Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR016W6.10ON64059327750.0
SAKL0E00880g6.10ON63655120860.0
TBLA0G011106.10ON63856019820.0
Kpol_1045.776.10ON65056519720.0
TPHA0M002006.10ON63455819620.0
KLLA0D00836g6.10ON64055519600.0
TDEL0G046106.10ON63355419570.0
Kwal_56.223506.10ON65855319310.0
KLTH0C11528g6.10ON64255619220.0
ZYRO0F00484g6.10ON64355619200.0
NCAS0D021906.10ON64556018310.0
CAGL0A01067g6.10ON64155918040.0
KAFR0B065006.10ON63655917120.0
NDAI0I027506.10ON66357816480.0
KNAG0E027806.10ON65056514540.0
YPL263C (KEL3)6.10ON65157114090.0
Skud_16.146.10ON65257214080.0
Suva_16.426.10ON65457214030.0
Smik_6.4716.10ON65156813750.0
Kpol_1050.695.88ON10842531691e-11
NCAS0F005205.88ON10862641468e-09
YHR158C (KEL1)5.88ON11642641405e-08
Suva_15.3575.88ON11722641395e-08
YGR238C (KEL2)5.88ON8821961395e-08
Smik_8.2425.88ON11682641388e-08
Skud_8.2225.88ON11692641352e-07
KAFR0B043205.88ON9862551352e-07
Skud_7.5725.88ON8831941342e-07
ZYRO0B08228g5.88ON12932521342e-07
TDEL0G011205.88ON10092571333e-07
SAKL0H02618g5.88ON10852551314e-07
Kpol_1010.625.88ON9732601299e-07
Smik_16.685.88ON8941811289e-07
TPHA0H010805.88ON8282561271e-06
KLTH0C01474g5.88ON10562501253e-06
NDAI0D026005.88ON11672601253e-06
KNAG0K005605.88ON11042611243e-06
Kwal_14.10195.88ON9782581234e-06
Suva_7.5305.88ON8942001209e-06
KLLA0E15511g5.88ON9052511201e-05
CAGL0F07997g5.88ON9362531181e-05
CAGL0I02090g5.88ON11362591172e-05
TBLA0C065305.88ON11722851128e-05
Ecym_20615.88ON13622591121e-04
TPHA0A051705.88ON10162421111e-04
ADL149W5.88ON12112561064e-04
ZYRO0C03344g3.15ON658119960.006
TBLA0A043207.9ON838153890.046
TDEL0A003403.15ON677101860.097
KAFR0I029103.15ON691233850.11
NCAS0A076407.9ON91386800.56
KAFR0I002007.9ON75384790.62
CAGL0K02101g8.157ON163396790.72
ZYRO0C00550g7.9ON84871780.92
Kpol_538.457.9ON848159761.6
KAFR0C049107.9ON87876761.7
Suva_15.193.15ON708160716.6
KNAG0A011803.15ON67698706.8
YOR371C (GPB1)7.9ON897157708.3
Suva_8.4277.9ON89875699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR016W
         (640 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...  1073   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   808   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   768   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   764   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   760   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   759   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   758   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   748   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   744   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   744   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   709   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   699   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   664   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   639   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   564   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   547   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   546   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   545   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   534   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    70   1e-11
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    61   8e-09
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    59   5e-08
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    58   5e-08
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    58   5e-08
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    58   8e-08
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    57   2e-07
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    57   2e-07
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    56   2e-07
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    56   2e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    56   3e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    55   4e-07
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    54   9e-07
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    54   9e-07
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    54   1e-06
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    53   3e-06
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    53   3e-06
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    52   3e-06
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    52   4e-06
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    51   9e-06
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    51   1e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    50   1e-05
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    50   2e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    48   8e-05
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    48   1e-04
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    47   1e-04
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    45   4e-04
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    42   0.006
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    39   0.046
TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15 ...    38   0.097
KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {O...    37   0.11 
NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa] ...    35   0.56 
KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9 Y...    35   0.62 
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    35   0.72 
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    35   0.92 
Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {O...    34   1.6  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    34   1.7  
Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W (...    32   6.6  
KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15 Y...    32   6.8  
YOR371C Chr15 complement(1031489..1034182) [2694 bp, 897 aa] {ON...    32   8.3  
Suva_8.427 Chr8 complement(769308..772004) [2697 bp, 898 aa] {ON...    31   9.6  

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/593 (88%), Positives = 523/593 (88%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107
           IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT
Sbjct: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107

Query: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167
           HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS
Sbjct: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167

Query: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227
           DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI
Sbjct: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227

Query: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287
           TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK
Sbjct: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287

Query: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF
Sbjct: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 348 TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKT 407
           TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANL         KT
Sbjct: 348 TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLDDDDGDEDGKT 407

Query: 408 IEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM 467
           IEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM
Sbjct: 408 IEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM 467

Query: 468 IDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKL 527
           IDSFYSIDMNKVDGVKVYWEDMAAVERAKELG                      HSDRKL
Sbjct: 468 IDSFYSIDMNKVDGVKVYWEDMAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKL 527

Query: 528 VAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSD 587
           VA         DNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSD
Sbjct: 528 VAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSD 587

Query: 588 AKGKHLKKHSFDLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDFTKPTKRR 640
           AKGKHLKKHSFDLC                              DFTKPTKRR
Sbjct: 588 AKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/551 (70%), Positives = 443/551 (80%), Gaps = 6/551 (1%)

Query: 52  LANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYN 111
           LANFKR+Q +FE V V TV+RP +R +SS+VANPLH KREL+LFGGE TN +   T FYN
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYN 111

Query: 112 DLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DLF YSLD DQW+K +SQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL
Sbjct: 112 DLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171

Query: 172 FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYK 231
            DC T EWTKIEQKNGP++RSGHR+TVWKNY ILHGGFRDLGT TTYL+DCWLFDITTYK
Sbjct: 172 LDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYK 231

Query: 232 WQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           W+Q+ FP NHPIPDARSGHSL+PTP+GA+LWGGYCKVKAGKGLQKGKILTDCWYLKMKSD
Sbjct: 232 WKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291

Query: 292 VTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHI 351
           + AIRWERRKKQGFQPS R GCSMVHHKGRGILFGGV+D+EETEE L+S+FYNDLFT+ I
Sbjct: 292 IGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQI 351

Query: 352 ETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXX-KTIEE 410
           ETNRWYS SLR QR +  K+  K+NR+KDKELED+LN IL+KANL            + +
Sbjct: 352 ETNRWYSASLRPQRKA-AKATSKNNRNKDKELEDILNQILEKANLNDDENEKETIGDVLK 410

Query: 411 ELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDS 470
           EL++ ++D   E    KK YPI ++LPHPRFNASTA+VDDTLFIFGGVWE GEKDY IDS
Sbjct: 411 ELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDS 470

Query: 471 FYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKLVAX 530
           FY+ID+N++DG+K+YWED+  +E AKELG                       +D+KLVA 
Sbjct: 471 FYAIDLNRLDGIKIYWEDLRDIEMAKELGDEEEDFEDNEEDDEEDDDDEEEITDQKLVAE 530

Query: 531 XXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSDAKG 590
                   ++E  PEIPDPRPWLPHPK FE+LR FYVRTGA FLEWAI++      DA+G
Sbjct: 531 DDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNR----DARG 586

Query: 591 KHLKKHSFDLC 601
           KHLKK SFDLC
Sbjct: 587 KHLKKKSFDLC 597

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/560 (65%), Positives = 436/560 (77%), Gaps = 15/560 (2%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107
           IE++L NFK+QQ +FE +N+ETV +P +R +S +++NP+H K ELILFGGE T+ +T   
Sbjct: 49  IEDILENFKKQQEQFEKINIETVSKPTKRINSCMISNPIHGKNELILFGGENTSTTTT-- 106

Query: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167
            FYNDLF Y+ + DQWKKYTSQNSPMPRSS+A+ +HP+G+ L+HGGEFSSPKQNTFYHYS
Sbjct: 107 -FYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYS 165

Query: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227
           DTWL DCAT EW+K+E KNGPS+RSGHRMTVWKN+IILHGGFRDLGTSTTYL D WLFD+
Sbjct: 166 DTWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDV 225

Query: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287
           T YKW Q++FP NH IPDARSGHSL+PT +GA+LWGGYCKVKAGKGLQKGKIL+DCWYLK
Sbjct: 226 TKYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLK 285

Query: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           MKSDV+ IRWERRKKQGFQPS R GCSMVHHKGRGILFGGV+D+EETEE LDSLFYNDLF
Sbjct: 286 MKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345

Query: 348 TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKT 407
           TY IE NRW+S+S+R+QR   +K  PK+ +DK+KEL+D+LN+ILKK NL           
Sbjct: 346 TYQIEINRWFSLSMRSQRKKTIKIGPKTTKDKEKELQDILNSILKKNNL-TDDDSEDPNA 404

Query: 408 IEEELNKLENDGITETEETK-----KSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQG 462
           IEEEL K+ +D     +E+K     K Y ++ +LPH RFNA+TA+V+DTL+IFGG WE G
Sbjct: 405 IEEEL-KINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELG 463

Query: 463 EKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXH 522
           EKDY IDSFYSID+NK+DGV VYWEDM  +E AKELG                       
Sbjct: 464 EKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGEEEI 523

Query: 523 SDRKLVA-XXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNK 581
            D+KLVA           +E   EIPDPRPWLPHPK FE+LRAFYVRTGA+FLEWAI+N 
Sbjct: 524 VDQKLVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNN 583

Query: 582 HNTRSDAKGKHLKKHSFDLC 601
                D+KGKHLKK SF+L 
Sbjct: 584 R----DSKGKHLKKKSFELT 599

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/565 (64%), Positives = 431/565 (76%), Gaps = 18/565 (3%)

Query: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110
           VLANFK++Q  FE +N+E+VERP +R +  ++ NP H K ELILFGGE TN+ T  T F+
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFF 110

Query: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           NDL+ Y+ + DQW++YTS+NSPMPRSSAA+AAHPSGV LIHGGEFSSPKQNTFYHYSDTW
Sbjct: 111 NDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTW 170

Query: 171 LFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTY 230
           L DC+T EWTK+EQKNGPS+RSGHR+++WKNY +LHGGFRDLGTSTTYLNDCWLFDIT Y
Sbjct: 171 LLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNY 230

Query: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS 290
           KW+Q++FP NHPIPDARSGHS +PT EGA+LWGGYCKVKAGKGLQKGKILTDCWYLKMK+
Sbjct: 231 KWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKA 290

Query: 291 DVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYH 350
           D TAIRWERRKKQGFQPS R GCSMVHHKGRGILFGGVYD+EETEE LDS+FYNDLF+Y 
Sbjct: 291 DPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQ 350

Query: 351 IETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLX----XXXXXXXXK 406
           IE NRW+++ LR QR   V+   KS++DK+KEL+D+LN IL+KANL             K
Sbjct: 351 IEINRWFALQLRPQRKKVVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAK 410

Query: 407 TIEEELNKLENDGI------TETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWE 460
            IE EL++ ++D         E  + KK Y ++ +LPHPRFNA+  +V+DTLFI+GGVWE
Sbjct: 411 AIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWE 470

Query: 461 QGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXX 520
            GEKDY IDSFYSID+N+ DGV V WED++ +E AKE G                     
Sbjct: 471 LGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSDDEDDGE 530

Query: 521 XH-SDRKLVAXXXXXXXXXDNEILP---EIPDPRPWLPHPKAFESLRAFYVRTGASFLEW 576
               D+KLVA         + E      EIPDP PWLPHPK FESLR FYVRTGA+FLEW
Sbjct: 531 EEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEW 590

Query: 577 AITNKHNTRSDAKGKHLKKHSFDLC 601
           AI+N      DA+GKHLKK SFDLC
Sbjct: 591 AISNNR----DARGKHLKKKSFDLC 611

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/558 (64%), Positives = 435/558 (77%), Gaps = 21/558 (3%)

Query: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110
           VLANFK++Q +FE +NVE+V++P +R +S ++ANP H K+EL+LFGGE T+Q  G+THFY
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFY 111

Query: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           NDL+ ++ D D WKK TSQNSPMPRSSAA+AAHPSG+ L+HGGEFSSPKQNTFYHYSDTW
Sbjct: 112 NDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 171

Query: 171 LFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTY 230
           L DC T EWTK+EQKNGPS+RSGHR+TVWKNY ILHGGFRDLG++T+YLND WLFDIT+Y
Sbjct: 172 LLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSY 231

Query: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS 290
           KW+Q++FP NHP+PDARSGHSL+PT EGA+LWGGYCKVKAGKGLQKGKIL DCWYLKMK+
Sbjct: 232 KWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKA 291

Query: 291 DVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYH 350
           D +A+RWERRKKQGFQPS R GCSMVHHKGRGILFGGVYD+EETEE LDS+FYNDLF+Y 
Sbjct: 292 DPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQ 351

Query: 351 IETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKTIEE 410
           IE+NRWY++ LR+QR   V+   KS+++K+ EL+++LN IL+KANL         K  +E
Sbjct: 352 IESNRWYALQLRSQRKKVVRLNNKSSKEKELELQNILNEILEKANL---------KDDDE 402

Query: 411 ELNKLEN-------DGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGE 463
           + N+L N             + +KK Y +  +LPH RFNAST +VDDTLFI+GGVWE GE
Sbjct: 403 DANELSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGE 462

Query: 464 KDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHS 523
           KDY IDS YSID+NK+DGV VYWE++  +E+AKELG                        
Sbjct: 463 KDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGAINSDEEDEEDEDDEDDDEEET-V 521

Query: 524 DRKLVAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHN 583
           D+KLVA         ++    EIPDPRPWLPHPKAFESLR FYVRTGASFLEWAI+N  +
Sbjct: 522 DQKLVAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKH 581

Query: 584 TRSDAKGKHLKKHSFDLC 601
           TR    GKHLK  SF+LC
Sbjct: 582 TR----GKHLKTKSFELC 595

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/555 (66%), Positives = 427/555 (76%), Gaps = 9/555 (1%)

Query: 52  LANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYN 111
           LANFKR+Q  FE +NVE V+RP QR +  +  NP H KREL++FGGE T Q TG THFYN
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYN 110

Query: 112 DLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL 171
           DLF+YSLDTD WK+YTSQNSPMPRSSAA+A+HP+GV LIHGGEFSSPKQNTFYHYSD+WL
Sbjct: 111 DLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWL 170

Query: 172 FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYK 231
           FDC++ EWTK+EQKNGPS+RSGHRM +WKN+IILHGGFRDLGTSTTYLND W+FDIT YK
Sbjct: 171 FDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYK 230

Query: 232 WQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSD 291
           W+Q++ PANHPIPDARSGHSL+ T EGA+L+GGY KVKAGKGLQKGKIL+DCWYLKMKSD
Sbjct: 231 WKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSD 290

Query: 292 VTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHI 351
           + +IRWERRKKQG QPS R GCSMVHHKGRG+LFGGVYD+EETEE L S+FYN+L+TY I
Sbjct: 291 LGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQI 350

Query: 352 ETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKTIEEE 411
           E NRWY++SLR QR  K     KSNR+KDKELED+LN IL KANL         K IEE+
Sbjct: 351 ENNRWYAMSLRPQRKKKNFVQSKSNRNKDKELEDILNQILDKANLRDAEDDDESKVIEEQ 410

Query: 412 LNKLENDGITETEETK----KSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM 467
           LN+L+     + +E+     KSY  +  LPH RFNA+TA+VDDTLFIFGG  E GEKDY 
Sbjct: 411 LNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVEIGEKDYP 470

Query: 468 IDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKL 527
           IDSFYSIDMNK+DGVKVYWE++  VERA++LG                        D KL
Sbjct: 471 IDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEEEIVDSKL 530

Query: 528 -VAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRS 586
                       + E   EIPD RPWLPHPKAFE+LRAFYVRTG +FLE AI++      
Sbjct: 531 EAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNR---- 586

Query: 587 DAKGKHLKKHSFDLC 601
           D+KGKHLK  SF+LC
Sbjct: 587 DSKGKHLKTKSFELC 601

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/554 (65%), Positives = 426/554 (76%), Gaps = 8/554 (1%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107
           IE+VLANFK++Q +FE V VE +ERP +R + S++ANP+H K ELI+FGGE+T QST  T
Sbjct: 49  IEQVLANFKKEQEQFEKVVVENIERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTT 108

Query: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167
           HF+NDL ++S D +QWK+ +SQNSPMPRSSAA+  HPSGV L+HGGEFSSPKQNTFYHYS
Sbjct: 109 HFFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYS 168

Query: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227
           DTWL DCAT EWTKIEQKNGPS+RSGHRM VWKN+IILHGGFRDLGTSTTYLNDCWLFDI
Sbjct: 169 DTWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDI 228

Query: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287
           TTYKW+Q++FP NHP+PDARSGHSL+   EGAILWGGYCKVKAGKGLQKGKILTDCWYLK
Sbjct: 229 TTYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 288

Query: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           M S+ +AIRW+R+K+QGFQPS R GCSMV HKGRG+LFGGVYD+EETEE L+S FYND+F
Sbjct: 289 MSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348

Query: 348 TYHIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKT 407
           TY I  NRWYS+SLR QR  +VK   +S +D++KELED+LN IL+ A L           
Sbjct: 349 TYQINMNRWYSLSLRPQRKKQVKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEIDA 408

Query: 408 IEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYM 467
            EE    +E D   E+E   K + I+ +LPHPRFNA+TA+VDDTLFIFGGVWE GEKDY 
Sbjct: 409 AEES-TAVEEDS-DESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYS 466

Query: 468 IDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKL 527
           IDSFY ID+NK DGV VYWED+ A+E AK+                          D+KL
Sbjct: 467 IDSFYGIDLNKADGVTVYWEDLTALENAKD--EDDSDEDEGEEDDDDEEDSEEEQVDQKL 524

Query: 528 VAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSD 587
           VA           E   EIPDPRPWLPHPKAFESLR+FYVRTGA+FLEWAI+N  +    
Sbjct: 525 VAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRH---- 580

Query: 588 AKGKHLKKHSFDLC 601
            KGKHLK  SF++C
Sbjct: 581 VKGKHLKTKSFEIC 594

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/553 (66%), Positives = 438/553 (79%), Gaps = 10/553 (1%)

Query: 50  EVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHF 109
           EVLANFK++Q  F+ V V  VERP QR +S +VANP+H KREL++FGGE+TN +  +T F
Sbjct: 76  EVLANFKKEQELFQEVLVTPVERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAF 135

Query: 110 YNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169
           YN+LF YSLD+DQW+K TS+NSPMPRSSAA AAH SGV LIHGGEFSSPKQNTFYHYSDT
Sbjct: 136 YNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDT 195

Query: 170 WLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITT 229
           WL DC T EWTK+EQKNGPS+RSGHRMT+WKN+ ILHGGFRDLGTSTTYLND W+FDITT
Sbjct: 196 WLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITT 255

Query: 230 YKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           YKW+Q++FP NHPIPDARSGHS++PT +GA+LWGGYCKVKAGKGLQKGK LTDCWYLKMK
Sbjct: 256 YKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMK 315

Query: 290 SDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTY 349
           SDV+AIRWERRKKQGFQPS R GCSMVHHKGRG+LFGGVYD+EETEEGL S F+NDLF+Y
Sbjct: 316 SDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSY 375

Query: 350 HIETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKTIE 409
            +E NRWYSV +R Q+   V +  ++NR+KD+ELE++LN IL++ANL         + I+
Sbjct: 376 QVEANRWYSVKMRPQKKKTV-AISRNNRNKDEELENILNDILQQANLADDTDDDDNE-IK 433

Query: 410 EELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMID 469
            EL +++ +     E ++K Y +V +LPHPRFNA+TA+VDD LFIFGGVWE GE+D+ ID
Sbjct: 434 RELQRIDEE--EALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSID 491

Query: 470 SFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKLVA 529
           SFYSID+NK+DGVKVYWE+++ +E+AK LG                       +D+KLVA
Sbjct: 492 SFYSIDLNKLDGVKVYWENLSELEKAKALGEDDEEEFDDDEDDDDDDEEEET-ADQKLVA 550

Query: 530 -XXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSDA 588
                     + E  PEIPD RPWLPHPK FE+LRAFY+RTGA FL+WAI+N      DA
Sbjct: 551 EDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNR----DA 606

Query: 589 KGKHLKKHSFDLC 601
           KGKHLKK SFDLC
Sbjct: 607 KGKHLKKQSFDLC 619

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/556 (63%), Positives = 423/556 (76%), Gaps = 16/556 (2%)

Query: 54  NFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDL 113
           NF+++Q  F+ V V  V+RP  RS+  +V NP H KREL++FGGEYTNQ++  T FYN+L
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNEL 113

Query: 114 FIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFD 173
           F YSLDTDQWKK TS+N+PMPRSSAA A HPSGVVLIHGGEFSSPKQNTFYHYSD+WL D
Sbjct: 114 FTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLD 173

Query: 174 CATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQ 233
           C++ EWTKI+QKNGPS+RSGHRMTVWKN+ ++HGGFRDLGTSTTYLNDCWLFDITTYKW+
Sbjct: 174 CSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWK 233

Query: 234 QLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSDVT 293
           Q++FP NHP+PDARSGHSL+PT EGAI+WGGYCK+KA KGLQKGKILTDCWYL+MKSD+T
Sbjct: 234 QVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDIT 293

Query: 294 AIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHIET 353
            IRWERRKKQGFQPS R GCSM HHKGRGILFGGVYDYEETEEGL S F+NDL +Y +E 
Sbjct: 294 GIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEA 353

Query: 354 NRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLX--XXXXXXXXKTIEEE 411
           NRWYS+ +R Q+  K+ +A KS + KD EL  +LN IL+KANL             IE+E
Sbjct: 354 NRWYSIKMRPQK-KKIVAASKSAKSKDDELVGILNDILQKANLADEENEENESDSEIEKE 412

Query: 412 LNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDSF 471
           L++L+ + +   ++  K YP+V +LPH RFNA+T +VDDTLFIFGG WE GE+D+ IDSF
Sbjct: 413 LHRLDEEELLGHQQ--KQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSF 470

Query: 472 YSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKLVAXX 531
           YSID+N+ DGV+V+WED+  +E+AK+ G                        +  +    
Sbjct: 471 YSIDLNRTDGVRVFWEDLEEIEKAKDQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEME 530

Query: 532 XXXXXXXDNEIL-------PEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNT 584
                  + E         PEIPDPRPWLPHPKAFE+LRAFY+RTGA FL+WAI+N  + 
Sbjct: 531 DDKQEEEEQEEEEEEEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRS- 589

Query: 585 RSDAKGKHLKKHSFDL 600
              AKGKHLKK SFDL
Sbjct: 590 ---AKGKHLKKQSFDL 602

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/556 (64%), Positives = 420/556 (75%), Gaps = 9/556 (1%)

Query: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110
           VLA+FK++Q +FE V VE+V++P  R +  LV+NP H K+ELILFGGEYTNQS   THFY
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFY 112

Query: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           N+LF ++ D DQW+K +SQN+PMPRSSAA+AAHPSG+ L+HGGEFSSPKQNTFYHYSDTW
Sbjct: 113 NELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTW 172

Query: 171 LFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTY 230
           L DC T EWTK++QKNGP+SRSGHRMTVWKN+ I++GGFRDLGTSTTYLNDCWLFDITT+
Sbjct: 173 LLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTH 232

Query: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS 290
           KW Q++FP NH IPDARSGHS +P  EGAILWGGYCKVKAGKGLQKGKILTDCWYLKM S
Sbjct: 233 KWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNS 292

Query: 291 DVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYH 350
             +AIRWERRKKQGFQPS R GCSMV HKGRG+LFGGVYD+EETEE LDS FYNDLFT+ 
Sbjct: 293 TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQ 352

Query: 351 IETNRWYSVSLRAQRHSKVKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXXXKTIEE 410
           I+TNRWYS+SLR QR  +VK +  S +D++KEL+D LN IL++A L              
Sbjct: 353 IKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIR 412

Query: 411 ELNKLENDGITETEE--TKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMI 468
           E  + EN    E EE  TKK + I  +LPHPRFN S A+V+DTLFI+GG+WE G+KDY I
Sbjct: 413 EQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNI 472

Query: 469 DSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSDRKLV 528
           DSFY ID+NKVDGV VYWE++A +E+AK+L                          R  V
Sbjct: 473 DSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQV 532

Query: 529 AXXXXXXXXXDNEILP---EIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTR 585
                     D E+     EIPDPRPWLPHPKAFESLRAFYVR G  FLEWAI+N     
Sbjct: 533 LVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNR--- 589

Query: 586 SDAKGKHLKKHSFDLC 601
            DA+GKHLK+ SFDLC
Sbjct: 590 -DARGKHLKQKSFDLC 604

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/560 (61%), Positives = 414/560 (73%), Gaps = 13/560 (2%)

Query: 50  EVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHF 109
           +VLANFK QQ +FE VNVE++ +P QR +S ++  P H+K+EL++FGGE+TN  T MTHF
Sbjct: 51  QVLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHF 110

Query: 110 YNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169
           YN+L  YS D  QW+K TSQNSPMPRSSAA+ AHPSG+ L+HGGEFSSPKQNTFYHYSDT
Sbjct: 111 YNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDT 170

Query: 170 WLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITT 229
           WL D  T EWTK++   GP  RSGHR+T+WKNY IL GGF+DLG ST+Y NDCW FDITT
Sbjct: 171 WLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITT 230

Query: 230 YKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           YKW+Q++FP NHPIPDARSGHS +PT EG ILWGGYCKVKAGKGLQKGKIL DCWYLKMK
Sbjct: 231 YKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMK 290

Query: 290 SDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTY 349
           SD++ +RWERRKKQGFQPS R GCSM +HKGRGILFGGVYD+EETEE L+S+FYNDLF+Y
Sbjct: 291 SDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSY 350

Query: 350 HIETNRWYSVSLR-AQRHSKV--KSAPKSNRDKDKELEDMLNAILKKANLX--XXXXXXX 404
           ++E+NRW+S+SLR AQ+  KV   S  KS+++K+KEL+D+LN IL+K NL          
Sbjct: 351 NVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEIS 410

Query: 405 XKTIEEELNKLENDGITETEETKKSYPIVM-KLPHPRFNASTAIVDDTLFIFGGVWEQGE 463
             T  E      +D     E +K +   VM +LPHPRFNA+T +VDD+LFI+GG+WE GE
Sbjct: 411 TGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGE 470

Query: 464 KDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHS 523
           KDY IDS YSID+NK+DGV  YWED+  +E+AKE+G                        
Sbjct: 471 KDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEIED 530

Query: 524 DRKLVA--XXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNK 581
            +KLVA           +     EIPD RPWLPHPK FESLRAFY+R GA+FLEWAI+N 
Sbjct: 531 -KKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNN 589

Query: 582 HNTRSDAKGKHLKKHSFDLC 601
            + R    GKHLKK SFDLC
Sbjct: 590 KHVR----GKHLKKKSFDLC 605

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/559 (59%), Positives = 426/559 (76%), Gaps = 13/559 (2%)

Query: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPL--HNKRELILFGGEYTNQSTGMTH 108
           VLANFK++Q +FE V V++V++ ++R +  +V NP    +K+ELI+FGGE+TN  T  T 
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 109 FYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSD 168
           FYNDL  ++ + +QWK+YTSQN+PMPRSSAA+AAHPSG+ L+HGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 169 TWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDIT 228
           TW+ DC T EW K++ K GPS+RSGHR+TVWKN+ ILHGGFRDLGTSTTYL+DCWLFDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 229 TYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAG-KGLQKGKILTDCWYLK 287
           TYKW+Q++FP+NH +PDARSGHS +PT EGAILWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           MKSD++ IRWERR+KQGFQPS R GCSM +HKGRGILFGGVYD+EETEE L+S F+NDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 348 TYHIETNRWYSVSLRAQR---HSKVKSAPKSNRDKDKELEDMLNAILKKANLX-XXXXXX 403
           +YHIE+NRWYS+S+R+++   ++  K + K++++++KEL+ +L++IL+KANL        
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 404 XXKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGE 463
             + I   L K++ +   E E+    + I+ +LPHPRFNA+T ++DDTLFIFGG+WE G+
Sbjct: 409 DDEEINTALAKVDLE-DEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGD 467

Query: 464 KDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHS 523
           K++MIDS YSID+NK+DGV +YWED+  +ERAKELG                       +
Sbjct: 468 KEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDN 527

Query: 524 DRKLVAXXXXXXXXXDNEILPEI-PDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKH 582
           ++             +        PDPRPWLPHPK FE+LRAFY+R GA+FLEWAI+N  
Sbjct: 528 EKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNK 587

Query: 583 NTRSDAKGKHLKKHSFDLC 601
           N    AKGKHLKKHSFDLC
Sbjct: 588 N----AKGKHLKKHSFDLC 602

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/559 (57%), Positives = 408/559 (72%), Gaps = 15/559 (2%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107
           IEE+L NFK++Q  +E +N+E+VE+P  R++ S++++    K+EL+LFGGE+T++    T
Sbjct: 48  IEEILENFKKEQENYEKINIESVEKPSIRNNGSIISST--TKKELLLFGGEHTSKELQTT 105

Query: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167
            FYNDL+ +S D +QWK+ TSQNSPMPRSSAA+AAHPSG+ L++GGEFSSPKQ+TFYHYS
Sbjct: 106 KFYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYS 165

Query: 168 DTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDI 227
           DTW+ D  T EWTKIE K  P  RSGHR+T WKNY IL GGF+DLG STTY ND WLFDI
Sbjct: 166 DTWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDI 225

Query: 228 TTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLK 287
           TTYKW+Q++FP NH +PDARSGHSL+PT EG I++GGYCK+KA KGLQKGK+L+ CW LK
Sbjct: 226 TTYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLK 285

Query: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           MK+DV AIRWERR+KQGFQPS R GCSM +HKGRGILFGGVYD++ETEE L+S+FYNDLF
Sbjct: 286 MKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLF 345

Query: 348 TYHIETNRWYSVSLRAQRHSK---VKSAPKSNRDKDKELEDMLNAILKKANLXXXXXXXX 404
           TY+IE+NRW++V+L+ + ++      +  KS+++K++EL+D+LN IL+K NL        
Sbjct: 346 TYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEE 405

Query: 405 XKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEK 464
             +         +D   E ++ K     V +LPHPRFNA+T ++DD L+I+GG WE GE 
Sbjct: 406 ESSDIFG----SDDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEI 461

Query: 465 DYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXXXXHSD 524
           DY IDSFYSID+NK+DGV VYWED+  +E AKELG                        D
Sbjct: 462 DYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEEEVED 521

Query: 525 RKLVA--XXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKH 582
            KL+A           +     EIPDPRPWLPHPKAFESLRAFY+R G +FLEWAI+N  
Sbjct: 522 TKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISNNR 581

Query: 583 NTRSDAKGKHLKKHSFDLC 601
           +TR    GK LK+ SF+LC
Sbjct: 582 HTR----GKLLKQKSFELC 596

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/578 (54%), Positives = 401/578 (69%), Gaps = 28/578 (4%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQ-----RSSSSLV-ANPLHNKR--ELILFGGEY 99
           IE VLANFK +Q +FE +NVE + +        RS+SS++ A   HNK+  EL++FGGEY
Sbjct: 50  IETVLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEY 109

Query: 100 TNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPK 159
           T+  TGMTHFYNDL  Y+ DT QW+K TSQNSPMPRSSAA+  HPSG+ ++HGGEFSSPK
Sbjct: 110 TSPETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPK 169

Query: 160 QNTFYHYSDTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTS-TTY 218
           QNTFYHYSDTW+ D +T EWTK++ K  P +RSGHR+  WKNY +L GGF+D+G + T Y
Sbjct: 170 QNTFYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNY 229

Query: 219 LNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKA--GKGLQK 276
            ND W FDI  YKW Q++FP NHP+PD RSGHS +P  EG ILWGGY KVK+    G QK
Sbjct: 230 FNDVWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQK 289

Query: 277 GKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEE 336
           GKIL DCWYLKMKSD+++IRWERRKK GFQPS R GCSM +HKGRGILFGGVYD++ETEE
Sbjct: 290 GKILNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEE 349

Query: 337 GLDSLFYNDLFTYHIETNRWYSVSLRAQR---HSKVKSAPKSNRDKDKELEDMLNAILKK 393
            L+SLFYNDLF+Y++ETNRW++++LR  +    S  +S  K++++K+KEL+D+LN IL+K
Sbjct: 350 SLESLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEK 409

Query: 394 ANLXXXXXXXXXKTIEEELN--------KLENDGITETEETKKSYPIVMKLPHPRFNAST 445
            NL         +  E E            +++    T +  +   I+ +LPHPR+N + 
Sbjct: 410 NNLKDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAM 469

Query: 446 AIVDDTLFIFGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXX 505
            +VDD LFI+GG WE GEKDY I+SFYSID+N++DGV  YWED+  +E+AKELG      
Sbjct: 470 TVVDDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDE 529

Query: 506 XXXXXXXXXXXXXXXXH--SDRKLVAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLR 563
                               D+KLVA         ++    EIPD RPWLPHPK FESLR
Sbjct: 530 EDDEDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLR 589

Query: 564 AFYVRTGASFLEWAITNKHNTRSDAKGKHLKKHSFDLC 601
           AFY+R G +FLEWAI+N  + R    GKHLKK SF+LC
Sbjct: 590 AFYIREGPAFLEWAISNNKHVR----GKHLKKKSFELC 623

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/565 (51%), Positives = 375/565 (66%), Gaps = 22/565 (3%)

Query: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110
           +L NFK +Q +FE V VE V  P  R+++ LV N   +K EL+LFGGE TN  T MT FY
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTNA--SKPELLLFGGERTNNETNMTKFY 110

Query: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           NDL +Y+   +QWKK+TSQNSPMPRSSAA+ +H SGV ++ GGEFSSPKQNTFYHY+DTW
Sbjct: 111 NDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTW 170

Query: 171 LFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTY 230
           L D  T EW+K++ KNGPS+RSGHR+T WKNY IL GGF+DL   T+Y ND WLF++  +
Sbjct: 171 LLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDF 230

Query: 231 KWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKM 288
           KW + +   N   PD RSGHS + + EG I++GGYCKVKA   K L KGK LTDCW LKM
Sbjct: 231 KWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKM 289

Query: 289 KSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
             +V  I+WERR K+G QPS R GCSM +H   RGILFGGVYD EETEE L S++YNDL+
Sbjct: 290 SQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLY 349

Query: 348 TYHIETNRWYSVSLR-AQRHSKVKSAPKSN----RDKDKELEDMLNAILKKANLXXXXXX 402
           +Y+IE+NRWY + LR   ++S       SN    ++++KEL+D+LN IL++ +L      
Sbjct: 350 SYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETN 409

Query: 403 XXXKTI---EEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVW 459
               +    EE     E D   E E+ + + P + +LPH RFNA T +++DT +I+GG+W
Sbjct: 410 SYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMW 469

Query: 460 EQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXXXXX 519
           E  + DY IDSFYSID+NK+DG+  Y+E++  +E  K LG                    
Sbjct: 470 EFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDDGE 529

Query: 520 XXHSDRKLVAXXXXXXXXXDNEILP--EIPDPRPWLPHPKAFESLRAFYVRTGASFLEWA 577
              ++ +L A         ++E +   EIPDPRPWLPHPKAFESLR FY+R G  FLEWA
Sbjct: 530 AEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWA 589

Query: 578 IT-NKHNTRSDAKGKHLKKHSFDLC 601
           I+ NKH     AKGKHLK+ SF+LC
Sbjct: 590 ISNNKH-----AKGKHLKQKSFELC 609

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/571 (48%), Positives = 370/571 (64%), Gaps = 24/571 (4%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107
           ++E+L++F ++Q E E V++ +VE+P  R+   + ANP HNK EL +FGGE+T+  T +T
Sbjct: 51  LDEILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLT 110

Query: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167
           HFYNDL+ YS+  + WKKY SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYS
Sbjct: 111 HFYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYS 170

Query: 168 DTWLFDCATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGT-STTYLNDCW 223
           DTWLFDC   ++TK+E   + + PS+RSGHR+  WKNY IL GGFRDLG   T+YLND W
Sbjct: 171 DTWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLW 230

Query: 224 LFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKV--KAGKGLQKGKILT 281
            FDI+TYKW +L+    +  PDARSGH  +PT   AIL GGYCK+  K  K L KGKIL 
Sbjct: 231 CFDISTYKWTKLE---TNSKPDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILN 287

Query: 282 DCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDS 340
           D W L +  D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE L+S
Sbjct: 288 DAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347

Query: 341 LFYNDLFTYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKAN 395
           +FYNDL+ +H+E N+W  + ++ QR +  K++P     KSN+D++KEL+D+LN+IL K+N
Sbjct: 348 VFYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSN 407

Query: 396 L--XXXXXXXXXKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLF 453
           L            T    ++  E++      + ++   I  +LPHPRFNA+T +V D+LF
Sbjct: 408 LNDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLF 467

Query: 454 IFGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXX 513
           I+ GVWE GEKDY I+SFYSID+NK+DGVKVYWED++A+E AK LG              
Sbjct: 468 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDD 527

Query: 514 XXXXXXXXHSDRK---LVAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTG 570
                                       D +   EIPD R WLPHPK FE+LRAFY+R G
Sbjct: 528 EEDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREG 587

Query: 571 ASFLEWAITNKHNTRSDAKGKHLKKHSFDLC 601
           A+FL W+I+N  N     KGK LK  SF+LC
Sbjct: 588 ANFLTWSISNNRN----LKGKQLKTKSFELC 614

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/572 (48%), Positives = 373/572 (65%), Gaps = 25/572 (4%)

Query: 48  IEEVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMT 107
           ++E+L++F ++Q E E V++  VER   R+   + ANP HNKREL +FGGE+T+  T +T
Sbjct: 51  LDEILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLT 110

Query: 108 HFYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYS 167
           HFYNDL+ YS+  + WKKY S+N+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYS
Sbjct: 111 HFYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYS 170

Query: 168 DTWLFDCATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGT-STTYLNDCW 223
           DTWLFDCA  ++TK+E   + + PS+RSGHR+  WKNY IL GGFRDLG   T+YLND W
Sbjct: 171 DTWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLW 230

Query: 224 LFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKV--KAGKGLQKGKILT 281
            FDI+ YKW +L+    +  P+ARSGH  +PT   AIL GGYCK+  K  K L KGKIL 
Sbjct: 231 CFDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILN 287

Query: 282 DCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDS 340
           D W L +  D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE L+S
Sbjct: 288 DAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLES 347

Query: 341 LFYNDLFTYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKAN 395
           +FYNDL+ +H+E N+W  + ++ QR +  K+AP     KSN+D++KEL+D+LN+IL K+N
Sbjct: 348 VFYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSN 407

Query: 396 LXXXXXXXXXKTIEEELNKLENDGITETEETK-KSYPIVMKLPHPRFNASTAIVDDTLFI 454
           L          T    ++  +     +++    ++  I  +LPHPRFNA+T +VDD+LFI
Sbjct: 408 LNDDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFI 467

Query: 455 FGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXX 514
           + GVWE GEKDY I+SFYSID+NK+DGV VYWED++ +E AK LG               
Sbjct: 468 YSGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDD 527

Query: 515 XXXXXXXHSDRKLVA-----XXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRT 569
                    + + VA              + +   EIPD R WLPHPK FE+LRAFY+R 
Sbjct: 528 DDDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLRE 587

Query: 570 GASFLEWAITNKHNTRSDAKGKHLKKHSFDLC 601
           GA+FL W+I+N      D KGKHLK  SF++C
Sbjct: 588 GANFLTWSISNN----KDLKGKHLKTKSFEIC 615

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/572 (49%), Positives = 364/572 (63%), Gaps = 27/572 (4%)

Query: 50  EVLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHF 109
           E+L++F ++Q E E V++  VERP  R    + ANP HNK EL +FGGE+T+  T +THF
Sbjct: 53  EILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHF 112

Query: 110 YNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169
           YNDL+ YS+  + WKKY SQN+P+PRSS A+A H SG+ L+HGGEFSSPKQ+ FYHYSDT
Sbjct: 113 YNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDT 172

Query: 170 WLFDCATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGT-STTYLNDCWLF 225
           WLFDC   ++TK+E   + + PS+RSGHR+  WKNY IL GGFRDLG+  T+YLND W F
Sbjct: 173 WLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCF 232

Query: 226 DITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCK--VKAGKGLQKGKILTDC 283
           DI+ YKW +L+    +  PDARSGH  +PT   AIL GGYCK   K  K L KGKIL D 
Sbjct: 233 DISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDS 289

Query: 284 WYLKMKSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLF 342
           W L +  D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE LDS+F
Sbjct: 290 WKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIF 349

Query: 343 YNDLFTYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKANLX 397
           YNDL+ +H+E N+W  + ++ QRH+  ++AP     KSN+D++KEL+D+LN+IL K+NL 
Sbjct: 350 YNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLN 409

Query: 398 XXXXXXXXKTI----EEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLF 453
                    T         N   +D      E +++  I  +LPHPRFNA+T +VDD+LF
Sbjct: 410 DEEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLF 469

Query: 454 IFGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXX 513
           I+ GVWE GEKDY I+SFYSID+NK+DGVKVYWED++ VE AK LG              
Sbjct: 470 IYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDE 529

Query: 514 XXXXXXXXHSDRKL----VAXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRT 569
                      +                 D +   EIPD R WLPHPK FE+LRAFY+R 
Sbjct: 530 DDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLRE 589

Query: 570 GASFLEWAITNKHNTRSDAKGKHLKKHSFDLC 601
           GA+FL W+I+N  N     KGK LK  SF+LC
Sbjct: 590 GANFLTWSISNNRN----LKGKQLKTKSFELC 617

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/568 (48%), Positives = 365/568 (64%), Gaps = 24/568 (4%)

Query: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFY 110
           +L++F ++Q E E V++  VERP  R+   + ANP HNK EL +FGGE+T+  T +THFY
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFY 113

Query: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           NDL+ YS+  + WKKY SQN+P+PRSSAA+A HPSG+ L+HGGEFSSPKQ+ FYHYSDTW
Sbjct: 114 NDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTW 173

Query: 171 LFDCATHEWTKIE---QKNGPSSRSGHRMTVWKNYIILHGGFRDLGT-STTYLNDCWLFD 226
           LFDC   ++ K+E   + + PS+RSGHR+  WKNY IL GGFRDLG   T+YLND W FD
Sbjct: 174 LFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFD 233

Query: 227 ITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCK--VKAGKGLQKGKILTDCW 284
           I+ YKW +++    +  PDARSGH  +PT   AIL GGYCK   K  K L KGKIL D W
Sbjct: 234 ISNYKWSKIE---TNSKPDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAW 290

Query: 285 YLKMKSDVTAIRWERRKKQGFQPSSRAGCSM-VHHKGRGILFGGVYDYEETEEGLDSLFY 343
            L +  D    +WE+ K    QPS R G S  +  + + + FGGVYD +ETEE L+S+FY
Sbjct: 291 KLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFY 350

Query: 344 NDLFTYHIETNRWYSVSLRAQRHSKVKSAP-----KSNRDKDKELEDMLNAILKKANLXX 398
           NDL+ +H+E N+W  + +++QR +  +++P     KSN+D++KEL+D+LN+IL K+NL  
Sbjct: 351 NDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLND 410

Query: 399 XXXXXXXKTI--EEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFG 456
                   T      ++  E++      + ++   I  +LPHPRFNA+T +V D+LFI+ 
Sbjct: 411 DDDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYS 470

Query: 457 GVWEQGEKDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGXXXXXXXXXXXXXXXXX 516
           GVWE GEKDY I+SFYSID+NK+DGVKVYWE+++A+E AK LG                 
Sbjct: 471 GVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDD 530

Query: 517 XXXXXHSDRKLV---AXXXXXXXXXDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASF 573
                      +             D +   EIPD R WLPHPK FE+LRAFY+R GA+F
Sbjct: 531 EDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANF 590

Query: 574 LEWAITNKHNTRSDAKGKHLKKHSFDLC 601
           L W+I+N  N     KGK LK  SF+LC
Sbjct: 591 LTWSISNNRNL----KGKQLKTKSFELC 614

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 104/253 (41%), Gaps = 44/253 (17%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEW 179
           W +   QNSP PR    S+A A   + + ++ G    S        Y DTW+  C   + 
Sbjct: 139 WNRIKLQNSPFPRYRHVSSAYATASNNIYILGGLHDQSV-------YGDTWIISC-NPDA 190

Query: 180 TKIEQK------NGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKW 232
           T+   K      N P  R GH  T+  N  I+ GG    +       +D +LF+I +YKW
Sbjct: 191 TQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMDDDIYLFNINSYKW 250

Query: 233 QQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
             +  P   P P  R GH +       IL     K K       G    D ++  +   D
Sbjct: 251 -TIPNPIG-PRPLGRYGHKI------CILATSTVKTKL---YLFGGQFDDTYFNDLAVFD 299

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     WE  K +GF P      +MV +     ++GG     +T++GL     ND+
Sbjct: 300 LSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG-----DTQQGL----INDI 350

Query: 347 FTYHIETNRWYSV 359
           F +   TN W  V
Sbjct: 351 FKFSPNTNTWTKV 363

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 84/185 (45%), Gaps = 27/185 (14%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAIAA 142
           K +L LFGG++ +       ++NDL ++ L +       W+   S+   P P ++  +  
Sbjct: 277 KTKLYLFGGQFDDT------YFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVT 330

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVWKN 201
           + S +  I+GG+      N      D + F   T+ WTK+E     P     H   V+KN
Sbjct: 331 YGSDL-WIYGGDTQQGLIN------DIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKN 383

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPA-NHPIPDARSGHSL-LPTPEGA 259
            + + GG  +   +  YLN  +LF+  + KW    FP     I   RSGHS+ L   +  
Sbjct: 384 IMCVVGGKDE---NDMYLNSVYLFNFDSSKW--YTFPDFKSGIIQGRSGHSVTLLNNDKL 438

Query: 260 ILWGG 264
           ++ GG
Sbjct: 439 LIMGG 443

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 77/167 (46%), Gaps = 33/167 (19%)

Query: 52  LANFKRQQAEFEAVNVETVERPHQRSSSSLVANPLHNK------RELILFGGEYTNQSTG 105
           L++F+RQ + +E +            S   +  PL N        +L ++GG+ T Q   
Sbjct: 300 LSSFRRQDSHWEFI-----------KSKGFMPPPLTNHTMVTYGSDLWIYGGD-TQQG-- 345

Query: 106 MTHFYNDLFIYSLDTDQWKKY-TSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFY 164
                ND+F +S +T+ W K  T+   P P    A   + + + ++ G +     +N  Y
Sbjct: 346 ---LINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGKD-----ENDMY 397

Query: 165 HYSDTWLFDCATHEW-TKIEQKNG-PSSRSGHRMTVWKN-YIILHGG 208
             S  +LF+  + +W T  + K+G    RSGH +T+  N  +++ GG
Sbjct: 398 LNS-VYLFNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGG 443

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 105/264 (39%), Gaps = 54/264 (20%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEW 179
           W +   QNSP PR    ++++ +  + V +I G    S        Y DTW+  C   + 
Sbjct: 131 WNRIKLQNSPFPRYRHVASSVISDTNQVYVIGGLHDQS-------VYGDTWVLTCEDPQT 183

Query: 180 TKI-------EQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLND-CWLFDITTYK 231
           + +         +  P  R GH  T+  N  ++ GG          ++D  +LF+I +YK
Sbjct: 184 STMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGEMDDDIYLFNINSYK 243

Query: 232 WQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQK-----GKILTDCWYL 286
           W          IP     H + P P+G   +G    + A K +Q      G    D ++ 
Sbjct: 244 WT---------IP-----HPIGPRPKGR--YGHKISIIARKQMQTKLYLFGGQFDDNYFN 287

Query: 287 KMKS-DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDS 340
            +   D+++ R     WE  K + F P      +MV +  +  +FGG     +T EGL  
Sbjct: 288 DLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG-----DTLEGL-- 340

Query: 341 LFYNDLFTYHIETNRWYSVSLRAQ 364
              N +F Y    N W  V    Q
Sbjct: 341 --LNQVFMYDPAVNDWCVVETTCQ 362

 Score = 44.7 bits (104), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 82/188 (43%), Gaps = 31/188 (16%)

Query: 91  ELILFGGEYTNQSTGMTHFYNDLFIYSL-----DTDQWKKYTSQN-SPMPRSSAAIAAHP 144
           +L LFGG++ +      +++NDL ++ L     D   W+    ++  P P ++  + ++ 
Sbjct: 273 KLYLFGGQFDD------NYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYD 326

Query: 145 SGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQ-------KNGPSSRSGHRMT 197
             + +  G          F       ++D A ++W  +E        +N P     H   
Sbjct: 327 FKLWVFGGDTLEGLLNQVF-------MYDPAVNDWCVVETTCQDDDLENMPPPMQEHATL 379

Query: 198 VWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSL-LPTP 256
           ++K  + + GG  +      YLND +  ++ + KW +L    +  IP  RSGHS+ L   
Sbjct: 380 IYKGLMCIVGGKDE---QDHYLNDVYFLNLKSLKWFRLPRFMDG-IPQGRSGHSVTLLKN 435

Query: 257 EGAILWGG 264
           +  ++ GG
Sbjct: 436 DKLLIMGG 443

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 107/264 (40%), Gaps = 44/264 (16%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---FDCAT 176
           W +   QNSP PR    ++A     + + +I G    S        Y DTW+   FD AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 H-EWTKIE-QKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
               T I+  +  P  R GH   +  N  ++ GG    +       +D +L +I +YKW 
Sbjct: 166 RFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW- 224

Query: 234 QLQFPAN-HPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
               PA   P P  R GH +      +I+     K K       G    D ++  +   D
Sbjct: 225 --TVPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     WE  K + F P      +M+ +  +  +FGG     +T +GL     ND+
Sbjct: 274 LSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG-----DTLQGL----VNDV 324

Query: 347 FTYHIETNRWYSVSLRAQRHSKVK 370
           F Y    N W+ +    ++   V+
Sbjct: 325 FMYDPAINDWFIIDTTGEKPPPVQ 348

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 91/211 (43%), Gaps = 37/211 (17%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAIAA 142
           K +L +FGG++ +       ++NDL +Y L +       W+    +  +P P ++  + +
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVWKN 201
           + S + +  G              +D +++D A ++W  I+     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYND 357

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQ-FPANHPIPDARSGHSLLPTPEGAI 260
            + + GG  +      YLN  +  ++ + KW +L  F A   IP  RSGHSL       I
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSRKWFKLPVFTAG--IPQGRSGHSLTLLKNDKI 412

Query: 261 LWGG-----YCKVK------AGKGLQKGKIL 280
           L  G     Y +V+      +   +Q+G I+
Sbjct: 413 LIMGGDKFDYARVEEYDLHTSDIDMQRGTIV 443

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 108/264 (40%), Gaps = 44/264 (16%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---FDCAT 176
           W +   QNSP PR    ++A A   + + +I G    S        Y DTW+   FD AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYATDKNQIYVIGGLHDQSV-------YGDTWILSAFDDAT 165

Query: 177 H-EWTKIE-QKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
               T I+  +  P  R GH   +  N  ++ GG    +       +D +L ++ +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMDDDIYLLNVNSYKW- 224

Query: 234 QLQFPAN-HPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
               PA   P P  R GH +      +I+     K K       G    D ++  +   D
Sbjct: 225 --TVPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     W+  K   F P      +M+ +  +  +FGG     +T +GL     ND+
Sbjct: 274 LSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG-----DTLQGL----INDV 324

Query: 347 FTYHIETNRWYSVSLRAQRHSKVK 370
           F Y    N W+++    ++   V+
Sbjct: 325 FMYDPAKNDWFTIETSGEKPPPVQ 348

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 83/186 (44%), Gaps = 29/186 (15%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT--------DQWKKYTSQNSPMPRSSAAI 140
           K +L +FGG++ +       ++NDL +Y L +        D  K  T   +P P ++  +
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWDFLKPMTF--TPPPMTNFTM 302

Query: 141 AAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVW 199
            ++ S + +  G              +D +++D A ++W  IE     P     H   V+
Sbjct: 303 ISYDSKLWVFGGDTLQG-------LINDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVY 355

Query: 200 KNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSL-LPTPEG 258
            + + + GG  +      YLN  +  ++ T+KW +L   A   IP  RSGHSL L   + 
Sbjct: 356 NDLMCVVGGKDE---HDAYLNTVYFLNLKTHKWFKLPIFAAG-IPQGRSGHSLTLLKNDK 411

Query: 259 AILWGG 264
            ++ GG
Sbjct: 412 VLIMGG 417

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 94/196 (47%), Gaps = 31/196 (15%)

Query: 79  SSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQ--------N 130
           S + +NP+  K  L LFGG+          ++NDL ++ L +  +++  S         +
Sbjct: 203 SIIASNPMQTK--LYLFGGQVDET------YFNDLVVFDLSS--FRRPNSHWEFLEPVGD 252

Query: 131 SPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKN-GPS 189
            P P ++  + A+    + + GGE  +PK  +    +DT+ +D A  EW+K++     P 
Sbjct: 253 LPPPLTNHTMVAY-DNKLWVFGGE--TPKTIS----NDTYRYDPAQSEWSKVKTTGEKPP 305

Query: 190 SRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSG 249
               H   V+K+ + + GG +D  T   Y ND +  ++ + KW +L       IP  RSG
Sbjct: 306 PIQEHASVVYKHLMCVLGG-KD--THNAYSNDVYFLNLLSLKWYKLPR-MKEGIPQERSG 361

Query: 250 HSL-LPTPEGAILWGG 264
           HSL L   E  ++ GG
Sbjct: 362 HSLTLMKNEKLLIMGG 377

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 97/257 (37%), Gaps = 40/257 (15%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLF----DCA 175
           W +   +NSP PR   SS+ I  + + + +  G    S        Y D W      D  
Sbjct: 73  WNRVKLKNSPFPRYRHSSSFIVTNDNRIFVTGGLHDQSV-------YGDVWQIAANADGT 125

Query: 176 THEWTKIE-QKNGPSSRSGHRMTVWKN-YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQ 233
           +    +I+  +N P  R GH  T+  N Y++  G    L  +    +D +LF+I +YKW 
Sbjct: 126 SFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWT 185

Query: 234 QLQFPANHPIPDARSGHSLL-----PTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKM 288
             Q     P+   R GH +      P      L+GG         L    ++ D    + 
Sbjct: 186 IPQPIGRRPL--GRYGHKISIIASNPMQTKLYLFGGQVDETYFNDL----VVFDLSSFRR 239

Query: 289 KSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFT 348
            +      WE  +  G  P      +MV +  +  +FGG     ET + +     ND + 
Sbjct: 240 PNS----HWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ETPKTIS----NDTYR 286

Query: 349 YHIETNRWYSVSLRAQR 365
           Y    + W  V    ++
Sbjct: 287 YDPAQSEWSKVKTTGEK 303

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 107/264 (40%), Gaps = 44/264 (16%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---FDCAT 176
           W +   Q+SP PR    S+A     + + +I G    S        Y DTW+   FD AT
Sbjct: 113 WNRIKLQDSPFPRYRHVSSAYVTDKNQIYVIGGLHDQSV-------YGDTWILTAFDNAT 165

Query: 177 H-EWTKIE-QKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
               T I+  +  P  R GH   +  N  ++ GG    +       +D +L +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWT 225

Query: 234 QLQFPAN-HPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
               PA   P P  R GH +      +I+     K K       G    D ++  +   D
Sbjct: 226 ---VPAPVGPRPLGRYGHKI------SIIATNQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     WE  K + F P      +M+ +  +  +FGG     +T +GL     ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG-----DTLQGL----VNDV 324

Query: 347 FTYHIETNRWYSVSLRAQRHSKVK 370
           F Y    N W+ +    ++   V+
Sbjct: 325 FMYDPALNDWFIIETTGEKPPPVQ 348

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 93/211 (44%), Gaps = 37/211 (17%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAIAA 142
           K +L +FGG++ +       ++NDL +Y L +       W+    +  SP P ++  + +
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVWKN 201
           + S + +  G              +D +++D A ++W  IE     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LVNDVFMYDPALNDWFIIETTGEKPPPVQEHATVVYND 357

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQ-FPANHPIPDARSGHSL-LPTPEGA 259
            + + GG  +      YLN  +  ++ + KW +L  F A   IP  RSGHSL L   +  
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSNKWFKLPVFTAG--IPQGRSGHSLTLLKNDKI 412

Query: 260 ILWGG----YCKVKAGK------GLQKGKIL 280
           ++ GG    Y +V+          +QKG I+
Sbjct: 413 LIMGGDKFDYARVEESDLHTSDIDMQKGTIV 443

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 106/264 (40%), Gaps = 44/264 (16%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---FDCAT 176
           W +   QNSP PR    ++A     + + +I G    S        Y DTW+    D AT
Sbjct: 113 WNRIKLQNSPFPRYRHVASAYVTDKNQIYVIGGLHDQSV-------YGDTWILTALDNAT 165

Query: 177 H-EWTKIE-QKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
               T I+  +  P  R GH   +  N  ++ GG    +       +D +L +I +YKW 
Sbjct: 166 KFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKW- 224

Query: 234 QLQFPAN-HPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
               PA   P P  R GH +      +I+     K K       G    D ++  +   D
Sbjct: 225 --TVPAPVGPRPLGRYGHKI------SIIATTQMKTKL---YVFGGQFDDTYFNDLAVYD 273

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     WE  K + F P      +M+ +  +  +FGG     +T +GL     ND+
Sbjct: 274 LSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG-----DTLQGL----INDV 324

Query: 347 FTYHIETNRWYSVSLRAQRHSKVK 370
           F Y    N W+ +    ++   V+
Sbjct: 325 FMYDPAINDWFIIETTGEKPPPVQ 348

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 93/211 (44%), Gaps = 37/211 (17%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAIAA 142
           K +L +FGG++ +       ++NDL +Y L +       W+    +  +P P ++  + +
Sbjct: 251 KTKLYVFGGQFDDT------YFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMIS 304

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVWKN 201
           + S + +  G              +D +++D A ++W  IE     P     H   V+ +
Sbjct: 305 YDSKLWVFGGDTLQG-------LINDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYND 357

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQ-FPANHPIPDARSGHSLLPTPEGAI 260
            + + GG  +      YLN  +  ++ ++KW +L  F A   IP  RSGHSL    +  I
Sbjct: 358 LMCVVGGKDE---HDAYLNSVYFLNLKSHKWFKLPVFTAG--IPQGRSGHSLTLLKDDKI 412

Query: 261 LWGG-----YCKVK------AGKGLQKGKIL 280
           L  G     Y +V+      +   LQ+G I+
Sbjct: 413 LIMGGDKFDYARVEEFDLHTSDIDLQRGTIV 443

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 98/255 (38%), Gaps = 40/255 (15%)

Query: 119 DTDQWKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCA 175
           D   W +    NSP PR    ++A A     + +I G    S        Y DTW+    
Sbjct: 130 DQTVWNRIKLANSPFPRYRHVASAYATEDDKIYVIGGLHDQSV-------YGDTWILTSE 182

Query: 176 THEWTKIEQ-----KNGPSSRSGHRMTVWKN-YIILHGGFRDLGTSTTYLNDCWLFDITT 229
            +    I Q      N P  R GH  T+  N +II  G    +       +D +LF+I +
Sbjct: 183 NNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMDDDLYLFNINS 242

Query: 230 YKWQQLQFPANHPIPDARSGH--SLLPTPEGAI---LWGGYCKVKAGKGLQKGKILTDCW 284
           +KW  +  P   P P  R GH  S++ T        L+GG         L    ++ D  
Sbjct: 243 HKW-TIPNPVG-PRPLGRYGHKISIIATANSKTRLYLFGGQFDDAYFNDL----VVFDLS 296

Query: 285 YLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYN 344
             +        RWE  K + F P      +MV +  +  +FGG     +T +GL     N
Sbjct: 297 SFRRPDS----RWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG-----DTLQGL----TN 343

Query: 345 DLFTYHIETNRWYSV 359
            +F Y    N W ++
Sbjct: 344 RVFMYDPMINDWTTI 358

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 94/217 (43%), Gaps = 41/217 (18%)

Query: 87  HNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAI 140
           ++K  L LFGG++ +       ++NDL ++ L +      +W+    ++  P P ++  +
Sbjct: 270 NSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDSRWEFVKPKSFVPPPLTNHTM 323

Query: 141 AAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQ-----KNGPSSRSGHR 195
            ++ + + +  G          F       ++D   ++WT IE       N       H 
Sbjct: 324 VSYDNKLWVFGGDTLQGLTNRVF-------MYDPMINDWTTIETSSDNPNNIAPPMQEHA 376

Query: 196 MTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHP-IPDARSGHSL-L 253
             V+K+ + + GG  +     TYLN  +  ++ T KW +L  P   P IP  RSGHS+ L
Sbjct: 377 AIVYKDLMCIFGGKDE---QDTYLNGVYFLNLRTLKWYKL--PIFAPGIPQGRSGHSITL 431

Query: 254 PTPEGAILWGG----YCKVK------AGKGLQKGKIL 280
              +  ++ GG    Y +V       +   + KG IL
Sbjct: 432 LKNDKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 91/194 (46%), Gaps = 28/194 (14%)

Query: 80  SLVA-NPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQNS-P 132
           S++A NP+  K  L LFGG+          ++NDL ++ L +       W+      + P
Sbjct: 201 SIIAYNPMQTK--LYLFGGQLDKT------YFNDLAMFDLSSFRRRNSHWEFLEPATTVP 252

Query: 133 MPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG-PSSR 191
            P ++  +  +    + + GGE  +PK  +    ++T+ +D   ++W+KIE     P   
Sbjct: 253 PPLANHTMVTY-GNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPV 305

Query: 192 SGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHS 251
             H   V+K+ + + GG     T   Y ND +  D+ ++KW +L       IP  RSGHS
Sbjct: 306 QEHASVVYKHIMCVFGGKY---THNAYSNDVYFLDLLSFKWYKLPH-IKEGIPRERSGHS 361

Query: 252 L-LPTPEGAILWGG 264
           L L   E  ++ GG
Sbjct: 362 LTLMKNEKILIMGG 375

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 25/157 (15%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCA---- 175
           W +   ++SP PR   SS+ I +     + + GG ++         Y D W         
Sbjct: 71  WNRIKLKDSPFPRYRHSSSPIVSS-ENRIFVTGGLYNQSV------YGDVWQITANADGT 123

Query: 176 --THEWTKIEQKNGPSSRSGHRMTVWKN-YIILHGGFRDLGTSTTYLNDCWLFDITTYKW 232
             T +  +I+ +N P  R GH  T+  N Y++  G    L       +D +LF++ +YKW
Sbjct: 124 SFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLLDDDIYLFNVNSYKW 182

Query: 233 QQLQFPANHPIPDARSGHSLL-----PTPEGAILWGG 264
              Q   + P+   R GH +      P      L+GG
Sbjct: 183 TIPQPIGSRPL--GRYGHKISIIAYNPMQTKLYLFGG 217

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 128/331 (38%), Gaps = 86/331 (25%)

Query: 73  PHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYT----- 127
           P  R SSS    P+ +    I   G   NQS      Y D++  + + D    +T     
Sbjct: 82  PRYRHSSS----PIVSSENRIFVTGGLYNQSV-----YGDVWQITANAD-GTSFTPKAIQ 131

Query: 128 -SQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKN 186
             +N+P PR   A     +  V + GG+     ++      D +LF+  +++WT I Q  
Sbjct: 132 IDRNTPPPRVGHASTLCGNAYV-VFGGDTHKLNEDKLLD-DDIYLFNVNSYKWT-IPQPI 188

Query: 187 G--PSSRSGHRMTV-----WKNYIILHGGFRDLGTSTTYLNDCWLFDITTYK-----WQQ 234
           G  P  R GH++++      +  + L GG  D     TY ND  +FD+++++     W+ 
Sbjct: 189 GSRPLGRYGHKISIIAYNPMQTKLYLFGGQLD----KTYFNDLAMFDLSSFRRRNSHWEF 244

Query: 235 LQFPANHPIPDARSGHSLLPTPEGAILWGG----------YC---------KVKA----- 270
           L+ PA   +P   + H+++       ++GG          YC         K++      
Sbjct: 245 LE-PATT-VPPPLANHTMVTYGNKLWVFGGETPKTVSNETYCYDPIQNDWSKIETTGEIP 302

Query: 271 ------------------GKGLQKGKILTDCWYLKMKSDVTAIRWERRK--KQGFQPSSR 310
                             G          D ++L    D+ + +W +    K+G  P  R
Sbjct: 303 PPVQEHASVVYKHIMCVFGGKYTHNAYSNDVYFL----DLLSFKWYKLPHIKEGI-PRER 357

Query: 311 AGCSMVHHKGRGILFGGVYDYEETEEGLDSL 341
           +G S+   K   IL  G   ++    G D+L
Sbjct: 358 SGHSLTLMKNEKILIMGGDKFDYANSGTDNL 388

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 102/252 (40%), Gaps = 48/252 (19%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLF---DCAT 176
           W +   QNSP PR    +++  +  + + +I G    S        Y DTW+    D  T
Sbjct: 141 WNRVKLQNSPFPRYRHVASSNCSEDNSLYVIGGLHDQS-------VYGDTWIISTNDNGT 193

Query: 177 HEWTKIEQ--KNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
              +K  +  +  P  R GH  T+  N  +L GG    + +     +D +LF++ +YKW 
Sbjct: 194 QFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKW- 252

Query: 234 QLQFPANHPI---PDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS 290
               P  HPI   P  R GH +      +I+     K K       G    D ++  +  
Sbjct: 253 --TIP--HPIGPRPLGRYGHKI------SIMAANQMKTKL---YLFGGQFDDTYFNDLAV 299

Query: 291 -DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYN 344
            D+++ R     WE  K   F P      +M+ +     +FGG     +T +GL     N
Sbjct: 300 FDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG-----DTLQGL----IN 350

Query: 345 DLFTYHIETNRW 356
            +F Y +  N W
Sbjct: 351 QVFKYDVANNDW 362

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 92/196 (46%), Gaps = 31/196 (15%)

Query: 79  SSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SP 132
           S + AN +  K +L LFGG++ +       ++NDL ++ L +       W+       SP
Sbjct: 271 SIMAANQM--KTKLYLFGGQFDDT------YFNDLAVFDLSSFRRPDSHWEFLKPTTFSP 322

Query: 133 MPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG--PSS 190
            P ++  + ++    + + GG+      N  + Y      D A ++W+ I +  G  P  
Sbjct: 323 PPLTNHTMISY-DNHLWVFGGDTLQGLINQVFKY------DVANNDWS-IAETTGTKPPP 374

Query: 191 RSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQL-QFPANHPIPDARSG 249
              H   V+K+ +++ GG  +     TYLN  +  ++ T++W +L  F A   IP  RSG
Sbjct: 375 MQEHAAVVYKHVMVVVGGKDE---HDTYLNSVYFLNLKTHEWFKLPTFKAG--IPQGRSG 429

Query: 250 HSL-LPTPEGAILWGG 264
           HSL L   +  ++ GG
Sbjct: 430 HSLTLLNNDKLLIMGG 445

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 104/257 (40%), Gaps = 40/257 (15%)

Query: 123 WKKYTSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLF---DCATH 177
           W +   Q+SP PR     +++ S    + + GG            Y DTW+    D  T 
Sbjct: 94  WNRVKLQDSPFPRYRHVASSYVSDDNRIYVIGGLHDESV------YGDTWIINVDDSGTQ 147

Query: 178 EWTKIEQKN--GPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQQ 234
             +K    +   P  R GH  T+  N  ++ GG    + +     +D +LF+I ++KW  
Sbjct: 148 FSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMDDDLYLFNINSFKW-T 206

Query: 235 LQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-DVT 293
           +  P   P P  R GH +      +I+     K K       G    D ++  +   D++
Sbjct: 207 IPHPVG-PRPLGRYGHKI------SIIATNQMKTKL---YLFGGQFDDTFFNDLAVYDLS 256

Query: 294 AIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFT 348
           + R     WE  K + F P   A  +MV +  +  +FGG     +T +GL     N +F 
Sbjct: 257 SFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG-----DTMQGL----INKVFV 307

Query: 349 YHIETNRWYSVSLRAQR 365
           Y I +N W  V     R
Sbjct: 308 YDIMSNDWSLVETTGAR 324

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 26/184 (14%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAIAA 142
           K +L LFGG++ +       F+NDL +Y L +       W+    +   P P ++  + +
Sbjct: 232 KTKLYLFGGQFDDT------FFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVS 285

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG-PSSRSGHRMTVWKN 201
           +    + I GG+      N  +      ++D  +++W+ +E     P     H   ++K+
Sbjct: 286 Y-DHKLWIFGGDTMQGLINKVF------VYDIMSNDWSLVETTGARPPPLQEHAALIYKD 338

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPA-NHPIPDARSGHSLLPTPEGAI 260
            + + GG  +      YLN  +  ++ + +W   +FP     IP  RSGHS+       I
Sbjct: 339 LMCVVGGKDE---QDIYLNSIYFLNLKSCRW--FKFPVFKAGIPQGRSGHSITLLKNNKI 393

Query: 261 LWGG 264
           L  G
Sbjct: 394 LIMG 397

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 99/255 (38%), Gaps = 48/255 (18%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEW 179
           W +    +SP PR    ++A A+  + V +I G    S        Y DTW+   A    
Sbjct: 73  WNRIKLGSSPFPRYRHVASAYASEQNQVFVIGGLHDQSV-------YGDTWIL-TAHANN 124

Query: 180 TKIEQKN------GPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKW 232
           T+   K        P  R GH  T+  N  ++ GG    +       +D +LF+I +YKW
Sbjct: 125 TRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMDDDVYLFNINSYKW 184

Query: 233 QQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKA---GKGLQKGKILTDCWYLKMK 289
             +  P   P P  R GH +      +++     K K    G           C Y    
Sbjct: 185 T-IPHPVG-PRPLGRYGHKI------SVIATSQMKTKLYVFGGQFDDTYFNDLCVY---- 232

Query: 290 SDVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYN 344
            D+++ R     WE  K Q F P      +MV +  +  +FGG     +T +GL     N
Sbjct: 233 -DLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG-----DTAQGL----IN 282

Query: 345 DLFTYHIETNRWYSV 359
           ++F Y    N W  V
Sbjct: 283 EVFMYDPTVNDWTVV 297

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 81/169 (47%), Gaps = 24/169 (14%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQN-SPMPRSSAAIAA 142
           K +L +FGG++ +       ++NDL +Y L +       W+    Q+  P P ++  + +
Sbjct: 211 KTKLYVFGGQFDDT------YFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVS 264

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG-PSSRSGHRMTVWKN 201
           +    + I GG+ +    N      + +++D   ++WT +E     P +   H   V+K+
Sbjct: 265 Y-DYKLWIFGGDTAQGLIN------EVFMYDPTVNDWTVVETTGSKPPAIQEHAAVVYKD 317

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGH 250
            + + GG  +     +Y ND +  ++ ++KW +L F  N  +P  RSGH
Sbjct: 318 LMCVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKNG-VPQGRSGH 362

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 102/260 (39%), Gaps = 59/260 (22%)

Query: 123 WKKYTSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFY------HYSDTWLFDC 174
           W ++    SP PR     ++H S    + I GG     ++ + Y      ++ D   F  
Sbjct: 37  WNRFKLNPSPFPRYRHVASSHASKDDTLFIIGGL----REQSVYGDVWSINHKDDKSFSA 92

Query: 175 ATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
           ++ E T       P  R GH  T+  N +IL GG    +       +D +LF++ +YKW 
Sbjct: 93  SSIEITPT----TPPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKW- 147

Query: 234 QLQFPANHPI---PDARSGHSL-----LPTPEGAILWGGYCKVKAGKGLQKGKILTDCWY 285
               P   PI   P  R GH +      PT     L+GG                 D ++
Sbjct: 148 --TIP--EPIGLRPLGRYGHKISIIATQPTKTKLFLFGGQ--------------FDDTYF 189

Query: 286 LKMKS-DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLD 339
             +   D++  R     WE  K + F P   +  +M+ +  +  +FGG     ET +GL 
Sbjct: 190 NDLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG-----ETLQGL- 243

Query: 340 SLFYNDLFTYHIETNRWYSV 359
               N++F Y    N W  +
Sbjct: 244 ---INEVFVYDPIVNDWSVI 260

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 85/181 (46%), Gaps = 26/181 (14%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQNS-PMPRSSAAIAA 142
           K +L LFGG++ +       ++NDL ++ L T      QW+    ++  P P S+  + +
Sbjct: 174 KTKLFLFGGQFDDT------YFNDLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMIS 227

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVWKN 201
           +    + + GGE      N      + +++D   ++W+ IE   + P     H   V+KN
Sbjct: 228 Y-DNKLWVFGGETLQGLIN------EVFVYDPIVNDWSVIETTGSSPPPIQEHAAVVYKN 280

Query: 202 YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHP-IPDARSGHSLLPTPEGAI 260
            + + GG +D  +   Y+N  +  ++ T KW   + P  +P I   RSGH+     + +I
Sbjct: 281 LMCVVGG-KD--SKDNYMNSVYFLNLNTLKW--FKLPHINPGIMQGRSGHTATLLNDDSI 335

Query: 261 L 261
           L
Sbjct: 336 L 336

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 82/181 (45%), Gaps = 23/181 (12%)

Query: 91  ELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWKKYTSQNSPMPRSSAAIAAHPS 145
           EL LFGG+          ++NDL ++ L +       W+     ++  P  +        
Sbjct: 213 ELYLFGGQIDET------YFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFD 266

Query: 146 GVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPSSRSGHRMTVWKNYII 204
             + + GGE  +PK  +    +DT+ +D   + W+K+E     P     H   V+K+ + 
Sbjct: 267 NKLWVFGGE--TPKTIS----NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMC 320

Query: 205 LHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSL-LPTPEGAILWG 263
           + GG +D+    TY ND +  ++ + KW +L       IP  RSGHSL L   E  ++ G
Sbjct: 321 VFGG-KDI--HNTYSNDVYFLNLLSLKWFKLPC-VKEGIPQERSGHSLTLMNNEKLVIMG 376

Query: 264 G 264
           G
Sbjct: 377 G 377

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 58/143 (40%), Gaps = 26/143 (18%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEW 179
           W +   ++SP PR   SS+ I  +    + + GG +          Y D W    A    
Sbjct: 73  WNRIKLKDSPFPRYRHSSSFITTN-DNRIFVTGGLYDQSV------YGDVWEI-TANANG 124

Query: 180 TKIEQK------NGPSSRSGHRMTVWKN-YIILHGGFRDLGTSTTYLNDCWLFDITTYKW 232
           T    K      N P  R GH  T+  N Y++  G    L  +    +D +LF+I +YKW
Sbjct: 125 TSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLDDDLYLFNINSYKW 184

Query: 233 QQLQFPANHPI---PDARSGHSL 252
                P  HPI   P  R GH +
Sbjct: 185 ---TIP--HPIGSRPLGRYGHKI 202

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 95/256 (37%), Gaps = 45/256 (17%)

Query: 119 DTDQWKKYTSQNSPMPRSSAAIAAH--PSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCAT 176
           D   W K   + +P PR     +++  PS  + I+GG F S        Y DTW  +   
Sbjct: 18  DYSPWSKINVKGTPFPRYRHITSSYIYPSNDLYINGGLFESDV------YGDTWKLNIKE 71

Query: 177 ----------HEWTKIEQKNG--PSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLND-C 222
                     H    I    G  P  R GH  T+  N +I+ GG    +  S   ++D  
Sbjct: 72  NYNENDLERWHYSCNIIDIMGTTPPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDL 131

Query: 223 WLFDITTYKWQQLQFPANHPI-PDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILT 281
           +  ++ T KW     P+   I P  R GH +        L+GG         L K  +L 
Sbjct: 132 YFLNLDTTKWT---IPSPKGIRPLGRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN 188

Query: 282 DCWYLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGG-VYDYEETEEGLDS 340
                    D  + +WE  K +GF P   +  SM   + +  +FGG  Y           
Sbjct: 189 -------FKDANS-QWEFIKPKGFIPPPLSNFSMCTFENKLYVFGGDTY----------Q 230

Query: 341 LFYNDLFTYHIETNRW 356
           +  N+ F Y  E N W
Sbjct: 231 VLTNETFVYDPELNEW 246

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 69/161 (42%), Gaps = 16/161 (9%)

Query: 92  LILFGGEY--TNQSTGMTHFYNDLFIYSLDTDQWKKYTSQN-SPMPRSSAAIAAHPSGVV 148
           LI+FGG+    N S G+    +DL+  +LDT +W   + +   P+ R    I+   S + 
Sbjct: 110 LIVFGGDTHKVNVSNGLMD--DDLYFLNLDTTKWTIPSPKGIRPLGRYGHKISVINSNLY 167

Query: 149 LIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG-PSSRSGHRMTVWKNYIILHG 207
           L  GG+F     N    + D   F  A  +W  I+ K   P   S   M  ++N + + G
Sbjct: 168 LF-GGQFDETYFNDLVKF-DLLNFKDANSQWEFIKPKGFIPPPLSNFSMCTFENKLYVFG 225

Query: 208 GFRDLGTSTTYLNDCWLFDITTYKWQQL----QFPANHPIP 244
           G     T     N+ +++D    +W  L    Q   N P P
Sbjct: 226 G----DTYQVLTNETFVYDPELNEWSILETFGQEDTNKPPP 262

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 101/250 (40%), Gaps = 44/250 (17%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEW 179
           W +    NSP PR    ++A A+  + V +I G    S        Y DTW+   A    
Sbjct: 78  WSRVKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWII-SAHDNG 129

Query: 180 TKIEQKN------GPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKW 232
           +K   K        P  R GH  T+  N  ++ GG    + +     +D +LF+I +YKW
Sbjct: 130 SKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW 189

Query: 233 QQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
             +  P   P P  R GH +      +I+     + K       G    D ++  +   D
Sbjct: 190 -TIPRPVG-PRPLGRYGHKI------SIIATSQMRTKL---YVFGGQFDDTYFNDLTVFD 238

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     W+  K   F P      +M+ +  +  +FGG     +T +GL     ND+
Sbjct: 239 LSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----DTPQGL----INDV 289

Query: 347 FTYHIETNRW 356
           F +  + N W
Sbjct: 290 FMFDPQINDW 299

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 85/194 (43%), Gaps = 28/194 (14%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT----DQWKKYTSQNS--PMPRSSAAIAA 142
           + +L +FGG++ +       ++NDL ++ L +    D   ++   N+  P P ++  + +
Sbjct: 216 RTKLYVFGGQFDDT------YFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMIS 269

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG--PSSRSGHRMTVWK 200
           +    + + GG+      N      D ++FD   ++W K+ Q  G  P     H   ++ 
Sbjct: 270 Y-DYKLWVFGGDTPQGLIN------DVFMFDPQINDW-KVMQTTGDKPPPLQEHAAVLYG 321

Query: 201 NYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPA-NHPIPDARSGHSLLPTPEGA 259
           + + + GG  +      Y N  +  ++ + KW   + P+    IP  RSGHSL   P   
Sbjct: 322 DLMCVVGGKDE---QDVYSNSVFFLNLISLKW--FKLPSYRSGIPQGRSGHSLTLLPNHK 376

Query: 260 ILWGGYCKVKAGKG 273
           +L  G  K    +G
Sbjct: 377 LLIMGGDKFDYARG 390

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 101/260 (38%), Gaps = 42/260 (16%)

Query: 123 WKKYTSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEW- 179
           W +   QNSP PR     +++ S  G + + GG            Y DTW+     +   
Sbjct: 160 WNRIKLQNSPFPRYRHVASSYVSDDGKIYVIGGLHDQSV------YGDTWILSYENNGLS 213

Query: 180 TKIEQK------NGPSSRSGHRMTVWKN-YIILHGGFRDLGTSTTYLNDCWLFDITTYKW 232
           T I  K      N P  R GH  T+  N ++I  G    +    +  +D +LF+I +YKW
Sbjct: 214 TTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGSMDDDIYLFNINSYKW 273

Query: 233 QQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-D 291
              +     P+   R GH +      +I+     K K       G    D ++  +   D
Sbjct: 274 TIPKPVGQRPL--GRYGHKI------SIIATSQMKTKL---YLFGGQFDDTYFNDLVVFD 322

Query: 292 VTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDL 346
           +++ R     WE  + + F P      +M  +  +  +FGG     +T +GL     N +
Sbjct: 323 LSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG-----DTLQGL----TNQV 373

Query: 347 FTYHIETNRWYSVSLRAQRH 366
           F Y    N W  V   A  +
Sbjct: 374 FMYDPVDNDWCVVETFANNN 393

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 79/189 (41%), Gaps = 30/189 (15%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT----DQWKKYTSQNS--PMPRSSAAIAA 142
           K +L LFGG++ +       ++NDL ++ L +    D   ++    S  P P ++  + +
Sbjct: 300 KTKLYLFGGQFDDT------YFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCS 353

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQ-------KNGPSSRSGHR 195
           +   + +  G          F       ++D   ++W  +E         N P     H 
Sbjct: 354 YDHKLWVFGGDTLQGLTNQVF-------MYDPVDNDWCVVETFANNNDVSNIPPPIQEHA 406

Query: 196 MTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPT 255
             ++K+ + + GG  +   S  YLND +  ++ T KW +L F     +P  RSGHS+   
Sbjct: 407 AVLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTLL 462

Query: 256 PEGAILWGG 264
               IL  G
Sbjct: 463 KNDKILIMG 471

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 100/261 (38%), Gaps = 60/261 (22%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL-------- 171
           W +   ++SP PR    +++ A     V +I G    S        + D W+        
Sbjct: 197 WNRIKLKDSPFPRYRHVTSSYATEDDRVFVIGGLHDQS-------VFGDVWIIKSLENGT 249

Query: 172 -FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITT 229
            F   T + T+    N P  R GH  T+  N  ++ GG    +       +D +LF+I +
Sbjct: 250 KFTSTTIDITE----NTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMDDDLYLFNINS 305

Query: 230 YKWQQLQFPANHPIPDARSGHSL-----LPTPEGAILWGGYCKVKAGKGLQKGKILTDCW 284
           YKW  +  P   P P  R GH +      P      L+GG                 D +
Sbjct: 306 YKWT-IPNPIG-PRPLGRYGHKVSIIATTPMKTKLYLFGGQ--------------FDDTY 349

Query: 285 YLKMKS-DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGL 338
           +  +   D++  R     WE  K + F P      +MV ++ +  +FGG     +T +GL
Sbjct: 350 FNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG-----DTLQGL 404

Query: 339 DSLFYNDLFTYHIETNRWYSV 359
                N +F Y  E N W  V
Sbjct: 405 ----INKIFMYDPEVNDWTVV 421

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 84/189 (44%), Gaps = 36/189 (19%)

Query: 79  SSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQ--------N 130
           S +   P+  K +L LFGG++ +       ++N+L ++  D  Q+++  S          
Sbjct: 327 SIIATTPM--KTKLYLFGGQFDDT------YFNNLAVF--DLSQFRRPDSHWEFLKPKSF 376

Query: 131 SPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIE------- 183
            P P ++  + ++    + I GG+      N  +      ++D   ++WT +E       
Sbjct: 377 MPPPLTNHTMVSY-QNKLWIFGGDTLQGLINKIF------MYDPEVNDWTVVETFPANND 429

Query: 184 QKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPI 243
           Q+N P     H   ++ + +++ GG  +      YLN  +   I T +W +L F  +  I
Sbjct: 430 QENFPPPMQEHASVMYGDLMVVMGGKDE---QDNYLNTVYFLKINTLEWYKLPF-LSVGI 485

Query: 244 PDARSGHSL 252
           P  RSGHS+
Sbjct: 486 PQGRSGHSI 494

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 105/258 (40%), Gaps = 42/258 (16%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLF----DCA 175
           W++    NSP PR    ++A A+  + V +I G    S        Y DTW+     + A
Sbjct: 76  WRRIKLANSPFPRYRHVASAYASEQNQVYVIGGLHDQS-------VYGDTWIVTSHENGA 128

Query: 176 THEWTKIEQKNG-PSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
                 +E  +  P  R GH  T+  N  ++ GG    + +     +D +LF+I +YKW 
Sbjct: 129 RFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMDDDVYLFNINSYKW- 187

Query: 234 QLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-DV 292
            +  P   P P  R GH +      +I+     K K       G    D ++  +   D+
Sbjct: 188 TIPNPVG-PRPLGRYGHKI------SIIAMSPMKTKL---YVFGGQFDDTYFNDLAVFDL 237

Query: 293 TAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           ++ R     W+      F P      +M+ +  +  +FGG     +T +GL     +D+F
Sbjct: 238 SSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG-----DTPQGL----IDDVF 288

Query: 348 TYHIETNRWYSVSLRAQR 365
            +  + N W  +    Q+
Sbjct: 289 VFDPQVNDWKFIQTTGQK 306

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 103/237 (43%), Gaps = 33/237 (13%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDT----DQWKKYTSQNS--PMPRSSAAIAA 142
           K +L +FGG++ +       ++NDL ++ L +    D   ++ + NS  P P ++ A+ +
Sbjct: 214 KTKLYVFGGQFDDT------YFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMIS 267

Query: 143 HPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG--PSSRSGHRMTVWK 200
           +    + + GG+  +P+        D ++FD   ++W K  Q  G  P     H   ++ 
Sbjct: 268 Y-DYKLWVFGGD--TPQG----LIDDVFVFDPQVNDW-KFIQTTGQKPPPLQEHASVLYG 319

Query: 201 NYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAI 260
           + + + GG  +      Y N  +  ++ + KW +  F     IP  RSGHSL   P   +
Sbjct: 320 DLMCIVGGKDE---QDVYSNGVYFLNLISLKWFKFPF-FRAGIPQGRSGHSLTLLPNHKL 375

Query: 261 LWGGYCKVKAGKG----LQKGKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSRAGC 313
           L  G  K    +G        ++   C  L    D++ +   R +  G   ++RAG 
Sbjct: 376 LIMGGDKFDYARGGDDDFHTSEVDMACGTLLYTLDLSKL---REQCPGIFDTNRAGA 429

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 91/200 (45%), Gaps = 39/200 (19%)

Query: 79  SSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNS------- 131
           S +  NP+  K  L LFGG+          ++NDL ++ L +     +   NS       
Sbjct: 203 SIIANNPMQTK--LFLFGGQIDET------YFNDLAMFDLSS-----FRRPNSHWVFLKP 249

Query: 132 ----PMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG 187
               P P ++  +    + +  + GG+  +   N      +T+ +D   ++W+KI Q  G
Sbjct: 250 VSIVPPPLTNHTMVTFDNKL-WVFGGKTPNTLSN------ETFCYDPVQNDWSKI-QTTG 301

Query: 188 --PSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPD 245
             P +   H   V+K+ + + GG +D+  +  Y ND +  ++ T+KW +L       +P 
Sbjct: 302 ERPPAVQEHASVVYKHLMCIFGG-KDIQNA--YSNDVYFLNLITFKWYKLP-RIKEGLPK 357

Query: 246 ARSGHSL-LPTPEGAILWGG 264
            RSGHSL L   +  ++ GG
Sbjct: 358 ERSGHSLTLIKNDKLVIMGG 377

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 62/155 (40%), Gaps = 21/155 (13%)

Query: 123 WKKYTSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDC---ATH 177
           W +   +NSP PR   SA+        + + GG       +    Y DTW        T 
Sbjct: 73  WNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGG------LHDHLVYGDTWQITGNLDGTS 126

Query: 178 EWTKIEQ--KNGPSSRSGHRMTVWKN-YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQ 234
             +K  Q  +N P  R GH  T+  N Y++  G    L  +    +D +LF+I +YKW  
Sbjct: 127 FVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLDDDLYLFNINSYKWTI 186

Query: 235 LQFPANHPIPDARSGHSLL-----PTPEGAILWGG 264
            Q     P+   R GH +      P      L+GG
Sbjct: 187 PQPVGTRPL--GRYGHKISIIANNPMQTKLFLFGG 219

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 78/195 (40%), Gaps = 35/195 (17%)

Query: 173 DCATHEWTKIEQKNGPSSRSGHR---MTVWKNYIILHGGFRDLGTSTTYLNDCWL----F 225
           D   + W +I+ KN P  R  H    +    N I + GG  D         D W      
Sbjct: 67  DAGKYVWNRIKLKNSPFPRYRHSASPIVTNDNRIFVTGGLHD----HLVYGDTWQITGNL 122

Query: 226 DITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWY 285
           D T++  + +Q   N P P  R GH+        +++GG         L   ++L D  Y
Sbjct: 123 DGTSFVSKTIQIGQNTPPP--RVGHASTICGNAYVVFGGDT-----HKLNMNRLLDDDLY 175

Query: 286 LKMKSDVTAIRWERRKKQGFQPSSRAG--CSMVHH---KGRGILFGGVYDYEETEEGLDS 340
           L    ++ + +W   +  G +P  R G   S++ +   + +  LFGG          +D 
Sbjct: 176 L---FNINSYKWTIPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGG---------QIDE 223

Query: 341 LFYNDLFTYHIETNR 355
            ++NDL  + + + R
Sbjct: 224 TYFNDLAMFDLSSFR 238

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 99/251 (39%), Gaps = 40/251 (15%)

Query: 123 WKKYTSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL---FDCATH 177
           W +   + SP PR    A+  A  SG + + GG            Y DTW+    D AT 
Sbjct: 93  WNRIRLKQSPFPRYRHVASSYATDSGELFVIGGLHDQSV------YGDTWIIKSLDNATS 146

Query: 178 --EWTKIEQKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQQ 234
               T       P  R GH  T+  N  ++ GG    +  +    +D +LF+I ++KW  
Sbjct: 147 FKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMDDDIYLFNINSHKW-T 205

Query: 235 LQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-DVT 293
           +  P   P P  R GH +      +I+     K K       G    D ++  +   D++
Sbjct: 206 IPTPQG-PRPLGRYGHKI------SIIAANQMKTKL---YVFGGQFDDTYFNDLAEFDLS 255

Query: 294 AIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFT 348
           + R     WE  K   F P   A  +M+    +  +FGG     +T +GL     N++F 
Sbjct: 256 SFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DTPQGL----TNEVFM 306

Query: 349 YHIETNRWYSV 359
           +    N W  V
Sbjct: 307 FDPAANDWCVV 317

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 90/197 (45%), Gaps = 33/197 (16%)

Query: 79  SSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQW---KKYTSQN 130
           S + AN +  K +L +FGG++ +       ++NDL  + L +       W   K  T   
Sbjct: 223 SIIAANQM--KTKLYVFGGQFDDT------YFNDLAEFDLSSFRRSDSHWEFIKPATFMP 274

Query: 131 SPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQK-NGPS 189
            P+   +     H    + + GG+  +P+  T    ++ ++FD A ++W  ++   N P 
Sbjct: 275 PPLANHTMISFDHK---LWVFGGD--TPQGLT----NEVFMFDPAANDWCVVQTTGNIPP 325

Query: 190 SRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPA-NHPIPDARS 248
               H   ++++ + + GG +D      Y N  +  +  + KW   + P  N+ IP ARS
Sbjct: 326 PLQEHAAIIYRDLMCVFGG-KD--AQDNYSNAVYFLNFRSLKW--FKLPTFNNMIPRARS 380

Query: 249 GHSL-LPTPEGAILWGG 264
           GHSL L +    ++ GG
Sbjct: 381 GHSLTLLSNNKLLIMGG 397

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 95/253 (37%), Gaps = 50/253 (19%)

Query: 123 WKKYTSQNSPMPRSS--AAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWT 180
           W +    +SP+PR    A+  A P   + + GG            Y DTW+    +    
Sbjct: 162 WGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGE------LVYGDTWMLTANSDSTN 215

Query: 181 KIEQK-----NGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQQ 234
              Q      N P  R GH  T+  N +++ GG    L +     +D +LF++ +++W  
Sbjct: 216 FTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTI 275

Query: 235 LQFPANHPIPDARSGHS---LLPTPEGA--ILWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
                  P+   R GH    +  TP+ A   L+GG               L D ++  + 
Sbjct: 276 PTPIGTRPL--GRYGHQVSVIATTPKKAKLYLFGGQ--------------LDDNYFNDLA 319

Query: 290 S-DVTAI-----RWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFY 343
             D++       RW+  K + F P      +MV +  +  +FGG    E           
Sbjct: 320 MYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGE---------LQ 370

Query: 344 NDLFTYHIETNRW 356
           N L+ Y  + N W
Sbjct: 371 NQLYVYIPDLNEW 383

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 89  KRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQ--NSPMPRSSAAIAAHPSG 146
           K  + +FGG+  +       + N ++  +L T +W +  +   N P+PRS  +++   + 
Sbjct: 405 KNLMCVFGGKNKDD-----EYQNTMYFLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQND 459

Query: 147 VVLIHGGE 154
            +LI GG+
Sbjct: 460 KILIMGGD 467

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 100/259 (38%), Gaps = 52/259 (20%)

Query: 123 WKKYTSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLFDCA----- 175
           W +    NSP PR     ++H +  G + + GG            Y DTW+   +     
Sbjct: 147 WGRIRLSNSPFPRYRHVSSSHITDQGKIYVIGGLHDQSV------YGDTWILTASDIDKT 200

Query: 176 ----THEWTKIE-QKNGPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITT 229
               + + T IE  ++ P  R GH  T+  N  ++ GG    + +     +D +L +I +
Sbjct: 201 GAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINS 260

Query: 230 YKWQQLQFPANHPIPDARSGHSLLPTPEGAI---LWGGYCKVKAGKGLQKGKILTDCWYL 286
           YKW   +     P+   R GH ++          L+GG                 D ++ 
Sbjct: 261 YKWTIPKPVGQRPL--GRYGHKIVTISAEQTKLYLFGGQ--------------FDDTYFG 304

Query: 287 KMKS-DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDS 340
            +   D+++ R     W   K  GF P      +MV ++ +  +FGG    +  EEGL  
Sbjct: 305 DLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG----DTLEEGL-- 358

Query: 341 LFYNDLFTYHIETNRWYSV 359
              N ++ Y    N W  V
Sbjct: 359 --INRVYLYSPTNNSWEIV 375

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 25/182 (13%)

Query: 91  ELILFGGEYTNQSTGMTHFYNDLFIYSLDT-----DQWK--KYTSQNSPMPRSSAAIAAH 143
           +L LFGG++ +       ++ DL ++ L +       W   K +  N P P ++  +  +
Sbjct: 290 KLYLFGGQFDDT------YFGDLAVFDLSSFRRPDSHWVFLKPSGFNPP-PLTNHTMVTY 342

Query: 144 PSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNG-PSSRSGHRMTVWKNY 202
              + +  G        N  Y YS T       + W  +E     P     H   V+K+ 
Sbjct: 343 QDKIWVFGGDTLEEGLINRVYLYSPT------NNSWEIVETTGDIPPPMQEHAAIVYKDL 396

Query: 203 IILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILW 262
           + + GG +D      YLN  +  ++ + KW +L F  N+ IP  RSGHS+       IL 
Sbjct: 397 MCVVGG-KD--AEDNYLNTLYFLNLQSLKWFKLPFYKNN-IPQGRSGHSVTLLKNDQILI 452

Query: 263 GG 264
            G
Sbjct: 453 MG 454

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 105/285 (36%), Gaps = 67/285 (23%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCAT--- 176
           W +Y   NSP PR    ++++ +  + V +I G    S        Y DTW+    T   
Sbjct: 55  WCRYKLHNSPFPRYRHVASSVVSSDNKVFVIGGLHDQS-------VYGDTWIISENTINI 107

Query: 177 ----------------------HEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGT 214
                                  +  +I +   P  R GH  T+  N  ++ GG      
Sbjct: 108 NSPATMHTPTSTTSTTSNISFSSKTVEITEY-TPPPRVGHASTLCGNAFVIFGGDTHKTN 166

Query: 215 STTYL-NDCWLFDITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKA--- 270
               + +D +LF+I +YKW   Q P   P P  R GH +      +I+     K K    
Sbjct: 167 KDGLMDDDIYLFNINSYKWTIPQ-PVG-PRPLGRYGHKI------SIIATSQMKTKLYVF 218

Query: 271 GKGLQKGKILTDCWYLKMKSDVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILF 325
           G           C Y     D+++ R     WE  K + F P      +MV +  +  +F
Sbjct: 219 GGQFDDSYFNDLCVY-----DLSSFRKPESHWEFLKPKSFIPPPLTNHTMVSYDYKLWVF 273

Query: 326 GGVYDYEETEEGLDSLFYNDLFTYHIETNRWYSVSLRAQRHSKVK 370
           GG     +T++GL     N LF +    N W  V    ++   V+
Sbjct: 274 GG-----DTQQGL----INQLFMFDPVINDWRVVETTGEKPPPVQ 309

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 99/259 (38%), Gaps = 48/259 (18%)

Query: 119 DTDQWKKYTSQNSPMPR--SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL----- 171
           D   W +     SP PR    A+  A  S  V + GG            Y DTW+     
Sbjct: 154 DETPWNRVKLLQSPFPRYRHVASSYASDSNEVFVIGGLHDQSV------YGDTWIIKSHE 207

Query: 172 ----FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYL-NDCWLFD 226
               F   T E T+      P  R GH  T+  N  ++ GG      +   + +D +L +
Sbjct: 208 NGNKFTSKTVEITETT----PPPRVGHASTLCGNAFVIFGGDTHKTNAEGLMDDDVYLLN 263

Query: 227 ITTYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYL 286
           I ++KW  +  P   P P  R GH +      +I+     K K       G    D ++ 
Sbjct: 264 INSHKW-TIPRPVG-PRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYFN 312

Query: 287 KMKS-DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDS 340
            +   D+++ R     W+  K   F P      +MV +  +  +FGG     +T +GL  
Sbjct: 313 DLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL-- 365

Query: 341 LFYNDLFTYHIETNRWYSV 359
              N+LF Y   TN W  V
Sbjct: 366 --INELFMYDPTTNDWSVV 382

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 97/242 (40%), Gaps = 42/242 (17%)

Query: 123 WKKYTSQNSPMPRSSAAIAAHPS--GVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWT 180
           W +    NSP PR     +++ S    + + GG            Y DTW    +T+  T
Sbjct: 142 WNRIKLTNSPFPRYRHVASSYESVDNEIFVIGGLHDQSV------YGDTWSI-TSTNNGT 194

Query: 181 KIEQKN------GPSSRSGHRMTVWKNYIILHGG-FRDLGTSTTYLNDCWLFDITTYKWQ 233
           +   K        P  R GH  T+  N  ++ GG    +       +D +LF+I ++KW 
Sbjct: 195 QFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLMDDDIYLFNINSHKWT 254

Query: 234 QLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS-DV 292
            +  P   P P  R GH +      +I+     K K       G    D ++  +   D+
Sbjct: 255 -IPSPVG-PRPLGRYGHKI------SIIATSSSKTKL---YLFGGQFDDTYFNDIAVFDL 303

Query: 293 TAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347
           ++ R     WE  K +G  P      +MV +  +  +FGG     +T++GL     ND++
Sbjct: 304 SSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG-----DTKDGL----INDIY 354

Query: 348 TY 349
            +
Sbjct: 355 AF 356

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 100/256 (39%), Gaps = 50/256 (19%)

Query: 123 WKKYTSQNSPMPR---SSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWL-------- 171
           W +     +P PR    ++A A+  + V++I G    S        Y DTW+        
Sbjct: 52  WDRVKLVQTPFPRYRHVASAYASDTNEVIVIGGLHDQS-------VYGDTWILRAQDNGK 104

Query: 172 -FDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYL-NDCWLFDITT 229
            F   T E T+      P  R GH  T+  N  ++ GG      +   + +D +L ++ +
Sbjct: 105 QFSARTIEITETT----PPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMDDDVYLLNVNS 160

Query: 230 YKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMK 289
           +KW  +  P   P P  R GH +      +I+     K K       G    D ++  + 
Sbjct: 161 HKW-TIPHPVG-PRPLGRYGHKI------SIIATSQMKTKL---YVFGGQFDDTYFNDLA 209

Query: 290 S-DVTAIR-----WERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFY 343
             D+++ R     W   K   F P      +MV +  +  +FGG     +T +GL     
Sbjct: 210 VYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG-----DTPQGL----I 260

Query: 344 NDLFTYHIETNRWYSV 359
           N+LF Y    N W  V
Sbjct: 261 NELFVYDPVVNDWSVV 276

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 57/119 (47%), Gaps = 15/119 (12%)

Query: 64  AVNVETVERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTD-Q 122
           ++ VE  E  + R   + V +P  NK++L+ FGG    ++       N++     D D +
Sbjct: 349 SLPVEYFEIANVRKFGASVLDP--NKKQLLYFGGSCPQRT-------NEIISIGPDGDCE 399

Query: 123 WKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTK 181
              +    +P+ R+        +   ++ GG     ++N +   SDTW+F+ ++HEWT+
Sbjct: 400 AVPFDKTTAPVARACHTFTLVNNDTAMVVGG-----RRNPWQPLSDTWMFNLSSHEWTR 453

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 59/153 (38%), Gaps = 34/153 (22%)

Query: 171 LFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTY 230
           LF   + + TK    +GP  +     T   + +++HGG      +T   +D W FD  T 
Sbjct: 627 LFPIGSPKSTKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETE 682

Query: 231 KWQQLQFPANH------PIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCW 284
            W Q++  A        PI  A +GHS+      +I  GG                    
Sbjct: 683 SWVQIETQAQTEDKGLVPIEMALAGHSMATVGSASIFVGG-------------------- 722

Query: 285 YLKMKSDVTAIRWERRKKQGFQPSSRAGCSMVH 317
              M+SDV  +    RK     P +  GC+M++
Sbjct: 723 --MMQSDVDKLYL--RKHSMPLPPNAPGCTMLN 751

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 15/81 (18%)

Query: 148 VLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNGPSSR---------SGHRMTV 198
           +++HGG       N  + YSD W FD  T  W +IE +     +         +GH M  
Sbjct: 659 LVMHGG------SNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMAT 712

Query: 199 WKNYIILHGGFRDLGTSTTYL 219
             +  I  GG         YL
Sbjct: 713 VGSASIFVGGMMQSDVDKLYL 733

>TDEL0A00340 Chr1 (58839..60872) [2034 bp, 677 aa] {ON} Anc_3.15
           YOL141W
          Length = 677

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 12/101 (11%)

Query: 111 NDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTW 170
           N+L    +DT  +    +  +P  R    + +  S    +  G   SPK      Y+DTW
Sbjct: 400 NELIEVDVDTGNYIPLDTGEAPPVRMCHTLTSLGSSQEFMMIGGRQSPKDG----YTDTW 455

Query: 171 LFDCATHEWTKIEQKNGPS---SRSGHRMTVWKNYIILHGG 208
           +F+  ++ W     + GPS   SR  H   + +N I++ GG
Sbjct: 456 VFNMGSNLW-----RQGPSLPESRYRHAACLIENQILVFGG 491

>KAFR0I02910 Chr9 complement(582726..584801) [2076 bp, 691 aa] {ON}
           Anc_3.15 YOL141W
          Length = 691

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 95/233 (40%), Gaps = 45/233 (19%)

Query: 125 KYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQ 184
           ++TS    + R+  +   H  G ++  GG   +P +      SDT   D   + + +++ 
Sbjct: 382 EFTSLEYDLKRNFGSSIKHDEGNIMYTGG--CNPNR-----ISDTLKIDTQKNTFIQLQN 434

Query: 185 KNG-PSSRSGHRMTVWKN--YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANH 241
            +  P +R+ H  T   +    ++ GG          +NDCW +++ T +WQ+       
Sbjct: 435 HSVLPPARACHTFTRLGDGETAMVIGG---RNAPHRAVNDCWFYNLNTNEWQK-----GP 486

Query: 242 PIPDARSGHSLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKS---DVTAIRWE 298
            +P+ R  HS + T +  +L  G      GK   +  +L D      K    D  +++  
Sbjct: 487 ELPEPRFRHSCVATDKNTLLVCG------GKTDGQAFLLYDNISETFKPCPVDHPSLKI- 539

Query: 299 RRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGL--DSLFYNDLFTY 349
                   P   A  +      RGI+ GG      +E G+  DSLF   +FTY
Sbjct: 540 --------PLISAAVAFDEKNNRGIIMGGY----NSETGMISDSLF---VFTY 577

>NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa]
           {ON} Anc_7.9 YAL056W
          Length = 913

 Score = 35.4 bits (80), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 17/86 (19%)

Query: 147 VVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQ-----------KNGPSSRSGHR 195
           +++IHGG       N    Y D W FD    +WTKI+             N   +  GH 
Sbjct: 728 MIIIHGG------SNDHKVYGDMWWFDVEMEKWTKIDMYAETNDAKEGLVNCDLALVGHT 781

Query: 196 MTVWKNYIILHGGFRDLGTSTTYLND 221
           M +  +Y I  GG       T ++++
Sbjct: 782 MAIIGHYAISVGGLIQQDVDTLFISE 807

>KAFR0I00200 Chr9 (39428..41689) [2262 bp, 753 aa] {ON} Anc_7.9
           YAL056W
          Length = 753

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 32/84 (38%), Gaps = 9/84 (10%)

Query: 186 NGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPAN----- 240
           N    R G   T     II+HGG  +         D W FD+ +  W +L   A      
Sbjct: 630 NTNEKRGGKNRTDVPKTIIIHGGSNNFDV----FGDLWWFDLESLTWNKLDISAKINGTL 685

Query: 241 HPIPDARSGHSLLPTPEGAILWGG 264
            P+     GH+++     AI  GG
Sbjct: 686 QPVELKLVGHTMVNIGHVAIFSGG 709

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 43/96 (44%), Gaps = 11/96 (11%)

Query: 146 GVVLIHGGEFSSP-KQNTFYHYSDTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKN--- 201
           G + I GG   SP  +  F   +D W  D   ++W+ + +  G   R  H M V  +   
Sbjct: 170 GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDP 229

Query: 202 ----YIILHGGFRDLGTSTTYLNDCWLFDITTYKWQ 233
                +++ GG  ++      ++   +F++TT +W+
Sbjct: 230 TKDTKLVIVGGIDNMDEPVAKID---IFNLTTLQWE 262

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 10/71 (14%)

Query: 203 IILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANH------PIPDARSGHSLLPTP 256
           +I+HGG       T    D W +DI T  W Q+     H      PI     GHSL+   
Sbjct: 671 LIMHGG----SNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVG 726

Query: 257 EGAILWGGYCK 267
             A+  GG  +
Sbjct: 727 GMAVFVGGLLQ 737

>Kpol_538.45 s538 complement(101351..103897) [2547 bp, 848 aa] {ON}
           complement(101351..103897) [2547 nt, 849 aa]
          Length = 848

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 58/159 (36%), Gaps = 37/159 (23%)

Query: 203 IILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPD-------ARSGHSLLPT 255
           +I+HGG       T  + D WLF+ T   W+   F   +P  D          GH+L   
Sbjct: 666 LIIHGG----SDHTNVIGDMWLFNFTKETWEHEHFLIKNPQEDRYKAIDIPLVGHTLTFI 721

Query: 256 PEGAILWGGYCK------------VKAG---KGLQKGKILTD----------CWYLKMKS 290
              A+ +GG  +             K G   +GL  G  L +             LK+ +
Sbjct: 722 GYSAVSFGGLTQDDINSVYNLGDEAKVGGDHEGLALGSNLVNYINLKTFQLESKELKLVA 781

Query: 291 DVTAIRWERRKKQGFQPSSRA-GCSMVHHKGRGILFGGV 328
                +  R K    + +  A GC +  + G  +L GGV
Sbjct: 782 GTDEYKLVRDKTVNARSTVLAIGCIVAMNNGSYLLIGGV 820

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 35/76 (46%), Gaps = 12/76 (15%)

Query: 203 IILHGGFRDLGTSTTYLNDCWLFDITTYKWQQL--------QFPANHPIPDARSGHSLLP 254
           I+LHGG  D    T    D W FD+ T++W ++        Q  +  PI     GH+++ 
Sbjct: 696 IVLHGGSDD----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKIVGHTMMT 751

Query: 255 TPEGAILWGGYCKVKA 270
           +   A+  GG  + + 
Sbjct: 752 SGCMAVCVGGITQAEV 767

>Suva_15.19 Chr15 (34295..36421) [2127 bp, 708 aa] {ON} YOL141W
           (REAL)
          Length = 708

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 63/160 (39%), Gaps = 16/160 (10%)

Query: 111 NDLFIYSLDTDQWKKYT----SQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHY 166
           N++   S+  D+    T    S   P+ R    + +      L+  G   +P Q      
Sbjct: 425 NEILQLSISNDKMNIQTIEPISNELPLARMCHTLTSFCGSSQLLLVGGRKAPHQG----L 480

Query: 167 SDTWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFD 226
           SD W+FD  T+EW+ +++ +    R      +  N +++ GG         Y  +   F 
Sbjct: 481 SDNWIFDTKTNEWSMVQKLSHTRFRHS-ACNLSDNSVLIFGGVTKGPVMLRYDANEQAFQ 539

Query: 227 ITTYKWQQLQFPANHPIPDARSGHSLLP-TPEGAILWGGY 265
             T K    Q    H +  A  G +  P + +G IL GG+
Sbjct: 540 DITPKDAFFQ----HSLVSA--GLAFNPVSKQGVILGGGF 573

>KNAG0A01180 Chr1 (9765..11795) [2031 bp, 676 aa] {ON} Anc_3.15
           YOL141W
          Length = 676

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 6/98 (6%)

Query: 110 YNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169
           YND++IY  + + W++ TS   P PR     A      VLI+GG  SS    T ++  D 
Sbjct: 447 YNDIWIYDTEHNLWEQKTSL--PYPRFRHCTAQVDENCVLIYGG--SSTLSVTPFNICDV 502

Query: 170 WLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHG 207
                   E + + +    S+   H       Y+IL G
Sbjct: 503 KNGTVTVPEGSAVLKCLASSAMDRH--PALNEYVILGG 538

>YOR371C Chr15 complement(1031489..1034182) [2694 bp, 897 aa] {ON}
           GPB1Multistep regulator of cAMP-PKA signaling; inhibits
           PKA downstream of Gpa2p and Cyr1p, thereby increasing
           cAMP dependency; promotes ubiquitin-dependent
           proteolysis of Ira2p; regulated by G-alpha protein
           Gpa2p; homolog of Gpb2p
          Length = 897

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 55/157 (35%), Gaps = 32/157 (20%)

Query: 72  RPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQNS 131
           RP  + S  L  N  H+++E                H  N     S DT       + +S
Sbjct: 641 RPGNKPSQPLFPNIPHSRKE--------KKSGRDSMHISNSNNSTSEDTSSKSTRNTTSS 692

Query: 132 PM-------PRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKI-- 182
           P        P + +   A     +  HGG       + +   SD W FD  +  WTKI  
Sbjct: 693 PPTSPKHTPPLNPSKKCASIGRTIAFHGG------SDGYDVCSDMWWFDFDSETWTKIDL 746

Query: 183 -----EQKNGPS----SRSGHRMTVWKNYIILHGGFR 210
                E+ +G         GH MT   + ++L GG R
Sbjct: 747 YAKTQEESDGLVPINLCMVGHSMTTVGHKVVLIGGLR 783

>Suva_8.427 Chr8 complement(769308..772004) [2697 bp, 898 aa] {ON}
           YOR371C (REAL)
          Length = 898

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 30/75 (40%), Gaps = 17/75 (22%)

Query: 147 VVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKI-------EQKNGPS----SRSGHR 195
           VV  HGG       + +    D W FD  +  WTKI       E+ +G         GH 
Sbjct: 716 VVAFHGG------SDCYSVCCDMWWFDFDSEVWTKIDLYAKTQEESDGLVPINLCMVGHS 769

Query: 196 MTVWKNYIILHGGFR 210
           MT     ++L GG R
Sbjct: 770 MTTVGRKVVLIGGLR 784

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,084,529
Number of extensions: 2592635
Number of successful extensions: 7009
Number of sequences better than 10.0: 72
Number of HSP's gapped: 6773
Number of HSP's successfully gapped: 105
Length of query: 640
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 524
Effective length of database: 40,180,143
Effective search space: 21054394932
Effective search space used: 21054394932
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)