGKGTISIF-----DRTLE----ESKAQVSTLAFHKENGYGLAFNPHISGE 201
           A++  I  I+  GT S F     D  L+     +  Q STL  H  +     ++P + G 
Sbjct: 165 AHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLTGHHWDVRSCDWHPTM-GL 223

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           + SGS D  + LWD  + +   +IL     I++  K+   + N+   +S+DK+ +V D R
Sbjct: 224 IASGSKDNLIKLWDPRSGQCISTILGCKHTIIS-TKFQPTKGNMLAVISKDKSCRVFDIR 282

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSG------ 315
             ++ +      S + +L++   + ++      D  +  +D+  M  P    SG      
Sbjct: 283 QNMKELAVYRDESDYMSLTWHPINESIFTVGCYDGSMKHFDL--MQEPQDSSSGCFHNIP 340

Query: 316 --HQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
             H   +T++ ++P    I+ S+  DR    W
Sbjct: 341 YAHDKCITSLAYNP-VGHILASASKDRTIRFW 371

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 64/334 (19%), Positives = 127/334 (38%), Gaps = 67/334 (20%)

Query: 129 SSFAIANKFPHIEEVIRARYMPANSNIIATINGK-----GTISIFDRTLEESKAQVSTLA 183
           SS  + +  P +E     R +     ++AT +G+     G+   F+  ++   + VS + 
Sbjct: 78  SSNKVKHVIPALEWTPEGRRL-----VVATYSGEFSLWNGSTFNFESIMQAHDSAVSVMT 132

Query: 184 FHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFES 243
           +            H    L+SG  D T+ +W        K +  +H   +  + +   +S
Sbjct: 133 YS-----------HAGDWLISGDSDGTIKIWQ-PNFNMVKVLDEAHTQCIRGISFSGTDS 180

Query: 244 NVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKH-SRNLLAAAGVDSQIYLYD 302
             F T S+D  L++ +     +  +   T   ++  S   H +  L+A+   D+ I L+D
Sbjct: 181 K-FVTCSDDNILKIWNFSNGQQ--ESTLTGHHWDVRSCDWHPTMGLIASGSKDNLIKLWD 237

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQS--QDDAD 360
            R     +  + G + ++ + +F P    ++     D+   ++D+ Q   E +  +D++D
Sbjct: 238 PRSGQC-ISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKELAVYRDESD 296

Query: 361 D---------------GAPELMMMH-------------------AGHRSPVNEFSFNPQI 386
                           G  +  M H                     H   +   ++NP +
Sbjct: 297 YMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSSSGCFHNIPYAHDKCITSLAYNP-V 355

Query: 387 PWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420
             +LAS  +D  I+ W  S  L    P A  DP+
Sbjct: 356 GHILASASKDRTIRFWTRSRPL---DPNAFDDPT 386

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 63/128 (49%), Gaps = 8/128 (6%)

Query: 225 ILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNT----LS 280
           +L  H   + D+ +H     +  T S D  +   D R      +   +AS ++     + 
Sbjct: 109 VLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMR---SSRRAFYSASVWSAGAAQVK 165

Query: 281 FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR 340
           ++  + N++A+A   + I+++D+R    PLH++ GH +SV +++FS   +  I SS +D 
Sbjct: 166 WNFKNPNVMASAH-SNDIFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDG 224

Query: 341 RAIIWDLT 348
               WD +
Sbjct: 225 TVKFWDYS 232

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 68/131 (51%), Gaps = 19/131 (14%)

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRD-MSSP--LHVMSGHQDSVTTVEFSPH-TDG 331
           FN +S S   R+++ A+     +Y+ D+ D  S+P  LH ++  +  V  V++SPH +  
Sbjct: 27  FNAVSISPSGRDVVLAS--RQGLYVVDLDDPFSAPRWLHHITPWE--VADVQWSPHPSKP 82

Query: 332 IICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLA 391
               S S+++A++W+L++  +   +           ++H GH   + + +F+P  P +LA
Sbjct: 83  SWVVSTSNQKALVWNLSRSSSNAVEH----------VLH-GHSRAITDINFHPTNPEILA 131

Query: 392 STEEDNVIQAW 402
           +   D  + AW
Sbjct: 132 TCSIDAYVHAW 142

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 74/160 (46%), Gaps = 6/160 (3%)

Query: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI-VNDVKWHEFESNVFGTVS 250
           LA N H    L S S D TV LWD+      +S+ + H    V+  +WH+   +V  T  
Sbjct: 294 LALNKHFRAVLASTSADHTVKLWDLNNGTAARSLASIHSGKNVSSSEWHKTNGSVLLTSG 353

Query: 251 EDKTLQVHDKRVRLEP-VKKLPTASPFNTLSFSKHSRNLLAAAGVDS-QIYLYDMRDMSS 308
            D  + + D R+  E  + K  +  P   +  S  +   +  +G DS  +Y +D+R+ S 
Sbjct: 354 YDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSGNVYAFDIRNNSG 413

Query: 309 --PLHVMSGHQDSVTTVEFSPHTDGIICSSG-SDRRAIIW 345
             P+  ++ H   ++ +  + +  G++ +S   D+   +W
Sbjct: 414 SKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTVKLW 453

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 112/246 (45%), Gaps = 35/246 (14%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELL 203
           IR+     +   +AT      I I++  ++E K  V  L  H+++ Y L + P    +L+
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWN--IKERKI-VMVLKGHEQDIYSLDYFPD-GQKLV 399

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           SGS D ++ +WD++  +   S+  S +D V  V     E  +    S D+++++ D    
Sbjct: 400 SGSGDRSIRIWDLKTGQ--CSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTG 457

Query: 264 LEPVKKLPT--------ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMS- 314
              V++L +             +++F+K  +++++ + +D  + L+++ D  S       
Sbjct: 458 FL-VERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGS-LDRTVKLWNLGDTQSGTGKCEV 515

Query: 315 ---GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHA 371
              GH+D V +V  S + D  I S   DR  IIW            D D G P LM+   
Sbjct: 516 TYIGHKDFVLSVATS-NDDKYIFSGSKDRGVIIW------------DKDSGNPILMLQ-- 560

Query: 372 GHRSPV 377
           GHR+ V
Sbjct: 561 GHRNSV 566

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVN 234
           S ++V ++ F  +N + L   P  +  LL+   + +V L D    K+   I      I +
Sbjct: 2   SYSKVDSINFGADN-WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISD 60

Query: 235 DVKWHEFESNVF--GTVSEDKTLQVHDKRVRLEPVKKLPT--ASPFNTLSFSKHSRNLLA 290
            V  +   +N F   T +ED ++++ D R   + V  L    ++PF +L  S+H   +LA
Sbjct: 61  MVVLNNDRNNGFLIATAAED-SVKIFDLRSS-DTVATLKNEKSAPFLSLD-SRHG--MLA 115

Query: 291 A----AGVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
                +GVD+++++YDM+    PL  ++  H D +T ++F P    ++ S  +D    I+
Sbjct: 116 CGTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIY 175

Query: 346 DLTQ 349
           DLTQ
Sbjct: 176 DLTQ 179

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 120/288 (41%), Gaps = 49/288 (17%)

Query: 144 IRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE-L 202
           IR+     +   +AT      I I+D  +++ K  V  L  H ++ Y L + P  SG+ L
Sbjct: 386 IRSVCFSPDGKFLATGAEDKLIRIWD--IQQRKI-VMVLQGHDQDVYSLDYFP--SGDKL 440

Query: 203 LSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRV 262
           +SGS D TV +WD++  +   S+  S +D V  V     +       S D+ ++V D   
Sbjct: 441 VSGSGDRTVRIWDLKTGQ--CSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSET 498

Query: 263 -----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMS- 314
                RL+   +L T    +  S  F+K   N + +  +D  + L+++RD ++     + 
Sbjct: 499 GFLVERLDSENELGTGHKDSVYSVVFTKDG-NKVVSGSLDRSVKLWNLRDNNANSSSNNS 557

Query: 315 ------------GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG 362
                       GH+D V +V  + + D  I S   DR  + W            D   G
Sbjct: 558 NKSNATCDVTYVGHKDFVLSVTTTAN-DEYILSGSKDRGVLFW------------DTKSG 604

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPW-----LLASTEEDNVIQAWKVS 405
            P LM+   GHR+ V   +   + P      + A+   D   + WK S
Sbjct: 605 NPLLMLQ--GHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKFS 650

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 84/216 (38%), Gaps = 56/216 (25%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           IA     G I I+D T    +  + TL+ H +    L++N HI   L SGS D T+   D
Sbjct: 483 IAIGQSNGIIEIYDVT---KRKCIRTLSGHTDRTACLSWNSHI---LTSGSRDRTILHRD 536

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +         + SH   V  +KW+E                                   
Sbjct: 537 VRMKDPFFERIKSHTQEVCGLKWNE----------------------------------- 561

Query: 276 FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICS 335
                    S N L + G D+ + +YD   M +PL  +  H  +V  + +SPH  GI+ +
Sbjct: 562 ---------SDNKLVSGGNDNTVNIYDG-CMPTPLLTLDEHTAAVKALAWSPHKRGILAT 611

Query: 336 SG--SDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
            G  +DR+  IW+   I +    ++ D G+    M+
Sbjct: 612 GGGTADRKLKIWN---INSSVKVNEVDTGSQVCNMI 644

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 103/261 (39%), Gaps = 69/261 (26%)

Query: 165 ISIFDRTLEESKAQVSTL--AFHKENG--YGLAFNPHISGELLSGSDDTTVALWDIEAAK 220
           +++F  T++    ++ TL   F    G   GL F+P      +S  DD T+ +W ++   
Sbjct: 28  VALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHP-TQPIFVSAGDDYTIKVWSLDT-N 85

Query: 221 KPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS 280
           K    LT H D V  V +H  E     + S+D+T+++ + + R E               
Sbjct: 86  KCLYTLTGHLDYVRTVFFHR-ELPWIISASDDQTIRIWNWQNRKE--------------- 129

Query: 281 FSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDR 340
                                        +  ++GH   V   +F P TD +I S+  D 
Sbjct: 130 -----------------------------IACLTGHNHFVMCAQFHP-TDDLIVSASLDE 159

Query: 341 RAIIWDLT----------------QIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNP 384
              IWD++                Q+ A+Q+  D   G   +  +  GH   VN  SF+P
Sbjct: 160 TIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHP 219

Query: 385 QIPWLLASTEEDNVIQAWKVS 405
            +P L+ S  +D  ++ W++S
Sbjct: 220 TLP-LIVSGSDDRQVKLWRMS 239

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 102/246 (41%), Gaps = 52/246 (21%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           V T+ FH+E  +           ++S SDD T+ +W+ +  +K  + LT H+  V   ++
Sbjct: 98  VRTVFFHRELPW-----------IISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQF 145

Query: 239 HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF--------NTLSFS-------- 282
           H  + ++  + S D+T+++ D    L      P  S F        N L  S        
Sbjct: 146 HPTD-DLIVSASLDETIRIWDIS-GLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKF 203

Query: 283 ---KHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVEFSP 327
               H+R            L+ +   D Q+ L+ M    +  +    GH ++V +V F P
Sbjct: 204 ILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHP 263

Query: 328 HTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVNEFS 381
           H + +I S G D+   +WDL  +   +Q + + D        P + +  A H S +  F 
Sbjct: 264 HQN-LIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFK 322

Query: 382 FNPQIP 387
            + + P
Sbjct: 323 LDRERP 328

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++SGSDD  V LW + A K         H + V+ V +H  + N+  +V EDKTL+V D 
Sbjct: 224 IVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTLRVWDL 282

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
             R  PVK+    +    L  +    NL  AA  DS I ++ + D   P   +  HQ+ +
Sbjct: 283 DKR-TPVKQFKRENDRFWLIAAHPHINLFGAAH-DSGIMVFKL-DRERPCSFI--HQNQL 337

Query: 321 TTV 323
             V
Sbjct: 338 FFV 340

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 75/189 (39%), Gaps = 21/189 (11%)

Query: 187 ENGY-GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNV 245
           ENG   L F P      LSG +D  + +WD+   ++       H   + D  +   +S  
Sbjct: 178 ENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHDRRLLRDFCGHQKPIRDFNFTT-DSKQ 236

Query: 246 FGTVSEDKTLQVHD-------KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQI 298
           F +VS DK L++ D        R +L  V    T  P N           L    ++S+I
Sbjct: 237 FTSVSYDKFLKIWDTEKGAIIHRTKLTSVPNCVTFHPINNYE--------LVVGLLNSEI 288

Query: 299 YLYDMRD--MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD-LTQIGAEQS 355
             YD RD   +  +     H  S+  ++F P+    I SS  D+   IWD    I  +Q 
Sbjct: 289 KHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFI-SSSEDKTIRIWDNQINIPIKQI 347

Query: 356 QDDADDGAP 364
            D A    P
Sbjct: 348 SDTAQHSMP 356

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 14/93 (15%)

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           ++V  GH++  T ++F P +  +  S G+D +  IWDL                  L+  
Sbjct: 171 INVYDGHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYH-------------DRRLLRD 217

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
             GH+ P+ +F+F         S   D  ++ W
Sbjct: 218 FCGHQKPIRDFNFTTDSK-QFTSVSYDKFLKIW 249

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 91/180 (50%), Gaps = 20/180 (11%)

Query: 188 NGYGLAFNPHISGELLSGSDDTTVALWDIEAAK---KPKSILTSHDD--IVNDVKWHEFE 242
           N + L F P  +  LL+   +  +++ D +  +   K K   TS +D  IVN+     + 
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNN----NYN 69

Query: 243 SNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSRNLLAA----AGVDS 296
                  + +++++++D +   + +K +     SPF +L  S H  N++A     +GVD+
Sbjct: 70  GGSLMVTATNESVKIYDLKSN-DCIKTITNEKNSPFLSLD-SLH--NMMACGTELSGVDA 125

Query: 297 QIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQS 355
           ++Y+YD+R   +P+   +  H D +T ++F P+   ++ S  +D    I+DLT+   E S
Sbjct: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI-VNDVKWHEFES 243
           H +    L+ N H    L S S D TV LWD+      +SI + H++  V+  +WH  + 
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNGIAARSIASIHNNKNVSSSQWHSTDG 337

Query: 244 NVFGTVSEDKTLQVHDKRV----RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIY 299
           ++  T   D  + V D R+     +     +       ++ F+  S N++        +Y
Sbjct: 338 SILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDSGNVY 395

Query: 300 LYDMR--DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IW 345
            +D+R  + S PL  +  H   +++++ + H   ++ +S    + + +W
Sbjct: 396 SFDIRNGEGSKPLWTLKAHDAGISSLDVNQHVPNMLATSAMGEKVVKLW 444

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (58%), Gaps = 8/87 (9%)

Query: 274 SPFNTLSFSKHSRNLLAA----AGVDSQIYLYDMRDMSSPLHVM-SGHQDSVTTVEFSPH 328
           +PF +L  S+H   +LA     +GVD++I++YD+R+   P+ ++   H D VT ++F P 
Sbjct: 105 TPFLSLD-SRHG--MLACGTELSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPS 161

Query: 329 TDGIICSSGSDRRAIIWDLTQIGAEQS 355
              ++ S  +D    ++DLTQ+  E +
Sbjct: 162 DPNVLLSGSTDGYTNVYDLTQVEEEDA 188

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 199 SGELLSGSDDTTVALWDIEAAKKPKSILT-SHDDIVNDVKWHEFESNVFGTVSEDKTLQV 257
            G  LSG D   + ++DI    KP  +L  SH D V D+K+H  + NV  + S D    V
Sbjct: 119 CGTELSGVD-AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNV 177

Query: 258 HD 259
           +D
Sbjct: 178 YD 179

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 88/194 (45%), Gaps = 12/194 (6%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWD 215
           +A   G G + I+D      +  + TL+ H +    L++N HI   L SGS D  +   D
Sbjct: 306 LAVGQGNGLVEIYDIV---KRKCIRTLSGHMDRVACLSWNNHI---LTSGSRDRKILHRD 359

Query: 216 IEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASP 275
           +   +     + +H   V  +KW+  E N   +   D  + V+D   R   +K     + 
Sbjct: 360 VRMPEPYFEQVETHTQEVCGLKWNTDE-NRLASGGNDNVVYVYDGTSRKPTLKLAEHTAA 418

Query: 276 FNTLSFSKHSRNLLAAAG--VDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGII 333
              +++S H R +LA  G   D ++ ++++   +    + +G Q  V  + +S +T+ ++
Sbjct: 419 VKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQ--VCNMIWSKNTNELV 476

Query: 334 CSSGSDRRAI-IWD 346
            S G  R  + +WD
Sbjct: 477 TSHGYSRYNLTLWD 490

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 101/236 (42%), Gaps = 33/236 (13%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN--VFGT 248
           G+AF+P     +L     +T+ LWD        ++L   +D    V+  +F     +F +
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMG----TLLHRFEDHEGPVRGLDFHPTQPIFVS 70

Query: 249 VSEDKTLQVHDKRVRLEPVKKLPTASP---FNTLSFSKHSRNLLAAAGVDSQIYLYDMRD 305
             +D T++V      LE  K L T      +    F  H    + +A  D  I +++ ++
Sbjct: 71  AGDDYTIKVWS----LETNKCLYTLQGHLDYVRTVFFHHELPWIISASDDQTIRIWNWQN 126

Query: 306 MSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT----------------Q 349
               +  ++GH   V   +F P+ D ++ S+  D    +WD++                Q
Sbjct: 127 RKE-IACLTGHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKHSAPGTTSMEDQ 184

Query: 350 IGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           I A+ +  D   G   +  +  GH   VN  SF+P +P L+ S  +D  ++ W++S
Sbjct: 185 IAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMS 239

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 60/125 (48%), Gaps = 11/125 (8%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV--H 258
           ++SGSDD  V LW +   K         H + V+ V +H  + N+  +V EDKTL++   
Sbjct: 224 IVSGSDDRQVKLWRMSQTKAWEVDTCRGHTNNVDCVIFHPHQ-NLIISVGEDKTLRIWDL 282

Query: 259 DKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQD 318
           DKRV   PVK+         L  +  + NL  AA  D+ I ++ + D   P   +  HQ+
Sbjct: 283 DKRV---PVKQFKREHDRFWLIAAHPNINLFGAAH-DTGIMVFKL-DRERPCSFI--HQN 335

Query: 319 SVTTV 323
            +  +
Sbjct: 336 QLIFI 340

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 133/324 (41%), Gaps = 51/324 (15%)

Query: 121 EEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVS 180
           ++D  ND +SFA   +    +  IR+     +   +AT      I I+D      K  V 
Sbjct: 417 DDDYNNDANSFA-NTRTASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIA---QKKIVM 472

Query: 181 TLAFHKENGYGLAFNPHISGE-LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWH 239
            L  H+++ Y L + P  SG+ L+SGS D TV +WD+   +   S+  S +D V  V   
Sbjct: 473 VLQGHEQDIYSLDYFP--SGDKLVSGSGDRTVRIWDLRTGQ--CSLTLSIEDGVTTVAVS 528

Query: 240 EFESNVFGTVSEDKTLQVHDKRV-----RLEPVKKLPTASPFNTLS--FSKHSRNLLAAA 292
             +       S D+ ++V D        RL+   +L T    +  S  F++    +++ +
Sbjct: 529 LGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGS 588

Query: 293 GVDSQIYLYDMRDMSSPLHV------------MSGHQDSVTTVEFSPHTDGIICSSGSDR 340
            +D  + L+++    +  +              +GH+D V +V  +   D  I S   DR
Sbjct: 589 -LDRSVKLWNLSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVA-TTRNDEYILSGSKDR 646

Query: 341 RAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPV------NEFSFNPQIPWLLASTE 394
             + W            D   G P LM+   GHR+ V      N +   PQ   + A+  
Sbjct: 647 GVLFW------------DTKSGNPLLMLQ--GHRNSVISVAVANGYPLGPQY-CVFATGS 691

Query: 395 EDNVIQAWKVSMKLVNASPPAISD 418
            D   + WK +    +++ P + +
Sbjct: 692 GDCKARIWKYTTTGNDSNDPKVKE 715

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 70/150 (46%), Gaps = 6/150 (4%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           G ++SGS D  + LWD  + +   +IL     I+   K+   + N+   V++DK+ ++ D
Sbjct: 220 GLIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIK-TKFQPTKGNLLAVVAKDKSCKIFD 278

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDM---RDMSSPLH-VMSG 315
            R  ++ +K     S + +L++   + ++      D  +  +D+      S+  H +   
Sbjct: 279 IRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHDIPYA 338

Query: 316 HQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
           H   +T++ ++P    I+ S+  DR    W
Sbjct: 339 HDKCITSLSYNP-VGHILASASKDRTIRFW 367

>NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672
          Length = 431

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 21/201 (10%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+DTT+ +WD+ A  K K  L  H   V D+   +    +F + SEDK ++  D    
Sbjct: 137 TGSNDTTIKIWDL-AKGKLKVTLAGHIMTVRDIAISKRHPYLF-SASEDKLVKCWDLEKN 194

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
           +         S  +++     + +L+A AG DS + L+D+R   + + ++ GH++ +  V
Sbjct: 195 MAIRDYHGHLSGVHSVDIHP-TLDLIATAGRDSVVRLWDIRARVAVMTLI-GHKNPINKV 252

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
              P  D  I S  +D    +WD+               A + M +   H+  V   +F+
Sbjct: 253 HCLP-VDPQIVSCSTDATIRLWDIV--------------AGKSMKVITHHKKSVRNIAFH 297

Query: 384 PQIPWLLASTEEDNVIQAWKV 404
           P       S+   N I++WK+
Sbjct: 298 PTE--FSMSSCSANDIRSWKL 316

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 92/204 (45%), Gaps = 14/204 (6%)

Query: 150 PANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT 209
           P ++   AT +   TI I+D  L + K +V TLA H      +A +      L S S+D 
Sbjct: 129 PVDNEWFATGSNDTTIKIWD--LAKGKLKV-TLAGHIMTVRDIAISKR-HPYLFSASEDK 184

Query: 210 TVALWDIEAAKKPKSILTSHDDI--VNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
            V  WD+E   K  +I   H  +  V+ V  H    ++  T   D  +++ D R R+  +
Sbjct: 185 LVKCWDLE---KNMAIRDYHGHLSGVHSVDIHP-TLDLIATAGRDSVVRLWDIRARVAVM 240

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
             +   +P N +        +++ +  D+ I L+D+    S + V++ H+ SV  + F P
Sbjct: 241 TLIGHKNPINKVHCLPVDPQIVSCS-TDATIRLWDIVAGKS-MKVITHHKKSVRNIAFHP 298

Query: 328 HTDGIICSSGSDRRAIIWDLTQIG 351
               +   S +D R+  W L + G
Sbjct: 299 TEFSMSSCSANDIRS--WKLPEGG 320

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 40/91 (43%), Gaps = 15/91 (16%)

Query: 312 VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHA 371
           +++GH   V ++E  P  +    +  +D    IWDL +               +L +  A
Sbjct: 114 IINGHLGWVRSIEVDPVDNEWFATGSNDTTIKIWDLAK--------------GKLKVTLA 159

Query: 372 GHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
           GH   V + + + + P+L  S  ED +++ W
Sbjct: 160 GHIMTVRDIAISKRHPYLF-SASEDKLVKCW 189

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 109/271 (40%), Gaps = 38/271 (14%)

Query: 148 YMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSD 207
           + P NS I+A     G +  F     +S A++S    H      L FN      L SG  
Sbjct: 70  WSPDNS-ILAGALDNGIVEFFSPKELKSVAKISK---HTTPVNTLKFNAKQDNVLCSGDS 125

Query: 208 DTTVALWDIEAAKK-------PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
              + +WDI            P   +T  D++ + + W++  ++VF +        + D 
Sbjct: 126 RGEIFIWDINKITSSGYVPFSPGVAMTPIDEVYS-LAWNQSLAHVFASAGSSGYTSIWDL 184

Query: 261 RVRLEPVKKLPTASPF----NTLSF----SKHSRNLLAAAGVDSQ--IYLYDMRDMSSPL 310
           + + E V  L   SP     N LS       +S  +  A G D+   I ++D+R+  +PL
Sbjct: 185 KAKKE-VLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRNAKAPL 243

Query: 311 HVMS-GHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
             MS GH   + ++++    + ++ SSG D    +W+  Q   + SQ             
Sbjct: 244 QAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWN-PQTAQKLSQ------------- 289

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQ 400
                +   +  F P+ P L AS   DN IQ
Sbjct: 290 FPTRGNWCFKTKFAPEAPDLFASASLDNKIQ 320

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 70/151 (46%), Gaps = 12/151 (7%)

Query: 206 SDDTTVALWDIEAA--KKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           S ++T+ LW + +A  +KP+  +T+     ND+ W    S + G +  D  +        
Sbjct: 37  SSESTLELWSLLSADVEKPQGSITASAKF-NDLDWSPDNSILAGAL--DNGIVEFFSPKE 93

Query: 264 LEPVKKLPT-ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQ----- 317
           L+ V K+    +P NTL F+    N+L +     +I+++D+  ++S  +V          
Sbjct: 94  LKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTP 153

Query: 318 -DSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
            D V ++ ++     +  S+GS     IWDL
Sbjct: 154 IDEVYSLAWNQSLAHVFASAGSSGYTSIWDL 184

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 265 EPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVE 324
           +P   +  ++ FN L +S  + ++LA A  +  +  +  +++ S +  +S H   V T++
Sbjct: 54  KPQGSITASAKFNDLDWSPDN-SILAGALDNGIVEFFSPKELKS-VAKISKHTTPVNTLK 111

Query: 325 FSPHTDGIICSSGSDRRAIIWDLTQI 350
           F+   D ++CS  S     IWD+ +I
Sbjct: 112 FNAKQDNVLCSGDSRGEIFIWDINKI 137

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 72/173 (41%), Gaps = 7/173 (4%)

Query: 174 ESKAQVSTLAFHKENGYGLAFNPHISGELL-SGSDDTTVALWDIEAAKKPKSILTSHDDI 232
           ES+ ++     H +  Y L+F     G LL SG  D    +WD+   K   + L  H   
Sbjct: 305 ESETELQFQEGHGKEVYSLSFQN--DGALLCSGGLDNAAIVWDVRTGKSIMN-LQGHAKP 361

Query: 233 VNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAA 292
           +  V W     ++  T   D  + + D R   E  + L   +    + F K + + L + 
Sbjct: 362 IYSVDWSPDGYHI-ATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSC 420

Query: 293 GVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIW 345
           G D QI +Y   D    +  + GH D +  V+ S     +I SSG DR   +W
Sbjct: 421 GYDKQIRIYS-SDNWIQVKTLEGHTDKILDVDISEDAQ-LIVSSGWDRSLKLW 471

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 74/181 (40%), Gaps = 37/181 (20%)

Query: 225 ILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKH 284
           +++  DD +  VK H F+ +V   + E   LQ H  RV                + F   
Sbjct: 244 LVSGADDCL--VKIHSFDPDV-KIIKELTALQGHTGRVV--------------NVDFHPS 286

Query: 285 SRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDG-IICSSGSDRRAI 343
            R  +A+A  D    L+D+ +  + L    GH   V ++ F    DG ++CS G D  AI
Sbjct: 287 GR-FVASASFDMTWRLWDI-ESETELQFQEGHGKEVYSLSF--QNDGALLCSGGLDNAAI 342

Query: 344 IWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
           +WD+                 + +M   GH  P+    ++P   + +A+   D VI  W 
Sbjct: 343 VWDVR--------------TGKSIMNLQGHAKPIYSVDWSPD-GYHIATGGGDGVINIWD 387

Query: 404 V 404
           +
Sbjct: 388 I 388

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 86/209 (41%), Gaps = 11/209 (5%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI-VNDVKWHEFES 243
           H +    L+ N H    L S S D TV LWD+ +    +S+ + H++  V+  +WH    
Sbjct: 288 HTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSGNAARSMASIHNNKNVSSSQWHHGNG 347

Query: 244 NVFGTVSEDKTLQVHDKRV----RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIY 299
           ++  T   D  + + D R+     +     +       T+ F+    N++ A      IY
Sbjct: 348 SILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENIILAGTDSGNIY 405

Query: 300 LYDMRDM--SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQD 357
            +D+R+   S P+  +  H   ++++  +    G++ +     +A+   L +     SQ 
Sbjct: 406 SFDIRNNAGSKPVWTLKAHDAGISSLSVNNFIPGLMSTGAMGEKAV--KLWKFPTGDSQA 463

Query: 358 DADDGAPELMMMHAGHRSPVNEFSFNPQI 386
           D     P +++        V   SF P I
Sbjct: 464 DGSMKGPNMVLSRDFDVGNVLTTSFAPDI 492

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 90/201 (44%), Gaps = 21/201 (10%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+DTT+ +WD+ A+ K K  L+ H   V D+        +F + SEDK  +  D    
Sbjct: 129 TGSNDTTIKIWDL-ASGKLKITLSGHAMTVRDIAISNRHPYLF-SASEDKLAKCWDLEKN 186

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                     S  +T+     + +L+A AG DS + L+D+R    P+  + GH+  +  V
Sbjct: 187 TAIRDYHGHLSGVHTVDIHP-TLDLIATAGRDSVVKLWDIRS-RVPVVTLIGHKSPINKV 244

Query: 324 EFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFN 383
              P    +I SS  D    +WD+              G    ++ H  H+  + + +F+
Sbjct: 245 HCLPVNPQVI-SSSVDATIRLWDIVA------------GKASKVLTH--HKRSIRDIAFH 289

Query: 384 PQIPWLLASTEEDNVIQAWKV 404
           P    +  +  +D  I++WK+
Sbjct: 290 PSEFSMATACTDD--IRSWKL 308

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 32/163 (19%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHK---ENGYGLAFNPHISGELLSGSDDTT 210
           ++IAT      + ++D     S+  V TL  HK      + L  NP    +++S S D T
Sbjct: 209 DLIATAGRDSVVKLWD---IRSRVPVVTLIGHKSPINKVHCLPVNP----QVISSSVDAT 261

Query: 211 VALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKL 270
           + LWDI A K  K +LT H   + D+ +H  E ++    ++D         +R     KL
Sbjct: 262 IRLWDIVAGKASK-VLTHHKRSIRDIAFHPSEFSMATACTDD---------IR---SWKL 308

Query: 271 PTASPFNTLSFSK---------HSRNLLAAAGVDSQIYLYDMR 304
           P  S       SK         +  N+L A G +  +  YD +
Sbjct: 309 PEGSLLTNFEASKVGIINCLSINQDNVLFAGGDNGALSFYDYK 351

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 38/93 (40%), Gaps = 15/93 (16%)

Query: 310 LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           + V+ GH   V  V+  P  +    +  +D    IWDL               + +L + 
Sbjct: 104 MRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDL--------------ASGKLKIT 149

Query: 370 HAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAW 402
            +GH   V + + + + P+L  S  ED + + W
Sbjct: 150 LSGHAMTVRDIAISNRHPYLF-SASEDKLAKCW 181

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 96/219 (43%), Gaps = 8/219 (3%)

Query: 142 EVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGE 201
           E IR     +N +   T +    + I++ +   +  Q   L+ H  +     ++P + G 
Sbjct: 180 ESIRDMAFSSNDSKFVTCSDDNILKIWNFS---NGKQERVLSGHHWDVKSCDWHPEM-GL 235

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           + S S D  V LWD  +     SIL     ++   ++   + N+   +S+DK+ +V D R
Sbjct: 236 IASASKDNLVKLWDPRSGNCISSILKFKHTVLK-TRFQPTKGNLLMAISKDKSCRVFDIR 294

Query: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD-MRDMSSP-LHVMSGHQDS 319
             ++ +  +   + + TL +   + ++   A  D  +  +D ++D++ P L +   H   
Sbjct: 295 YSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQDLNEPILTIPYAHDKC 354

Query: 320 VTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDD 358
           +T++ ++P    I  ++  DR    W   +     + DD
Sbjct: 355 ITSLSYNP-VGHIFATAAKDRTIRFWTRARPTDPNAYDD 392

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 97/238 (40%), Gaps = 19/238 (7%)

Query: 183 AFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFE 242
           A H E+   +AF+ + S + ++ SDD  + +W+    K+ + +L+ H   V    WH  E
Sbjct: 176 AAHTESIRDMAFSSNDS-KFVTCSDDNILKIWNFSNGKQER-VLSGHHWDVKSCDWHP-E 232

Query: 243 SNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYD 302
             +  + S+D  +++ D R        L          F     NLL A   D    ++D
Sbjct: 233 MGLIASASKDNLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFD 292

Query: 303 MRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG 362
           +R     L  +    D + T+E+ P  + +   +  D     +DL Q          D  
Sbjct: 293 IRYSMKELMCVRDETDYM-TLEWHPINESMFTLACYDGSLKHFDLLQ----------DLN 341

Query: 363 APELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420
            P L + +A H   +   S+NP +  + A+  +D  I+ W    +     P A  DP+
Sbjct: 342 EPILTIPYA-HDKCITSLSYNP-VGHIFATAAKDRTIRFW---TRARPTDPNAYDDPT 394

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 88/181 (48%), Gaps = 15/181 (8%)

Query: 174 ESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDT-TVALWDIEAAKKPKSILTSHDDI 232
            ++  + T +  K+  Y  +F     G+LL   D T  V+++D   +  P++IL S +  
Sbjct: 69  RTRQVIKTFSRFKDVVYSASFRS--DGKLLCAGDATGLVSVYD---SYNPRTILLSINAS 123

Query: 233 VNDV---KWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF-NTLSFSKHSRNL 288
            +     K+H  ++ +  T S+D+  ++ D     EP  +L  A+ +  TLSF   + +L
Sbjct: 124 THPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHL 183

Query: 289 LAAAGVDSQIYLYDMRDM-SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
           +A    D  I LYD R   S+P++ ++  Q     +  SP    I+   G++ +  +WDL
Sbjct: 184 VATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSP--TQIVSCGGNNFK--VWDL 239

Query: 348 T 348
           T
Sbjct: 240 T 240

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 57/137 (41%), Gaps = 18/137 (13%)

Query: 133 IANKFPHIEEVIRARYMPANSNIIATINGKGTISIFD----RTL----EESKAQVSTLAF 184
           +   F   ++V+ +    ++  ++   +  G +S++D    RT+      S        F
Sbjct: 73  VIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKF 132

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H ++   LA          + SDD    LWDI  A +P+  LT   D V  + +     +
Sbjct: 133 HTQDNKILA----------TASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPH 182

Query: 245 VFGTVSEDKTLQVHDKR 261
           +  T S D  ++++D R
Sbjct: 183 LVATGSYDGLIRLYDTR 199

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 93/194 (47%), Gaps = 23/194 (11%)

Query: 175 SKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSI------LTS 228
           S  +  T++F  +N + L   P  S  LLS   +  V L D  +    + I      +++
Sbjct: 2   SYTKCDTISFGSDN-WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 229 HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSR 286
              + NDV       N F T SED ++++ D R+  + V  +  A  SPF +L  S+H  
Sbjct: 61  LKVLDNDVD----SGNTFVTASED-SVKIFDLRLN-QCVATVQNAKNSPFISLD-SRHG- 112

Query: 287 NLLAA----AGVDSQIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRR 341
            +LA     +G D++I+LYD++ + +P+      H D +T ++F      ++ S  +D  
Sbjct: 113 -MLACGTELSGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGY 171

Query: 342 AIIWDLTQIGAEQS 355
             ++DL Q   E++
Sbjct: 172 VNVYDLKQQEEEEA 185

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 10/107 (9%)

Query: 164 TISIFDRTLEESKAQVSTLA----FHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA 219
           ++ IFD  L +  A V           ++ +G+       G  LSG+D   + L+D++  
Sbjct: 81  SVKIFDLRLNQCVATVQNAKNSPFISLDSRHGML----ACGTELSGTD-AEIHLYDLKKI 135

Query: 220 KKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLE 265
             P +S   SH D + D+K+H  + +V  + S D  + V+D + + E
Sbjct: 136 DAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 71/144 (49%), Gaps = 5/144 (3%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+DTT+ +WD+ AA K K  L  H   V D+   +    +F + SEDK ++  D    
Sbjct: 140 TGSNDTTIKIWDL-AAGKLKITLIGHVMSVRDIAISKRHPYMF-SASEDKLVKCWDLERN 197

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                     S  +T+     S +++A AG D+ + L+D+R  S  + V+ GH+  +  V
Sbjct: 198 TAIRDFHGHLSGVHTVDVHP-SLDIIATAGRDAVVRLWDIRSRSE-IMVLPGHKSPINKV 255

Query: 324 EFSPHTDGIICSSGSDRRAIIWDL 347
           +  P    II  SG D    +WD+
Sbjct: 256 KCLPVDPQIISCSG-DATVRLWDI 278

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 86/193 (44%), Gaps = 33/193 (17%)

Query: 154 NIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213
           +IIAT      + ++D     S++++  L  HK     +   P +  +++S S D TV L
Sbjct: 220 DIIATAGRDAVVRLWD---IRSRSEIMVLPGHKSPINKVKCLP-VDPQIISCSGDATVRL 275

Query: 214 WDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPT- 272
           WDI A K  K +LT H   + D+  H  E + F +VS +      D R    P  +L T 
Sbjct: 276 WDIIAGKASK-VLTHHSRNIRDLTLHPAEFS-FASVSTN------DVRSWKLPEGQLLTN 327

Query: 273 -----ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQ-DSVTTVEFS 326
                    NT+S +    N+L A G D  +  YD +         +GH+  S+ T E +
Sbjct: 328 FQSQNTGILNTVSINHD--NVLLAGGDDGTLCFYDYK---------TGHKYQSMMTTEVA 376

Query: 327 PHTD---GIICSS 336
              +    I+CS+
Sbjct: 377 GSLESERSILCST 389

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 80/166 (48%), Gaps = 10/166 (6%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H+ +     F+       ++GS DT +AL D+   +K ++    H  +VN V+     ++
Sbjct: 117 HRRSAAITTFDTLDDTRAVTGSSDTRLALVDLHTGRKLRN-FAGHTRVVNQVR--ALNTD 173

Query: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSR--NLLAAAGVDSQIYLYD 302
            F +VS+D  L++ D   +  PV ++ +  P  TL+ S  S   N+L  +G+D  I  YD
Sbjct: 174 RFASVSDDGALKIWDAHTK-SPVWQISSEFPLFTLTSSSSSSDDNILYTSGLDPVIRAYD 232

Query: 303 MRDMSSP--LHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWD 346
           +R  +     +  + H DSVT++  +   +  +CS   D    I D
Sbjct: 233 LRQNNGQELFNWSTPHTDSVTSIHINASRN--LCSLDFDNCIYISD 276

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 5/144 (3%)

Query: 204 SGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVR 263
           +GS+D T+ +W++ A+ K K  L +HD  V D+        +F +VSEDKT++  D    
Sbjct: 133 TGSNDKTIKIWNL-ASGKLKVTLKAHDMTVRDLAISNRHPYMF-SVSEDKTVKCWDLEKN 190

Query: 264 LEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTV 323
                     S  +T+     + +++  AG DS + ++D+R    P+  + GH+  +T V
Sbjct: 191 TAIRNYHGHLSGVHTVDIHP-TVDVVVTAGRDSVVKVWDIR-TRLPVMTLPGHKGPITKV 248

Query: 324 EFSPHTDGIICSSGSDRRAIIWDL 347
              P  D  + SS  D    +WDL
Sbjct: 249 RCLP-VDPQVISSSVDASIRLWDL 271

 Score = 36.6 bits (83), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 80/176 (45%), Gaps = 16/176 (9%)

Query: 156 IATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAF-NPHISGELLSGSDDTTVALW 214
            AT +   TI I++  L   K +V TL  H      LA  N H    + S S+D TV  W
Sbjct: 131 FATGSNDKTIKIWN--LASGKLKV-TLKAHDMTVRDLAISNRH--PYMFSVSEDKTVKCW 185

Query: 215 DIEAAKKPKSILTSHDDI--VNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPT 272
           D+E   K  +I   H  +  V+ V  H    +V  T   D  ++V D R RL PV  LP 
Sbjct: 186 DLE---KNTAIRNYHGHLSGVHTVDIHP-TVDVVVTAGRDSVVKVWDIRTRL-PVMTLPG 240

Query: 273 -ASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
              P   +        +++++ VD+ I L+D+    S + V++ HQ +V  +   P
Sbjct: 241 HKGPITKVRCLPVDPQVISSS-VDASIRLWDLVAGKS-MKVLTHHQRTVRDISVHP 294

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 110/266 (41%), Gaps = 47/266 (17%)

Query: 134 ANKFPHIEEVIRARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLA 193
           AN     +  IR+     +   +AT      I I+D      +  V  L  H+++ Y L 
Sbjct: 366 ANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIA---QRKIVMVLRGHEQDIYSLD 422

Query: 194 FNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDK 253
           +      +L+SGS D T+ +WD+   +   S+  S +D V  V       N     S D+
Sbjct: 423 Y-FQSGNKLVSGSGDRTIRIWDLHTGQ--CSLTLSIEDGVTTVAVSPGNGNYVAAGSLDR 479

Query: 254 TLQVHD-------KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDM 306
           T++V D       +R+  E    +       ++ F++  +N+++ + +D  + L+++R++
Sbjct: 480 TVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGS-LDRSVKLWNLRNI 538

Query: 307 ----SSPL--------HVMSGHQD---SVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIG 351
               +SP             GH+D   SVTT E     D  I S   DR  I WD     
Sbjct: 539 NGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTE----NDQYILSGSKDRGVIFWDKV--- 591

Query: 352 AEQSQDDADDGAPELMMMHAGHRSPV 377
                     G P LM+   GHR+ V
Sbjct: 592 ---------SGVPLLMLQ--GHRNSV 606

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 74/167 (44%), Gaps = 6/167 (3%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI-VNDVKWHEFES 243
           H +    LA N H    L S S D TV LWD+ +    +SI + H +  V+  +WH    
Sbjct: 285 HTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSGTAARSIASIHSNKNVSASEWHMSHG 344

Query: 244 NVFGTVSEDKTLQVHDKRVRLEP-VKKLPTASPFNTLSFSKHSRNLLAAAGVDS-QIYLY 301
           ++  T   D  L + D R+  E  + K  +      +  +  +   L   G DS  +Y +
Sbjct: 345 SILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFASENLILCGTDSGNVYSF 404

Query: 302 DMR--DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IW 345
           D+R  + S P+  +  H   ++T+  +    G++ +     +A+ +W
Sbjct: 405 DIRNNEGSKPVWTLKAHDAGISTLNCNKFIPGMMSTGAMGEKAVKLW 451

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 106/241 (43%), Gaps = 39/241 (16%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN--VFGT 248
           G+AF+P     +L     +T+ LWD        ++L  ++D    V+  +F     +F +
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMG----TLLHRYEDHEGPVRGIDFHPTQPLFVS 70

Query: 249 VSEDKTLQVHDKRVRLEPVKKLPTASP----FNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
             +D T++V      LE  K L T         T+ F K    +++A+  D  I +++ +
Sbjct: 71  AGDDYTIKVWS----LETNKCLYTLDGHLDYVRTVFFHKELPWIISASD-DQTIRIWNWQ 125

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ--------------- 349
           +    +  ++GH   V   +F P T+ +I S+  D    +WD+++               
Sbjct: 126 NRKE-IACITGHNHFVMCAQFHP-TEDLIVSASLDETVRVWDISKLREKHSAPGRSAMPT 183

Query: 350 -----IGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
                I A+Q+  D   G   +  +  GH   VN  SF+P +P L+ S  +D  ++ WK+
Sbjct: 184 SFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLP-LIVSGGDDRQVKLWKM 242

Query: 405 S 405
           S
Sbjct: 243 S 243

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 61/257 (23%), Positives = 109/257 (42%), Gaps = 54/257 (21%)

Query: 171 TLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHD 230
           TL+     V T+ FHKE  +           ++S SDD T+ +W+ +  +K  + +T H+
Sbjct: 90  TLDGHLDYVRTVFFHKELPW-----------IISASDDQTIRIWNWQN-RKEIACITGHN 137

Query: 231 DIVNDVKWHEFESNVFGTVSEDKTLQVHD-KRVRLEPVKKLPTASPFN------------ 277
             V   ++H  E ++  + S D+T++V D  ++R +      +A P +            
Sbjct: 138 HFVMCAQFHPTE-DLIVSASLDETVRVWDISKLREKHSAPGRSAMPTSFEEKIAAQQNLL 196

Query: 278 -------TLSF--SKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGH 316
                  T+ F    H+R            L+ + G D Q+ L+ M    +  L    GH
Sbjct: 197 DGGFGDCTVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLWKMSATKAWELDSCRGH 256

Query: 317 QDSVTTVEFSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMH 370
            ++V +V F P T  +I S G D+   +WDL  +   +Q + + D        P + +  
Sbjct: 257 TNNVDSVIFHP-TQNLILSVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPNINLFG 315

Query: 371 AGHRSPVNEFSFNPQIP 387
           A H S +  F  + + P
Sbjct: 316 AAHDSGIMIFKLDRERP 332

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 202 LLSGSDDTTVALWDIEAAKKPK-SILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++SG DD  V LW + A K  +      H + V+ V +H  + N+  +V EDKTL+V D 
Sbjct: 228 IVSGGDDRQVKLWKMSATKAWELDSCRGHTNNVDSVIFHPTQ-NLILSVGEDKTLRVWDL 286

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSV 320
             R  PVK+    +    L  +  + NL  AA  DS I ++ +     P  +   HQ+ +
Sbjct: 287 DKR-TPVKQFKRENDRFWLIAAHPNINLFGAAH-DSGIMIFKLDRERPPFAI---HQNML 341

Query: 321 TTV 323
             V
Sbjct: 342 YFV 344

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 102/233 (43%), Gaps = 31/233 (13%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVS 250
           G+AF+P     +L     +T+ LWD             H+  V  V +H  +  +F +  
Sbjct: 16  GIAFHPS-RPWVLVALFSSTIQLWDYRMGTLLHR-FEDHEGPVRSVDFHPTQP-IFVSGG 72

Query: 251 EDKTLQVHDKRVRLEPVKKLPTASP----FNTLSFSKHSRNLLAAAGVDSQIYLYDMRDM 306
           +D T++V      LE  K L T +       T+ F K    +++A+  D  I +++ ++ 
Sbjct: 73  DDYTIKVWS----LETNKCLYTLNGHLDYIRTVFFHKELPWIISASD-DQTIRIWNWQNR 127

Query: 307 SSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT----------------QI 350
              +  ++GH   V   +F P TD ++ S+  D    +WD++                Q+
Sbjct: 128 KE-IACLTGHNHFVMCAQFHP-TDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQM 185

Query: 351 GAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWK 403
            A+Q+  D   G   +  +  GH   VN  SF+P +P ++ S  +D  ++ WK
Sbjct: 186 AAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-MIVSGSDDRQVKLWK 237

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 96/246 (39%), Gaps = 52/246 (21%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           + T+ FHKE  +           ++S SDD T+ +W+ +  +K  + LT H+  V   ++
Sbjct: 98  IRTVFFHKELPW-----------IISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCAQF 145

Query: 239 HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFN-------------------TL 279
           H  +  V  + S D+T++V D    L      P  S F+                     
Sbjct: 146 HPTDDLVV-SASLDETIRVWDIS-GLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKF 203

Query: 280 SFSKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVEFSP 327
               H+R            ++ +   D Q+ L+      +  +    GH ++V  V F P
Sbjct: 204 ILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHP 263

Query: 328 HTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDADD-----GAPELMMMHAGHRSPVNEFS 381
            T   I S G D+   IWDL  +I  +Q + + D        P + +  A H + +  F 
Sbjct: 264 -TQKFILSVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINLFGAAHDAGIMVFK 322

Query: 382 FNPQIP 387
            + + P
Sbjct: 323 LDRERP 328

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++SGSDD  V LW   + K         H + V+ V +H  +  +  +V EDKTL++ D 
Sbjct: 224 IVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFIL-SVGEDKTLRIWDL 282

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQ 317
             R+ PVK+    +    L  S  + NL  AA  D+ I ++ + D   P +V+  +Q
Sbjct: 283 DKRI-PVKQFKRENDRFWLIASHPNINLFGAAH-DAGIMVFKL-DRERPCNVIYQNQ 336

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 102/249 (40%), Gaps = 58/249 (23%)

Query: 179 VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKW 238
           V T+ FH+E  +           ++S SDD T+ +W+ +  +K  + LT H+  V    +
Sbjct: 98  VRTVFFHRELPW-----------IISASDDQTIRIWNWQN-RKEIACLTGHNHFVMCADF 145

Query: 239 HEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLS------------------ 280
           H  E  V  + S D+T++V D    +  ++K  +A    TL                   
Sbjct: 146 HPTEDLVV-SASLDETVRVWD----ISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCV 200

Query: 281 ----FSKHSRN-----------LLAAAGVDSQIYLYDMRDMSS-PLHVMSGHQDSVTTVE 324
                  HSR            L+ + G D Q+ L+ M    +  +    GH ++V +V 
Sbjct: 201 VKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

Query: 325 FSPHTDGIICSSGSDRRAIIWDL-TQIGAEQSQDDAD-----DGAPELMMMHAGHRSPVN 378
           F PH + +I S G D+   +WDL  +   +Q + + D        P + +  A H S + 
Sbjct: 261 FHPHQN-LIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIM 319

Query: 379 EFSFNPQIP 387
            F  + + P
Sbjct: 320 VFKLDRERP 328

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 90/231 (38%), Gaps = 65/231 (28%)

Query: 191 GLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVS 250
           G+ F+P      +S  DD T+ +W ++  KK    L  H D V  V +H  E     + S
Sbjct: 58  GIDFHP-TQPLFVSAGDDYTIKVWSLDT-KKCLFTLNGHLDYVRTVFFHR-ELPWIISAS 114

Query: 251 EDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPL 310
           +D+T+++ + + R E                                            +
Sbjct: 115 DDQTIRIWNWQNRKE--------------------------------------------I 130

Query: 311 HVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLT----------------QIGAEQ 354
             ++GH   V   +F P T+ ++ S+  D    +WD++                QI A+Q
Sbjct: 131 ACLTGHNHFVMCADFHP-TEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQ 189

Query: 355 SQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVS 405
           +  D   G   +  +  GH   VN  SF+P +P L+ S  +D  ++ W++S
Sbjct: 190 NLLDGGFGDCVVKFILEGHSRGVNWASFHPTLP-LIVSGGDDRQVKLWRMS 239

 Score = 38.1 bits (87), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 202 LLSGSDDTTVALWDIEAAKK-PKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDK 260
           ++SG DD  V LW + + K         H + V+ V +H  + N+  +V EDKT++V D 
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQ-NLIISVGEDKTVRVWDL 282

Query: 261 RVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQ 317
             R  PVK+    +    L  +  + NL  AA  DS I ++ + D   P  V++ +Q
Sbjct: 283 DKR-TPVKQFKRENDRFWLVRAHPNINLFGAAH-DSGIMVFKL-DRERPCSVINQNQ 336

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 6/163 (3%)

Query: 200 GELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHD 259
           G ++SGS D  +  WD  +     ++L     I++  K+   + N+   +S+DKT +V+D
Sbjct: 220 GLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIIS-TKFQPKQGNLLSVISKDKTCKVYD 278

Query: 260 KRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSP----LHVMSG 315
            R + + +  +     + TL +      +      D  I  +D+   + P     ++   
Sbjct: 279 IRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHNIPYA 338

Query: 316 HQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDD 358
           H+  VT++ +SP    I+ S+  DR    W  ++     + DD
Sbjct: 339 HEKCVTSLAYSP-IGHIMASASKDRTIRFWTRSRAVDPNAFDD 380

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 94/236 (39%), Gaps = 17/236 (7%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H E    ++F+P    + +S SDD  + +W+    ++ + +L+ H   V    WH  +  
Sbjct: 164 HMECVREISFSP-TDQKFVSCSDDNVLKIWNFSNGQQER-VLSGHHWDVKSCDWHP-KMG 220

Query: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
           +  + S+D  ++  D R        L       +  F     NLL+    D    +YD+R
Sbjct: 221 LIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIR 280

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAP 364
             +  L  +    D + T+++ P  + +      D     +DL+Q   E   +      P
Sbjct: 281 QQAKELFSVRDDVDYM-TLQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHNIP 336

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420
                   H   V   +++P I  ++AS  +D  I+ W  S  +    P A  DP+
Sbjct: 337 ------YAHEKCVTSLAYSP-IGHIMASASKDRTIRFWTRSRAV---DPNAFDDPT 382

>NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.534
           YKL213C
          Length = 725

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 76/167 (45%), Gaps = 10/167 (5%)

Query: 181 TLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHE 240
           TL  H  N   L++  H+S  ++SGS DTT  +W I  A +    L  H   V D K   
Sbjct: 97  TLIGHHSNVCALSY-KHMSA-IISGSWDTTAKVW-INGALQWS--LEGHQASVWDAKIIS 151

Query: 241 FESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYL 300
            E N F T S D+T+++  +   L+    + +    N    S  S   +A    D  I +
Sbjct: 152 VEENTFITASADRTVKLWKENKLLKTFSGIHSDVIRNIEVLS--SGKEIATCSNDGTIKI 209

Query: 301 YDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDL 347
            D+    +   V+SGH+  V  V+ S   D ++ S G DR   IWD+
Sbjct: 210 SDLD--GNIKQVLSGHESFVYNVKLSKQGDKLV-SCGEDRSLRIWDI 253

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/243 (21%), Positives = 112/243 (46%), Gaps = 32/243 (13%)

Query: 171 TLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHD 230
           T E  K  V++++F ++N +           +++ S+D T+ +WD+ +   P++    H+
Sbjct: 90  TFEGHKGNVTSVSFQQDNKW-----------MVTSSEDGTIKVWDVRSPSVPRNY--KHN 136

Query: 231 DIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSR-NLL 289
             VN+V  H  +  +  +   D T+++ D        + +P     +  S S  S  ++L
Sbjct: 137 APVNEVVIHPNQGELI-SCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSML 195

Query: 290 AAAGVDSQIYLYDMRDMS-----SPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAII 344
            AA      Y+++M + +      P++  S H+D +T V  S     +   S +DR A I
Sbjct: 196 VAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCS-ADRTAKI 254

Query: 345 WDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKV 404
           W +      +++DD +     L     GH+  V + +F+    +L+ ++  D+ ++ W +
Sbjct: 255 WSVG-----ETEDDFN-----LETTLDGHQRWVWDCAFSADSAYLVTAS-SDHYVRLWDL 303

Query: 405 SMK 407
           S +
Sbjct: 304 STR 306

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 78/176 (44%), Gaps = 22/176 (12%)

Query: 202 LLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261
           L  G  +  V ++D+   KK    L+ H D V  + W+ +   V  + S D+ +   D R
Sbjct: 311 LAVGQGNGLVEIYDV-VKKKCIRTLSGHMDRVACLSWNNY---VLTSGSRDRRILHRDVR 366

Query: 262 V------RLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSG 315
           +      R+E   +      +N         N LA+ G D+ +++YD     +P+   + 
Sbjct: 367 IPDSYFERIEAHTQEVCGLKWNV------DDNKLASGGNDNMLFVYD-STARNPVLTFNE 419

Query: 316 HQDSVTTVEFSPHTDGIICSSG--SDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           H  +V  + +SPH  G++ S G  +DRR  +W+   +   Q   D D G+    M+
Sbjct: 420 HTAAVKAMAWSPHKRGVLGSGGGTADRRLKVWN---VNTSQKISDVDTGSQVCNMV 472

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 64/118 (54%), Gaps = 15/118 (12%)

Query: 249 VSEDKTLQVHDKRVR--LEPVKKLPTASPFNTLSFSKHSRNLLAA----AGVDSQIYLYD 302
           V+ + ++ + D R R  L  +K    A PF +L  S+H   +LA     +GVD+++++YD
Sbjct: 77  VASNDSVNILDVRSRDKLASLKNDKNA-PFLSLD-SRHG--MLACGTELSGVDAELHIYD 132

Query: 303 MRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDA 359
           +R+ S+P+   +  H D VT + F P    ++ S  +D    ++DL Q    Q +DDA
Sbjct: 133 VRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ----QEEDDA 186

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 199 SGELLSGSDDTTVALWDIEAAKKP-KSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQV 257
            G  LSG D   + ++D+     P +S + SH D V D+++H  + NV  + S D    V
Sbjct: 117 CGTELSGVD-AELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNV 175

Query: 258 HDKRVRLE 265
           +D + + E
Sbjct: 176 YDLKQQEE 183

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 92/224 (41%), Gaps = 57/224 (25%)

Query: 148 YMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSD 207
           +M A S++ A   G G + I+D T E+    + TL+ H +    L++N HI   L SGS 
Sbjct: 384 WMGAGSHL-AIGQGNGIVEIYDVTKEKC---IRTLSGHLDRVACLSWNNHI---LSSGSR 436

Query: 208 DTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPV 267
           D T+   D+  A      + +H+  +  +KW+  +                         
Sbjct: 437 DRTILHRDVRMADPFFEKIETHEQEICGLKWNTND------------------------- 471

Query: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327
                              N LA+ G D+ +++YD    + P   ++ H+ +V  + +SP
Sbjct: 472 -------------------NKLASGGNDNMVFVYDGTSRT-PFLSINEHKAAVKAMAWSP 511

Query: 328 HTDGIICSSG--SDRRAIIWDLTQIGAEQSQDDADDGAPELMMM 369
           H  GI+ + G  +DR   +W+   +      +D D G+    M+
Sbjct: 512 HKQGILATGGGTADRTLKMWN---VNTSVKLNDVDTGSQVCNMV 552

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 98/236 (41%), Gaps = 19/236 (8%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H E    +AF+ + S + ++ SDD  + +W+    ++ + +L+ H   V    WH  E  
Sbjct: 164 HTECIRDVAFSGNDS-KFVTCSDDNILKIWNFSNGQQER-VLSGHHWDVKSCDWHP-EMG 220

Query: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
           +  + S+D  +++ D RV       L          F     NLLAA   D    ++D+R
Sbjct: 221 LIASASKDNLVKLWDPRVGQCISTILKFKHTVLKTRFQPTGGNLLAAISKDKSCRVFDIR 280

Query: 305 DMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAP 364
                L V+    D +T + ++P  + ++  +  D           G+ +  D   D   
Sbjct: 281 HSLKELMVVRDEVDYMTLL-WNPINESMLTVACYD-----------GSLKDFDVVQDLKK 328

Query: 365 ELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVIQAWKVSMKLVNASPPAISDPS 420
            +  +   H   +   S+NP +  +LAS  +D  I+ W    +   + P A  DP+
Sbjct: 329 PVHTIPYAHDKCITSLSYNP-VGHILASASKDRTIRFW---TRARPSDPNAFDDPT 380

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 92/245 (37%), Gaps = 30/245 (12%)

Query: 172 LEESKAQVSTLAFHKENGYGLAFNPHISGELLS-GSDDTTVALWDIEAAKKPKSILTSHD 230
           L+ S   V    FH  N    +        L S G  D+ V +W ++       + +  D
Sbjct: 411 LQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQD 470

Query: 231 DIVNDVKWHEFESNVFGTV-----------SEDKTLQVHDKRVRLEPVKKLPTASPFNTL 279
           +  N+         V+ T            SEDKT+++         V       P   +
Sbjct: 471 ERSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDV 530

Query: 280 SFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSD 339
           +FS    +  A A  D    L+   D   PL + +GH + V TV F P+   +   S SD
Sbjct: 531 AFSPLG-HYFATASHDQTARLWSC-DHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGS-SD 587

Query: 340 RRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEEDNVI 399
           +   +WD++                + + +  GH +PV   + +P   W L++  ED +I
Sbjct: 588 KTCRMWDMS--------------TGDSVRLFLGHTAPVTATAVSPDGRW-LSTGSEDGII 632

Query: 400 QAWKV 404
             W +
Sbjct: 633 NVWDI 637

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 7/170 (4%)

Query: 185 HKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDIVNDVKWHEFESN 244
           H    + +AF+P +     + S D T  LW  +    P  I   H + V+ V +H   + 
Sbjct: 523 HNHPIWDVAFSP-LGHYFATASHDQTARLWSCDHIY-PLRIFAGHLNDVDTVSFHPNGTY 580

Query: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMR 304
           VF T S DKT ++ D          L   +P    + S   R  L+    D  I ++D+ 
Sbjct: 581 VF-TGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGR-WLSTGSEDGIINVWDI- 637

Query: 305 DMSSPLHVMSGH-QDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAE 353
                L  M GH +++V ++ +S     ++ S G+D    +WD+ +  AE
Sbjct: 638 GTGKRLKQMRGHGKNAVYSLSYSKEGH-VLVSGGADHSLRVWDVKKSTAE 686

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,502,522
Number of extensions: 2223916
Number of successful extensions: 10381
Number of sequences better than 10.0: 983
Number of HSP's gapped: 8774
Number of HSP's successfully gapped: 1772
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)