Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR015W6.11ON55255227200.0
Ecym_30146.11ON55154917610.0
SAKL0E00902g6.11ON54454416400.0
Kwal_56.223556.11ON54154114890.0
KLTH0C11506g6.11ON54454114600.0
KLLA0D00858g6.11ON54153413640.0
Kpol_1032.26.11ON53952813470.0
TBLA0G009806.11ON55855513071e-175
TPHA0M002106.11ON54552913001e-174
Suva_5.106.11ON55353412891e-172
TDEL0G046006.11ON52852812741e-170
NDAI0K028906.11ON56154112741e-170
Skud_5.316.11ON55754912611e-168
ZYRO0F00506g6.11ON55056312601e-168
NCAS0F002006.11ON54953712571e-168
Smik_5.296.11ON55555612481e-166
YEL058W (PCM1)6.11ON55754812481e-166
KAFR0L003406.11ON54052612371e-165
CAGL0B03597g6.11ON54053812111e-161
KNAG0E009406.11ON53853611451e-151
Ecym_46118.840ON63042910.017
KLLA0D01573g8.840ON60739910.022
TDEL0B005708.840ON63047910.022
TPHA0I002508.840ON62953870.053
Kwal_27.102588.840ON62077870.060
KAFR0B039208.840ON62447860.080
Kpol_1068.88.840ON63227860.088
NDAI0K004108.840ON62640840.12
TBLA0B032508.840ON64365820.22
NCAS0C004108.840ON62544820.23
CAGL0M02981g8.840ON61783810.27
Skud_13.4508.840ON62251810.34
ABL126W8.840ON62440800.35
KNAG0J002708.840ON62571800.39
Suva_13.4668.840ON62251790.58
YMR278W (PGM3)8.840ON62251790.60
ZYRO0G14190g8.840ON61038780.61
Smik_13.4918.840ON62226780.76
KLTH0C03872g8.840ON62164761.1
SAKL0D01474g8.840ON62438761.2
Smik_15.803.126ON117653751.8
TBLA0A08180singletonON711170733.0
YOL078W (AVO1)3.126ON117653724.3
Suva_15.873.126ON117553706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR015W
         (552 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...  1052   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   682   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   636   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   578   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   566   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   530   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   523   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   508   e-175
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   505   e-174
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   501   e-172
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   495   e-170
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   495   e-170
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   490   e-168
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   489   e-168
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   488   e-168
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   485   e-166
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   485   e-166
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   481   e-165
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   471   e-161
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   445   e-151
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    40   0.017
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    40   0.022
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    40   0.022
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    38   0.053
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.060
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    38   0.080
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    38   0.088
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    37   0.12 
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    36   0.22 
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    36   0.23 
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    36   0.27 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    36   0.34 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    35   0.35 
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    35   0.39 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    35   0.58 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    35   0.60 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    35   0.61 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    35   0.76 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    34   1.1  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    34   1.2  
Smik_15.80 Chr15 (146001..149531) [3531 bp, 1176 aa] {ON} YOL078...    33   1.8  
TBLA0A08180 Chr1 complement(2019183..2021318) [2136 bp, 711 aa] ...    33   3.0  
YOL078W Chr15 (181682..185212) [3531 bp, 1176 aa] {ON}  AVO1Comp...    32   4.3  
Suva_15.87 Chr15 (154447..157974) [3528 bp, 1175 aa] {ON} YOL078...    32   6.4  

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/552 (93%), Positives = 514/552 (93%)

Query: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60
           MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV
Sbjct: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60

Query: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXX 120
           MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHM        
Sbjct: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMLVDRLGLD 120

Query: 121 XXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180
                            PQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA
Sbjct: 121 LALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180

Query: 181 AGVREDLYYAHFVXXXXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240
           AGVREDLYYAHFV             TLPFPLVVDTANGVGALKARELFRRSPLFKNRVS
Sbjct: 181 AGVREDLYYAHFVAALEELAALHGLETLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240

Query: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300
           IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE
Sbjct: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300

Query: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360
           RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT
Sbjct: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360

Query: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420
           PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK
Sbjct: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420

Query: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480
           TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN
Sbjct: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480

Query: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540
           AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL
Sbjct: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540

Query: 541 VVESTNDPGICN 552
           VVESTNDPGICN
Sbjct: 541 VVESTNDPGICN 552

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/549 (61%), Positives = 405/549 (73%), Gaps = 5/549 (0%)

Query: 1   MRTVQEMVKLYDRHRGCGRV-YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVG 59
           M  V+E+ KLYD+H  C R  Y YGTAGFR +AE+L  V+F TG+LACLRS++L G YVG
Sbjct: 1   MSVVEEVSKLYDKH-CCSRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVG 59

Query: 60  VMLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXX 119
            M+TASHNPP+DNGVKLVDP GEML  EWE +AT LANCAS G+ + L  L         
Sbjct: 60  AMITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKHQFLHRLQELMNQFGI 119

Query: 120 XXXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACN---E 176
                              +LL AL+DGT +  +V++VD  MLTTPQLHFLT   N   E
Sbjct: 120 KADSEARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNRQME 179

Query: 177 RGSAAGVREDLYYAHFVXXXXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFK 236
                 V E  YY+HF+              LP+PLV+D ANGVG  KA ELF ++  FK
Sbjct: 180 SERVIEVNEAFYYSHFLSALKELTELFNIPGLPYPLVIDAANGVGGAKAEELFMKNTFFK 239

Query: 237 NRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYI 296
           +  +IIN NWSQH+LLNS CGADYVKT QCLPQGISA     SL CS+DGDADRVIFYY 
Sbjct: 240 DSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRVIFYYR 299

Query: 297 DGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVP 356
           D    FHLLDGDKISTL AKF QS L  AGI D+V LGVVQTAYANGSSTRYLSEVL VP
Sbjct: 300 DVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSEVLIVP 359

Query: 357 VSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSL 416
           VSCTPTGVK+LHR+AV+ YDVGIYFEANGHGTVIFSE+F  TV + L+  +LSA+++++L
Sbjct: 360 VSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAESKMAL 419

Query: 417 QTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMF 476
           +TL++F+ LINQT+GDA++DM+AV+A+L IL W+P+ WD +YTDLPN L+KVVVPDRS+F
Sbjct: 420 KTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVPDRSLF 479

Query: 477 KTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATK 536
           KTTNAE+QL SP GLQ  ID ++  YD+ RSFVRASGTEDAVRIYAEAA+++QAD+L+ K
Sbjct: 480 KTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEAATKEQADDLSIK 539

Query: 537 VSTLVVEST 545
           +S LV+ +T
Sbjct: 540 ISQLVISAT 548

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/544 (55%), Positives = 390/544 (71%), Gaps = 2/544 (0%)

Query: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60
           M  +Q + +LYD+H   G  Y YGTAGFR +A+VL  V+F TG+LA +RS+YL G YVGV
Sbjct: 1   MVNIQLLEELYDKHCKTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXX 120
           M+TASHNPP+DNGVK+VDP GEML   WE  AT LAN AS+G+QEL+ AL          
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGKQELIKALDKLITKLGID 120

Query: 121 XXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180
                            P+LL A++DGT++L++V+VVD  +LTTPQLHFLT   N+ GS+
Sbjct: 121 DTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYNQ-GSS 179

Query: 181 AGVREDLYYAHFVXXXXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240
           + V E  YY+ F              +LP+ +++D ANG+G  K  E+  ++  F + VS
Sbjct: 180 SKVEESTYYSAFSSAWTKICGLHDINSLPYRVIIDAANGIGGPKVSEMLLKNKFFSSTVS 239

Query: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300
           +IN+ W   ELLN  CGADYVKT Q  P+G+S +   E ++CS+DGDADR++FYY D + 
Sbjct: 240 VINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGDADRIVFYYHDEKS 299

Query: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360
           +F+LLDGDKISTL AKF +  L+ AG  +++ LGVVQTAYANGSST YLS +LEVPVSCT
Sbjct: 300 KFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTEYLSSILEVPVSCT 359

Query: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420
            TGVKHLH EA+  YD+GIYFEANGHGTVIFS+ F  T+++ L+ P     A+ +L+TL 
Sbjct: 360 ATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQDEKTAK-ALKTLY 418

Query: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480
            F NLINQT+GDAI+DMLAV+A+L IL WSP+ WD++YTDLPN LVKV+VPDRS+FKT+N
Sbjct: 419 LFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKVIVPDRSVFKTSN 478

Query: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540
           AE+QL SP GLQE ID  V  ++ GRSFVRASGTEDAVR+YAEAA++++AD LA  VS L
Sbjct: 479 AERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKEKADRLAASVSDL 538

Query: 541 VVES 544
           V  S
Sbjct: 539 VSRS 542

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/541 (52%), Positives = 364/541 (67%), Gaps = 1/541 (0%)

Query: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60
           M   + +  LY+ H   G  YAYGTAGFR +A+VL  V+F TG++A LRS++L G  VGV
Sbjct: 1   MLDTKALKSLYEAHCSTGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXX 120
           M+TASHNPPEDNGVK+VDP GEML   WE +AT LAN ASQG  E + ++          
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSASQGFSEFVASVERLMTKLEVG 120

Query: 121 XXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180
                            P+LL A L G ++L +V+V D G+LTTPQLHFLT   NE    
Sbjct: 121 SNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNELPKG 180

Query: 181 AGVREDLYYAHFVXXXXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240
             + + LYY +F+             +LP+ L +D ANG+GA    E+  +   FK   +
Sbjct: 181 TEIGKSLYYDNFLSAWVEIAELCKIDSLPYKLEIDAANGIGAPVVTEMLSQHKFFKGAFA 240

Query: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300
           ++ND W   + LN  CGAD+VKT Q LP GI+    R  + CS+DGDADR++FYY     
Sbjct: 241 VVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSFDGDADRIVFYYCGKNG 300

Query: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360
            FHLLDGDK++TL AKF Q  L  AG+ D++ LGVVQTAYANGSST Y+ +VL + V+CT
Sbjct: 301 DFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGSSTAYIEQVLGISVTCT 360

Query: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420
           PTGVKHLH EAV KYD+G+YFEANGHGTV+FS  F   ++R L     S  A+ SL+ L 
Sbjct: 361 PTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKLSEKLESDAAQKSLKVLH 419

Query: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480
            FA LINQT+GDAI+DMLAV+A+LSIL WSPE WD++YTDLPN L+KV+VPDR++FKT N
Sbjct: 420 LFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPNKLIKVLVPDRTVFKTKN 479

Query: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540
           AE+QL SPAG+QE ID +V  +  GRSFVRASGTEDAVR+YAEAA+ Q+ + L+ +V  L
Sbjct: 480 AERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAEAATPQETEALSQQVEKL 539

Query: 541 V 541
           +
Sbjct: 540 L 540

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/541 (51%), Positives = 362/541 (66%), Gaps = 1/541 (0%)

Query: 1   MRTVQEMVKLYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGV 60
           M   + +  LY+ H   G  YAYGTAGFR +A+VL  V+F TG+LA LRS+YL G  VGV
Sbjct: 1   MLDTKTLETLYETHCKSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 61  MLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXX 120
           M+TASHNPPEDNGVK+VDP GEML   WE +AT LAN A+Q     L  L          
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSATQSFTAFLAYLQNLVSELGLD 120

Query: 121 XXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSA 180
                            P+LL ALL+G+R+L ++ + D G+LTTPQLHFLT   NE  + 
Sbjct: 121 TDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLTSKRNELPND 180

Query: 181 AGVREDLYYAHFVXXXXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFKNRVS 240
             +    YY  F+             +LP+ L +D ANG+GA + +E+      F     
Sbjct: 181 TAIDRFFYYKEFLSAWDDITALCGIQSLPYKLEIDAANGIGAPRVKEMLSTHKFFDGVFR 240

Query: 241 IINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE 300
           ++ND+W     LN  CGADYVKT Q LP GI A+   + + CS+DGDADR++FY+ D + 
Sbjct: 241 VVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGDADRIVFYFCDSEG 300

Query: 301 RFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCT 360
           +F LLDGDK++TL AKF Q  L +A + + + LGVVQTAYANGSST Y+  VL +PV+CT
Sbjct: 301 QFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTHYIERVLGIPVTCT 360

Query: 361 PTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLK 420
           PTGVKHLH EA+  YD+G+YFEANGHGTV+FS+ F   V   L N   S  +  SL+ L 
Sbjct: 361 PTGVKHLHHEAIN-YDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKHQSDSSLQSLEVLS 419

Query: 421 TFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTN 480
            FANLINQT+GDAI+DM+ V+A+LSIL W+P+ W+++YTDLPN LVKV+VPDR++FKTTN
Sbjct: 420 KFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVKVLVPDRTVFKTTN 479

Query: 481 AEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTL 540
           AE+QL SP GLQ  I+ +V  Y   RSFVRASGTEDAVR+YAEA+++++AD LA++VS +
Sbjct: 480 AERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTREEADSLASRVSQV 539

Query: 541 V 541
           V
Sbjct: 540 V 540

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/534 (51%), Positives = 352/534 (65%), Gaps = 4/534 (0%)

Query: 10  LYDRHRGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPP 69
           LY+++   G  Y YGTAGFR+   VL  V+F TG++A LRS+YL   +VGVM+TASHNPP
Sbjct: 6   LYEQYCKQGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNPP 65

Query: 70  EDNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXXXXXXXXXXX 129
           EDNGVK+V+P+GEML   WE  AT LAN AS    +L   L                   
Sbjct: 66  EDNGVKVVEPYGEMLVQNWEPIATKLANAASSSFTQLESTLQSIIAELNIDTTQLANITV 125

Query: 130 XXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYY 189
                   P+LL AL  G  +   V+++D  +LTTPQLHFL  + N     + VR+  YY
Sbjct: 126 ARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNTSSQPSQVRDSTYY 185

Query: 190 AHFVXXXXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSP-LFKNRVSIINDNWSQ 248
            HFV              LPF L +D ANG+GA K ++L  ++  + +N ++ +N     
Sbjct: 186 DHFVSIWNQLTQLYEVTELPFHLTIDCANGIGADKVKQLISQAGHMLENSLTAVNGETKT 245

Query: 249 HELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQE-RFHLLDG 307
            +LLN  CGAD+VKT Q  P   +       L+CS+DGDADRV+FYY+DG+E +FHLLDG
Sbjct: 246 FQLLNESCGADFVKTNQTFPANCNPK--PSQLYCSFDGDADRVVFYYVDGKENKFHLLDG 303

Query: 308 DKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHL 367
           DKI+TL+AK +   L   G++D + LGVVQTAYANGSST+Y+++ L++PVSCT TGVKHL
Sbjct: 304 DKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKLKIPVSCTKTGVKHL 363

Query: 368 HREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLIN 427
           H EAV +YD+GIYFEANGHGTVIFS  F  TV+  L+  + + +   SL +LK  + LIN
Sbjct: 364 HHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQYKSLLSLKLLSQLIN 423

Query: 428 QTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTS 487
           QT+GDAI+DMLAVIA LSI +  PEDWD  Y DLPN L KV+VPDRS+F +TNAE+QL S
Sbjct: 424 QTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDRSVFVSTNAERQLLS 483

Query: 488 PAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLV 541
           P GLQ  ID +V  + + RSFVRASGTEDAVR+YAEA + + A ELATKV  LV
Sbjct: 484 PEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIELATKVGELV 537

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/528 (50%), Positives = 346/528 (65%), Gaps = 10/528 (1%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80
           Y YGTAGFR  A +L  V+F TG++ACLRS+ LGG  VGVM+TASHNPPEDNGVK+V+P+
Sbjct: 17  YVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHNPPEDNGVKIVEPN 76

Query: 81  GEMLAAEWEKHATALANCASQGQQELLDAL---HMXXXXXXXXXXXXXXXXXXXXXXXXX 137
           G ML   WE  AT LAN A+    + L A     +                         
Sbjct: 77  GAMLDQSWEPMATELANIAANSTFDDLKAYVEEKVKKFSPESGSKVQPVVVVGRDSRESG 136

Query: 138 PQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVXXXX 197
             LL+ LL       + ++++ G+LTTPQLHFLT   N + S A V+E  YY +F+    
Sbjct: 137 SYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKKSYA-VQESSYYNYFIESWN 195

Query: 198 XXXXXXXXXTLP-FPLVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGC 256
                     L    L +DTANG+G  K +EL +  P F ++V+++N+ W + +LLN  C
Sbjct: 196 KITALHNITDLYCSSLTIDTANGIGGPKIQELLKSWP-FASKVTLVNNEWEKPDLLNKNC 254

Query: 257 GADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAK 316
           GAD+VKT Q LP G+S +     L+CSYDGDADR++FY+ D  ++FHLLDGDKISTL AK
Sbjct: 255 GADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYFQDQDKQFHLLDGDKISTLFAK 314

Query: 317 FLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYD 376
            +   L  A +N  + LGVVQTAYANGSST YL   L VPVSC  TGVKHLH EAV  YD
Sbjct: 315 LIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNVPVSCAKTGVKHLHHEAVTNYD 374

Query: 377 VGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIAD 436
           +G+YFEANGHGT+IFS+HF    E+ L+  + S    +++ TL   ++LINQT+GDAI+D
Sbjct: 375 IGVYFEANGHGTIIFSDHFYQVCEKELKANSES----IAVNTLVALSHLINQTVGDAISD 430

Query: 437 MLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELID 496
           ML V+++LSI+  S + WD +YTDLPN L KV+VPDRS+F TT+ E++L SP GLQ  ID
Sbjct: 431 MLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFITTDQERKLLSPEGLQSKID 490

Query: 497 DIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544
             +  + +GRSFVRASGTEDAVR+YAEA+SQ++A EL   V+ LV ES
Sbjct: 491 KAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALVTKLVKES 538

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  508 bits (1307), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 275/555 (49%), Positives = 356/555 (64%), Gaps = 33/555 (5%)

Query: 14  HRGC---GRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPE 70
           H+ C     VY YGTAGFR +A +L  V+F TG +ACLRSL   G  VGVM+TASHNPP 
Sbjct: 15  HKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGVMVTASHNPPV 74

Query: 71  DNGVKLVDPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXXXXXXXXXXXX 130
           DNGVK+V+P+G ML+ +WE  AT LAN ASQG+ + L    +                  
Sbjct: 75  DNGVKIVEPNGSMLSQDWEPIATDLANLASQGKIDEL-VQFVNAKLIELNSNKVPTLIVG 133

Query: 131 XXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYA 190
                    LL+ L +G+  L D ++VD  +LTTPQLHFLT A N        +E  YY 
Sbjct: 134 RDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNAYNLEKDLP--KETDYYH 191

Query: 191 HFVXX-----XXXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFKNRVSIINDN 245
           HF                        L++D+ANG+G  K   L +       +V +IN+N
Sbjct: 192 HFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKMENLLKYWKT-NYKVRLINNN 250

Query: 246 WSQHELLNSGCGADYVKTKQCLPQGISADLLRES----LFCSYDGDADRVIFYYIDGQER 301
           W + E LN+ CGADYVKT Q LP GI+ D++ ES    + CS+DGDADRV+FYY D Q  
Sbjct: 251 WKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHCSFDGDADRVVFYYQDPQSN 310

Query: 302 -FHLLDGDKISTLIAKFLQSALLTAGIN--DDVCLGVVQTAYANGSSTRYLSEVLEVPVS 358
            F+LLDGDKISTL A F+   L  AGI+  +++ LGVVQTAYANGSST YL + L++PV+
Sbjct: 311 TFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTAYANGSSTNYLQQNLKIPVA 370

Query: 359 CTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHF------TLTVERALEN-PALSAK 411
           C  TGVKHLH EA  +YD+G+YFEANGHGT+IFSE+F       +  E  +EN P L A 
Sbjct: 371 CAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKIINQKINAESQIENTPKLRA- 429

Query: 412 ARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVP 471
               L+TLK  + LINQT+GDAI+DM+ V+A+L+IL+W+P+ W+K+YTDLPN L K+VVP
Sbjct: 430 ----LKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKEYTDLPNKLAKLVVP 485

Query: 472 DRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQAD 531
           DRS+F+TT+ E++LTSPAGLQ  I+ IV  Y++GRSFVRASGTEDAVR+YAEA+     +
Sbjct: 486 DRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDAVRVYAEAS--DDVN 543

Query: 532 ELATKVSTLVVESTN 546
           +L  +V     ES N
Sbjct: 544 KLCQEVLDATAESVN 558

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  505 bits (1300), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 274/529 (51%), Positives = 336/529 (63%), Gaps = 10/529 (1%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80
           Y YGTAGFR  A VL  V+  TGLLACLRS+ L G  VGVM+TASHN P DNGVK+V+P 
Sbjct: 21  YVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMITASHNQPCDNGVKIVEPD 80

Query: 81  GEMLAAEWEKHATALANCAS--QGQQELLDALHMXXXXXXXXXXXXXXXXXXXXXXXXXP 138
           G ML   WE  AT LAN AS     QE    L                           P
Sbjct: 81  GSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVDSGITPVLVVGRDSRDSGP 140

Query: 139 QLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVXXXXX 198
           +LL  L      L   +++D G+LTTPQLHFLT A N   S A V ED YY+ F+     
Sbjct: 141 RLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTKSRAPVTEDDYYSFFMDAWVS 200

Query: 199 XXXXXXXXTLPFP-LVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGCG 257
                    L  P L +D ANG+G  K  +LF   P    + +++N++W    LLN+ CG
Sbjct: 201 ITALHGIKVLQSPRLYIDAANGIGGPKVSKLFEVWPQ-AGQFTLVNNHWQTPTLLNNDCG 259

Query: 258 ADYVKTKQCLPQGI--SADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIA 315
           ADYVKT Q LP+ I  +AD    +L+CS+DGDADR++FYY D Q  FHLLDGDKISTL A
Sbjct: 260 ADYVKTNQRLPKNIDPAADSDPATLYCSFDGDADRIVFYYQDAQNSFHLLDGDKISTLFA 319

Query: 316 KFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKY 375
            F+   L  AG+ + + +GVVQTAYANG+ST YL  VL +PVSC  TGVKHLH EA+  Y
Sbjct: 320 LFISKQLKKAGLTEKISMGVVQTAYANGNSTNYLENVLNIPVSCAKTGVKHLHHEAITNY 379

Query: 376 DVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIA 435
           DVGIYFEANGHGT++FS  F  T E  L+    S    L ++TL +FA+LINQT+GDAI+
Sbjct: 380 DVGIYFEANGHGTIMFSNKFFETCESLLKENNES----LEVKTLLSFAHLINQTVGDAIS 435

Query: 436 DMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELI 495
           DML V+A+LSI+  +P  WDK+YTDLPN L KVVVPDRS+F TT+ E++L +P G Q  I
Sbjct: 436 DMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVVPDRSLFTTTDQERKLLTPEGAQTKI 495

Query: 496 DDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544
           D IV  Y +GRSFVRASGTEDAVR+YAEA++ Q A  L  +VS  V+ S
Sbjct: 496 DAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDAAALNEEVSKAVLAS 544

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  501 bits (1289), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 272/534 (50%), Positives = 340/534 (63%), Gaps = 14/534 (2%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80
           Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+TASHNP +DNGVK+V+P 
Sbjct: 23  YSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPD 82

Query: 81  GEMLAAEWEKHATALANCASQGQ--QELLDALHMXXXXXXXXXXXXXXXXXXXXXXXXXP 138
           G ML A WE +A  LAN AS      E    L                           P
Sbjct: 83  GSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHEKIDLDAAPHVVVGRDSRESSP 142

Query: 139 QLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER----GSAAGVREDLYYAHFVX 194
            LL  L      +    VVD G +TTPQLH++T   N+R    GSA    E  YY+ F+ 
Sbjct: 143 FLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLSNKRQREGGSAQVATEQDYYSFFIN 202

Query: 195 XXXXXXXX-XXXXTLPFP-LVVDTANGVGALKARELF--RRSPLFKNRVSIINDNWSQHE 250
                         L  P L VDTANG+G  + ++L   +   +  + + I+ND     +
Sbjct: 203 AFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKLLASKDWAVPSDEIEIVNDKSDVPK 262

Query: 251 LLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKI 310
           LLN  CGADYVKT Q LP+G+S     +SL+CS+DGDADRV+FYY+D + +FHLLDGDKI
Sbjct: 263 LLNFECGADYVKTNQRLPKGLSPSS-PDSLYCSFDGDADRVVFYYVDPESKFHLLDGDKI 321

Query: 311 STLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHRE 370
           STL AKFL   L  A + D + +GVVQTAYANGSST Y+ + L  PVSCT TGVKHLH E
Sbjct: 322 STLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTSYIKDTLHCPVSCTKTGVKHLHHE 381

Query: 371 AVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTI 430
           A  +YD+GIYFEANGHGT+IFS+ F  T+E  L     +  + L+L TL+ FANLINQT+
Sbjct: 382 AATQYDIGIYFEANGHGTIIFSKKFHQTIESELSR---AQGSLLALNTLRCFANLINQTV 438

Query: 431 GDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAG 490
           GDAI+DMLAV+A LSILH +P DWDK+YTDLPN LVK +VPDRS+F+TT+ E++L +PAG
Sbjct: 439 GDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKCIVPDRSIFQTTDQERKLQNPAG 498

Query: 491 LQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544
           LQ  ID ++  Y  GRSFVRASGTEDAVR+YAE     + D+   +V   V  S
Sbjct: 499 LQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPTKLDQFCNEVVEYVKSS 552

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  495 bits (1274), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 275/528 (52%), Positives = 335/528 (63%), Gaps = 20/528 (3%)

Query: 18  GRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLV 77
           G  Y YGTAGFR  +E L  V+FATG++ACLRS  L G  VGVM+TASHNP  DNGVK+V
Sbjct: 17  GYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKVV 76

Query: 78  DPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXXXXXXXXXXXXXXXXXXX 137
           +P G ML   WE  AT LAN  +   + L D                             
Sbjct: 77  EPDGSMLIQSWESTATELANLLAN--RPLEDIKAKVGQLTSGESSVRPQLIVGRDSRVSG 134

Query: 138 PQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERG-SAAGVREDLYYAHFVXXX 196
           P LL  L+     L D ++ D G+LTTPQLHFLT   NE   + A V E  Y+AHF+   
Sbjct: 135 PHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMITGAHVDEQAYFAHFLGAW 191

Query: 197 XXXXXXXXXXTLPFPLVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGC 256
                      LP  +VVD ANG+G  K   L  +   F  + S+IND   + ELLN GC
Sbjct: 192 DQIAALQPVK-LP-NVVVDCANGIGGPKMSALLTQWG-FAKQCSVINDKCDEPELLNHGC 248

Query: 257 GADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAK 316
           GAD+VKT Q LP G+  +     L+CS+DGDADRV+FYY+D    FHLLDGDKISTL A 
Sbjct: 249 GADFVKTSQRLPNGVKPN--ANDLYCSFDGDADRVVFYYLDQNLGFHLLDGDKISTLFAY 306

Query: 317 FLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYD 376
           F+   L    ++  + +GVVQTAYANGSST+YL + L+VPVSCT TGVKHLH EAV  YD
Sbjct: 307 FVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQVPVSCTKTGVKHLHHEAVNNYD 366

Query: 377 VGIYFEANGHGTVIFSEHFTLTV-ERALENPALSAKARLSLQTLKTFANLINQTIGDAIA 435
           +GIYFEANGHGTV+FS  F  TV   A + P         L+ LK  A LINQT+GDAI+
Sbjct: 367 IGIYFEANGHGTVMFSNKFHETVTNHADQTP--------ELKILKYLAKLINQTVGDAIS 418

Query: 436 DMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELI 495
           DM+AV+A+LSIL WSP  WD+++TDLPN L KVVV DRS F TT+ E++L SPAGLQ+ I
Sbjct: 419 DMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQERRLVSPAGLQDKI 478

Query: 496 DDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVE 543
           D+ V    SGRSFVRASGTEDAVR+YAEAA+Q + D+L++ V  LV E
Sbjct: 479 DEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLVRE 526

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  495 bits (1274), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 270/541 (49%), Positives = 347/541 (64%), Gaps = 27/541 (4%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAY----VGVMLTASHNPPEDNGVKL 76
           Y YGTAGFR  A+ L  V+F TG++ACLRSL L  +     +GVM+TASHNPPEDNGVK+
Sbjct: 27  YTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIGVMVTASHNPPEDNGVKI 86

Query: 77  VDPHGEMLAAEWEKHATALANCASQGQ-----QELLDALHMXXXXXXXXXXXXXXXXXXX 131
           ++P+G ML  EWE  AT  AN A+        Q L+D++                     
Sbjct: 87  IEPNGSMLLQEWEPKATQFANIAANESFDEFYQLLIDSI--VTLENDLNIKQPPTLILGH 144

Query: 132 XXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAH 191
                 P L++ ++    ++ + ++++   +TTPQLHFLT   N  G+A  +    YY H
Sbjct: 145 DSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFLTNLTNTTGTAEEIN---YYDH 201

Query: 192 FVXXXXXXXXXXXXXTLPFP-LVVDTANGVGALKARELF----RRSPL-FKNRVSIINDN 245
           F               LPF  L++D ANG+GA +  +L     +  PL  KN + IIN++
Sbjct: 202 FNKYLSQLQSLYPPFNLPFDNLIIDAANGIGAPQVEKLLFTKNKFPPLNIKNPIKIINND 261

Query: 246 WSQHELLNSGCGADYVKTKQCLPQGISADL-LRESLFCSYDGDADRVIFYYIDGQ-ERFH 303
                LLN  CGADYVKT Q LPQGI  D+    +LFCSYDGDADR++FYYID     F+
Sbjct: 262 SKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANSTLFCSYDGDADRIVFYYIDPMTNNFN 321

Query: 304 LLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTG 363
           LLDGDKI+TL AKF  + L  A +N  + LGVVQTAYANGSST Y+S  L+VPVSCT TG
Sbjct: 322 LLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQTAYANGSSTNYISSKLKVPVSCTKTG 381

Query: 364 VKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFA 423
           VKHLH EA+ KYD+GIYFEANGHGTVIFS+ F   + +  E    S  +R  ++TL  F+
Sbjct: 382 VKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHSELTKLKE----SGSSR-EIKTLLLFS 436

Query: 424 NLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQ 483
            LINQT+GDA++DMLAVIA+LSIL  SP  WDK+Y DLPN L KV+VPDRS F TT+ E+
Sbjct: 437 ELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLPNKLAKVIVPDRSKFITTDQER 496

Query: 484 QLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVE 543
           +L  P GLQ L+++ V     GRSFVRASGTEDAVR+YAEA +Q++ + L+ KV  LV+E
Sbjct: 497 KLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYAEAKTQEETEWLSKKVCQLVIE 556

Query: 544 S 544
           S
Sbjct: 557 S 557

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  490 bits (1261), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 266/549 (48%), Positives = 342/549 (62%), Gaps = 21/549 (3%)

Query: 5   QEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63
           +++ KLYD   R     Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+T
Sbjct: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCAS------QGQQELLDALHMXXXXX 117
           ASHNP +DNGVK+V+P G ML A WE +A  LAN AS      +   EL+  + +     
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELEKIDL 125

Query: 118 XXXXXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER 177
                               P LL  L      +    V+D G +TTPQLH++T   N R
Sbjct: 126 GASNVAPHIVVGRDSRESS-PYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDLSNRR 184

Query: 178 -----GSAAGVREDLYYAHFV-XXXXXXXXXXXXXTLPFP-LVVDTANGVGALKARELFR 230
                 + A   E  YY+ F+               L  P L +DTANG+G  + ++L  
Sbjct: 185 EREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLKKLLA 244

Query: 231 RSPLF--KNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDA 288
                   +++ IIND     +LLNS CGADYVKT Q LP+G+S     ESL+CS+DGDA
Sbjct: 245 SKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSF-ESLYCSFDGDA 303

Query: 289 DRVIFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRY 348
           DRV+FYY+D + +FHLLDGDKISTL AKFL   L  A +   + +GVVQTAYANGSST Y
Sbjct: 304 DRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSSTAY 363

Query: 349 LSEVLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPAL 408
           + + L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F  T+E  L  P  
Sbjct: 364 IKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSKP-- 421

Query: 409 SAKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKV 468
                L+L+TL  FA LINQT+GDA++DMLAV+A L+IL  +P +WD++Y DLPN LVK 
Sbjct: 422 -NGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLVKC 480

Query: 469 VVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQ 528
           +VPDRS+F+TT+ E++L +P GLQ  ID ++  Y  GRSFVRASGTEDAVR+YAE     
Sbjct: 481 IVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQDMS 540

Query: 529 QADELATKV 537
           + D+   ++
Sbjct: 541 KLDQFCNEI 549

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  489 bits (1260), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 272/563 (48%), Positives = 343/563 (60%), Gaps = 29/563 (5%)

Query: 1   MRTVQEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVG 59
           M  V  + KL D++     R Y YGTAGFR  A  L  V+FATG+LACLRSL L G  +G
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 60  VMLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANC-ASQGQ-QELLDALH------ 111
           VM+TASHNPP DNGVK+V+P G M+   WE  AT LAN  A +G   E   A H      
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 112 ----MXXXXXXXXXXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQL 167
               +                         P+LL  L+   + L   ++ D G+LTTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 168 HFLTCACNERGSAAGVREDLYYAHFVXX-XXXXXXXXXXXTLPF--PLVVDTANGVGALK 224
           HFLT    +    A V E  YY HF+              +LP    L +D ANG+GA K
Sbjct: 181 HFLTSETAK--GVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238

Query: 225 ARELFRRSPLFKNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSY 284
            +EL  +    + +V  IND W+  ELLN  CGAD+VK+ Q  P G +       L CSY
Sbjct: 239 VQELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST---GLGCSY 294

Query: 285 DGDADRVIFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGS 344
           DGDADRV+FYYI+    F LLDGD+IS L A F    L  AG+  ++ LGVVQTAYANG+
Sbjct: 295 DGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGN 354

Query: 345 STRYLSEVLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALE 404
           ST YL + L+VPVSC  TGVKHLH EAV KYD+GIYFEANGHGT+IFS  F   ++   E
Sbjct: 355 STEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKE 414

Query: 405 NPALSAKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNN 464
                    ++++TL+ F+ LINQT+GDAI+DML V+A LSI  W+PE W +++TDLPN 
Sbjct: 415 R-------SVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNR 467

Query: 465 LVKVVVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEA 524
           L KVVVPDRS+F TT+ E++LT P GLQ+ ID+ V  +  GRSFVRASGTEDAVR+YAEA
Sbjct: 468 LAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEA 527

Query: 525 ASQQQADELATKVSTLVVESTND 547
           AS +  ++L+  V  LVV+S  +
Sbjct: 528 ASLEDVEKLSNTVKELVVKSVQN 550

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  488 bits (1257), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 263/537 (48%), Positives = 345/537 (64%), Gaps = 20/537 (3%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80
           Y YGTAGFR +A  L  V+FATG++AC RS+ L G  VGVM+TASHNPP DNGVK+V+P 
Sbjct: 23  YTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTASHNPPLDNGVKVVEPT 82

Query: 81  GEMLAAEWEKHATALAN-CASQGQQELLD-ALHMXXXXXXXXXXXXXXXXXXXXXXXXXP 138
           G ML  EWE   T LAN  A++  +++ D  L +                         P
Sbjct: 83  GAMLIQEWEPLTTKLANIAANESFEKVYDFILEVSKDPKFPFQENKPSLIIGHDSRESSP 142

Query: 139 QLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACN---ERGSAAGVREDLYYAHFVXX 195
           +L   L++    + + ++ + G++TTPQLHF+T   N    + +   +  D YY +F   
Sbjct: 143 RLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLWNAKYNKNTNDVISVDNYYNYFNAS 202

Query: 196 XXXXXXXXXXXTLPF--PLVVDTANGVGALKARELFRRSP-LFKNRVSIINDNWSQHELL 252
                      +      L++D+ANG+G  K  +L    P   +  VSIIN++W    LL
Sbjct: 203 WSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDLISTWPSTLRGNVSIINNSWENPNLL 262

Query: 253 NSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYI-DGQERFHLLDGDKIS 311
           N+ CGADYVKT Q LP+GI  +    +L CS+DGDADR++FYYI +  ++FHLLDGDKI+
Sbjct: 263 NNDCGADYVKTNQKLPKGIQ-NPSNLNLHCSFDGDADRIVFYYISEVDQKFHLLDGDKIA 321

Query: 312 TLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREA 371
           TL AKFL + L    + D + LGVVQTAYANGSST YL+ VL+VPVSCT TGVKHLH EA
Sbjct: 322 TLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSSTNYLTNVLKVPVSCTKTGVKHLHHEA 381

Query: 372 VQKYDVGIYFEANGHGTVIFSEHFTLTVERALEN-PALSAKARLSLQTLKTFANLINQTI 430
             KYD+GIYFEANGHGTV+FSE F    ++ L+N P  +A      QTL  F  +INQT+
Sbjct: 382 STKYDIGIYFEANGHGTVLFSERF----QQVLQNEPKTTAT-----QTLLLFQKIINQTV 432

Query: 431 GDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAG 490
           GDA+ADML VI +LS+   +P  WD+ Y DLPN L KV+VPDRS+F TTN E+QLTSP G
Sbjct: 433 GDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDRSVFITTNQERQLTSPVG 492

Query: 491 LQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVESTND 547
           LQE ID  V    +GRSFVRASGTEDAVR+YAEAA+Q++ ++L+ +V   V+ S ++
Sbjct: 493 LQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKLSQEVCKFVLSSVSN 549

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  485 bits (1248), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 268/556 (48%), Positives = 347/556 (62%), Gaps = 23/556 (4%)

Query: 5   QEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63
           +++ +LYD+  R     Y+YGTAGFR+ A+ L  V+F TG+LA LRSL L G YVGVM+T
Sbjct: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQ--QELLDALH--MXXXXXXX 119
           ASHNP +DNGVK+V+P G ML A WE +A  LAN AS     +E    L   +       
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEHEKIGL 125

Query: 120 XXXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER-- 177
                             P LL  L      +   +V+D G +TTPQLH++T   N+R  
Sbjct: 126 DTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLSNKRER 185

Query: 178 --GSAAGVREDLYYAHFV-XXXXXXXXXXXXXTLPFP-LVVDTANGVGALKARELFRRSP 233
             GSA    E  YY+ F+               L  P L +D ANG+G  + ++L     
Sbjct: 186 EGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKLLTSKD 245

Query: 234 LF--KNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRV 291
                +++ +IND     ELLN  CGADYVKT Q LP+G+S     +SL+CS+DGDADRV
Sbjct: 246 WVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSS-HDSLYCSFDGDADRV 304

Query: 292 IFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSE 351
           +FYY+D + +FHLLDGDKISTL AKFL   L  A + + + +GVVQTAYANGSST Y+  
Sbjct: 305 VFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTNYIEN 364

Query: 352 VLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAK 411
            L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F   ++  L      ++
Sbjct: 365 TLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL------SR 418

Query: 412 AR---LSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKV 468
           AR   L+L+TL  F+ LINQT+GDA++DMLAV+A L+I+  +P DWDK+YTDLPN LVK 
Sbjct: 419 ARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478

Query: 469 VVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQ 528
           +VPDRS+F+T + E++L +P GLQ  ID ++  Y  GRSFVRASGTEDAVRIYAE     
Sbjct: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538

Query: 529 QADELATKVSTLVVES 544
           Q D+   ++  LV  S
Sbjct: 539 QLDQFCNEIVELVKAS 554

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  485 bits (1248), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 271/548 (49%), Positives = 345/548 (62%), Gaps = 19/548 (3%)

Query: 5   QEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63
           +++ KLYD   R     ++YGTAGFR+ A+ L  V+F+TG+LA LRSL L G YVGVM+T
Sbjct: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65

Query: 64  ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCAS------QGQQELLDALHMXXXXX 117
           ASHNP +DNGVK+V+P G ML A WE +A  LAN AS      + + EL  A  +     
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVEL--AKLIEHEKI 123

Query: 118 XXXXXXXXXXXXXXXXXXXXPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER 177
                               P LL  L      +   +V+D G +TTPQLH++T   N R
Sbjct: 124 DLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRR 183

Query: 178 ---GSAAGV-REDLYYAHFV-XXXXXXXXXXXXXTLPFP-LVVDTANGVGALKARELFRR 231
              G  A V  E  YY+ F+               L  P L +DTANG+G  + ++L   
Sbjct: 184 KLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLAS 243

Query: 232 SP--LFKNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDAD 289
               +   +V +IND     ELLN  CGADYVKT Q LP+G+S     +SL+CS+DGDAD
Sbjct: 244 EDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSF-DSLYCSFDGDAD 302

Query: 290 RVIFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYL 349
           RV+FYY+D   +FHLLDGDKISTL AKFL   L  A +   + +GVVQTAYANGSST Y+
Sbjct: 303 RVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYI 362

Query: 350 SEVLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALS 409
              L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F  T++  L    L+
Sbjct: 363 KNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLN 422

Query: 410 AKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVV 469
               L+L+TLK F+ LINQT+GDAI+DMLAV+A L+IL  SP DWD++YTDLPN LVK +
Sbjct: 423 GDT-LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCI 481

Query: 470 VPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQ 529
           VPDRS+F+TT+ E++L +P GLQ+ ID +V  Y  GRSFVRASGTEDAVR+YAE     +
Sbjct: 482 VPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSK 541

Query: 530 ADELATKV 537
             +   +V
Sbjct: 542 LGQFCDEV 549

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  481 bits (1237), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 256/526 (48%), Positives = 337/526 (64%), Gaps = 9/526 (1%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80
           Y YGTAGFR+ A  L  V+F TG++A LRSL L G Y+GVM+TASHNPP+DNGVK+V+P 
Sbjct: 22  YTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVMITASHNPPQDNGVKIVEPS 81

Query: 81  GEMLAAEWEKHATALANCASQGQ-QELLDALHMXXXXXXXXXXXXXXXXXXXXXXXXXPQ 139
           G ML   WE+ AT LAN AS G     +  L                           P 
Sbjct: 82  GAMLIESWEQIATDLANIASHGNFTAFVMHLSQVIAKLNIDETTTPRLIVGHDSRESSPY 141

Query: 140 LLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVXXXXXX 199
           L++ L     + + + V++  ++TTPQLH+LT   N+      V E  YY  F       
Sbjct: 142 LMECLQAAAPVFDTI-VINHTLITTPQLHYLTMLQNDV-----VTEVDYYKFFSTSWNNL 195

Query: 200 XXXXXXXTLPFP-LVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNSGCGA 258
                   L F  L+VD ANGVG+++  +     P      +IIND  +  ++LN  CGA
Sbjct: 196 FSLYPDLNLTFNNLIVDGANGVGSVQFSKFLPYLPQLATLTTIINDKHNVPQMLNVDCGA 255

Query: 259 DYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDKISTLIAKFL 318
           D+VKT Q LP GI  +     L+ S+DGDADR++FYY+D  ++FHLLDGDKIST++ K L
Sbjct: 256 DFVKTNQKLPNGI-VNPNPSDLYASFDGDADRIVFYYVDNNKKFHLLDGDKISTILTKCL 314

Query: 319 QSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHREAVQKYDVG 378
            S L  + + +D+ LGVVQTAYANGSST+Y+++ L+VPV CT TGVKHLH  A  K+D+G
Sbjct: 315 ISMLRESELLNDINLGVVQTAYANGSSTKYITKSLKVPVECTKTGVKHLHHIAESKFDIG 374

Query: 379 IYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQTIGDAIADML 438
           IYFEANGHGTV+FS  F   +++A++N + S K   +  +L  F+ LINQT+GD++AD+L
Sbjct: 375 IYFEANGHGTVLFSNKFYEVLQKAIDNGSSSEKIHKARLSLFYFSKLINQTVGDSMADLL 434

Query: 439 AVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPAGLQELIDDI 498
           AVIA LSIL  SP DWD +Y DLPN L K  V +R +FKTT+ E++LTSP+GLQE ID  
Sbjct: 435 AVIATLSILQLSPSDWDTEYQDLPNLLTKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAA 494

Query: 499 VMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544
           V  YDSGRSFVRASGTEDAVRIYAEA ++ + + L+ +V+ LV  S
Sbjct: 495 VSKYDSGRSFVRASGTEDAVRIYAEAKTKAEVEALSKEVTQLVENS 540

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  471 bits (1211), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 257/538 (47%), Positives = 337/538 (62%), Gaps = 25/538 (4%)

Query: 21  YAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLVDPH 80
           Y YGTAGFR+ A +L  V+F TG++A LRS+    A VGVM+TASHNPP DNGVK+V+  
Sbjct: 17  YTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHNPPRDNGVKIVESD 76

Query: 81  GEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXXXXXXXXXXXXXXXXXXXPQL 140
           G ML  +WE  AT LAN  +         L+                          P+L
Sbjct: 77  GSMLLQDWEPLATRLANSVAD-YHTFESTLNAIMQELNISPGHAPQIVVGHDSRESSPRL 135

Query: 141 LDALLDGTRMLE-DVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVXXXXXX 199
           L  LLDG + +  D  + + G+LTTPQLHFLT       +     ED YY +F+      
Sbjct: 136 LANLLDGIKAVSPDARITNHGLLTTPQLHFLT-------ANPAHFEDYYYRYFLDAWNQL 188

Query: 200 XXXXXXXTLPF--PLVVDTANGVGALKARELFRRS----PLFK----NRVSIINDNWSQH 249
                         LV+DTANG+G  +  ++   S    P  +    +++ I N++W   
Sbjct: 189 FELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDLPHLQKIRLHQIDITNNSWLNP 248

Query: 250 ELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGDK 309
            +LNSGCGAD+VKT Q LP+GI+AD    +L+CS+DGDADRV+FYY+D    FHLLDGDK
Sbjct: 249 SMLNSGCGADFVKTNQRLPEGINAD--PRNLYCSFDGDADRVVFYYVDDSLTFHLLDGDK 306

Query: 310 ISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLHR 369
           ISTL+A F+ + L  AG+ +++ LGVVQTAYANGSST Y+++ L+VPVS   TGVKHLH 
Sbjct: 307 ISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYVTKKLQVPVSIAKTGVKHLHH 366

Query: 370 EAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQT 429
           EAV  YD+G+YFEANGHGTVIFS+HF   +E  L   A            +     INQT
Sbjct: 367 EAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNAHDKSTLTLRLLSRL----INQT 422

Query: 430 IGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSPA 489
           IGDAI+DMLA+I +L IL WSP  WD +YTDLPN L KVVVPDRS+F TT+ E++L SPA
Sbjct: 423 IGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVPDRSIFITTDQERRLVSPA 482

Query: 490 GLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVESTND 547
           GLQ+ ID +V     GRSF+RASGTEDAVR+YAEA + +  ++L+T+V+  ++E+  +
Sbjct: 483 GLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATEKLSTEVTDALIETVKE 540

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  445 bits (1145), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 250/536 (46%), Positives = 323/536 (60%), Gaps = 25/536 (4%)

Query: 18  GRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVKLV 77
           G  Y YGTAGFR +A VL  V+FATG +A LRS  L GA VGVM+TASHNPPEDNGVK+V
Sbjct: 18  GYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVTASHNPPEDNGVKVV 77

Query: 78  DPHGEMLAAEWEKHATALANCASQGQQELLDALHMXXXXXXXXXXXXXXXXXXXXXXXXX 137
           DP G ML  +WE  AT LAN A+ G  +     +                          
Sbjct: 78  DPEGGMLPEQWEPLATRLANLAANGTFDQW-WEYWTSLVEEGNYTGGARLCVGHDTRESS 136

Query: 138 PQLLDALLDGTRMLE--DVEVVDCGMLTTPQLHFLTCACNERGSAAGVREDLYYAHFVXX 195
           P+LL  L+D    +    + +    +   PQLH+LT    +     GV +   Y      
Sbjct: 137 PRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSLQRD-----GVTDAAAYNDHFQG 191

Query: 196 XXXXXXXXXXXTLPFP-LVVDTANGVGALKARELFRRSPLFKNRVSIINDNWSQHELLNS 254
                        PF  L +DTANGVGA++ ++ F+   + +N+  ++N ++   E LN 
Sbjct: 192 CWQKLFPDGVVAWPFDRLFIDTANGVGAVQLQQFFKGWAVDQNKFRLLNTDYGTPENLNV 251

Query: 255 GCGADYVKTKQCLP------QGISADLLRESLFCSYDGDADRVIFYYIDGQERFHLLDGD 308
            CGAD+VKT   LP      +G S  L    L+CS+DGDADR++FY++  ++ FHLLDGD
Sbjct: 252 KCGADFVKTNHRLPSEVPDQRGTSGAL--PDLYCSFDGDADRIVFYFVKNKQ-FHLLDGD 308

Query: 309 KISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSEVLEVPVSCTPTGVKHLH 368
           KISTL AKF+      AG +D + +GVVQTAYANG+STRY++  L +P +CT TGVKHLH
Sbjct: 309 KISTLFAKFIGQLTARAGADDKLTVGVVQTAYANGNSTRYIASELGIPSACTKTGVKHLH 368

Query: 369 REAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAKARLSLQTLKTFANLINQ 428
             A  +YD+GIYFEANGHGTV+FS+ F   V       A  A    +  TL  F+ LINQ
Sbjct: 369 HVAKTQYDIGIYFEANGHGTVVFSDKFNEVV-------AGVASTNDAASTLYHFSKLINQ 421

Query: 429 TIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVPDRSMFKTTNAEQQLTSP 488
           T+GDAIADML V+A+L  L W+PE W  +YTDLPN L KVVVPDRS+F+TT+ E++L SP
Sbjct: 422 TVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKVVVPDRSIFETTDQERRLVSP 481

Query: 489 AGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQADELATKVSTLVVES 544
            GLQE ID  V  +   RSFVRASGTE+AVRIY EA   Q+  EL+ +V+  V+ S
Sbjct: 482 EGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQEVQELSKQVTEAVLNS 537

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 8/42 (19%)

Query: 54  GGAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAE 87
           GGA  G+M+TASHNP  DNG K        +  PH + +A+E
Sbjct: 159 GGASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASE 200

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 8/39 (20%)

Query: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85
           GA VG+M+TASHNP  DNG K        ++ PH +++A
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHDKLIA 189

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 27/47 (57%), Gaps = 8/47 (17%)

Query: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHAT 93
           GA VGVM+TASHNP  DNG K        ++ PH   +A   E++ T
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDSEIAQSIEENLT 202

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 24/35 (68%), Gaps = 2/35 (5%)

Query: 502 YDSGRSFVRASGTEDAVRIYAEA--ASQQQADELA 534
           Y+S R  +R SGTE  +++Y EA   S+++A ELA
Sbjct: 573 YESVRFTIRGSGTEPKLKVYIEACSKSEERASELA 607

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 53  LGGAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALAN 97
           L  A +GVM+TASHNP  DNG K        ++ PH + +A   EK+   L++
Sbjct: 152 LYSASIGVMITASHNPEMDNGYKVYYNNGCQIIPPHDKNIAECIEKNLEPLSD 204

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 38/77 (49%), Gaps = 19/77 (24%)

Query: 19  RVYAYG-TAGFRSRAEVLAPVV-FATGLLACLRSLYLGGAYVGVMLTASHNPPEDNGVK- 75
           +VY+ G  A  +  A V  P+V FA   L         GA  GVM+TASHNP  DNG K 
Sbjct: 123 KVYSLGFNADPKKDAFVHTPMVPFAIDRL---------GASAGVMITASHNPKMDNGYKV 173

Query: 76  -------LVDPHGEMLA 85
                  ++ PH  ++A
Sbjct: 174 YYSNGCQIIPPHDRLIA 190

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 8/47 (17%)

Query: 59  GVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALAN 97
           GVM+TASHNP +DNG K        ++ PH + +A   EK+ T  + 
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSK 204

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 37.7 bits (86), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 55  GAYVGVMLTASHNPPEDNGVKLVDPHG 81
           GA VGVM+TASHNP  DNG K+   +G
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 8/40 (20%)

Query: 55  GAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAA 86
            A +GVM+TASHNP  DNG K        ++ PH + +AA
Sbjct: 151 NASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAA 190

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 18/65 (27%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA-------AEWE---KHATALAN 97
           A VGVM+TASHNP  DNG K        ++ PH   ++         WE    +   +AN
Sbjct: 164 ASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMAN 223

Query: 98  CASQG 102
             S+G
Sbjct: 224 AESKG 228

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 8/44 (18%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKH 91
           A VGVM+TASHNP  DNG K        ++ PH + +A   +K+
Sbjct: 151 ASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNIAEMIQKN 194

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 26/83 (31%)

Query: 29  RSRAEVLAPVVFATGLLACLRSLYLG------------------GAYVGVMLTASHNPPE 70
           R  ++  A V  AT + A  +  YL                    A VGVM+TASHNP  
Sbjct: 101 RYHSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKM 160

Query: 71  DNGVK--------LVDPHGEMLA 85
           DNG K        ++ PH   +A
Sbjct: 161 DNGYKVYYTNGCQIIPPHDHGIA 183

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANC 98
           A VGVM+TASHNP  DNG K        ++ PH + ++   + +    AN 
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAISNAIDMNLEPWANA 199

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 8/40 (20%)

Query: 54  GGAYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85
           G    GVM+TASHNP  DNG K        ++ PH E++ 
Sbjct: 155 GPTSCGVMITASHNPKMDNGYKVYYANGCQIIPPHDELIG 194

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 31/71 (43%), Gaps = 18/71 (25%)

Query: 29  RSRAEVLAPVVFATGLLACLRSLYLG------------------GAYVGVMLTASHNPPE 70
           R  ++  A V  A  L A  + LYL                    A VGVM+TASHNP  
Sbjct: 107 RFHSKEFATVTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKM 166

Query: 71  DNGVKLVDPHG 81
           DNG K+   +G
Sbjct: 167 DNGYKVYFANG 177

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANC 98
           A VGVM+TASHNP  DNG K        ++ PH   ++   + +    AN 
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDMNLEPWANV 199

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 8/51 (15%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLAAEWEKHATALANC 98
           A VGVM+TASHNP  DNG K        ++ PH   ++   + +    AN 
Sbjct: 149 ASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHAISDSIDANLEPWANV 199

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 8/38 (21%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85
           A VGVM+TASHNP  DNG K        ++ PH   +A
Sbjct: 145 ASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIA 182

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 56  AYVGVMLTASHNPPEDNGVKLVDPHG 81
           A VGVM+TASHNP  DNG K+   +G
Sbjct: 149 ASVGVMVTASHNPKMDNGYKVYYSNG 174

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 15/64 (23%)

Query: 59  GVMLTASHNPPEDNGVK--------LVDPHGEMLAAE-------WEKHATALANCASQGQ 103
           G+M+TASHNP  DNG K        ++ PH + ++         W++     A  A   Q
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQ 216

Query: 104 QELL 107
            E+L
Sbjct: 217 SEML 220

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 8/38 (21%)

Query: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA 85
           A  G+M+TASHNP  DNG K        ++ PH  +++
Sbjct: 153 ASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHDRLIS 190

>Smik_15.80 Chr15 (146001..149531) [3531 bp, 1176 aa] {ON} YOL078W
            (REAL)
          Length = 1176

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 495  IDDIVMVYDSGRS------FVRASGTEDAVRIYAEAASQQQADELATKVSTLV 541
            I  +V+V  S R       FVR  G +D  R Y EA S Q+  E+ T++  L+
Sbjct: 1116 ISQVVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSNQECTEIVTRLQNLL 1168

>TBLA0A08180 Chr1 complement(2019183..2021318) [2136 bp, 711 aa]
           {ON} 
          Length = 711

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 65/170 (38%), Gaps = 38/170 (22%)

Query: 384 NGHGTVIFSEHFTLTVERALENPA--------LSAKARLSLQTLKTFANLINQTIG---- 431
           +GH  ++ ++H +L   R  + P+          A+   +L+ +K   N +  T+     
Sbjct: 117 HGHHFILRTDHISLLAYRNKKEPSARISRWLDFLAEFDFTLEYIKGSLNHVADTLSRPAT 176

Query: 432 ---------------DAIADMLAVIAILSILHWSPEDWDKQYTDLPNNL----------- 465
                          + I D   V  I SI   SP DW + +   P ++           
Sbjct: 177 KNEITTNEVNKVAIIEEIEDPTLVFPINSIERISPVDWYEDWIQDPWSVAVLVHLGLIQD 236

Query: 466 VKVVVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTE 515
           VK+   D+S+F     + +L+  A  +   DD ++ YD      R+  TE
Sbjct: 237 VKINPTDKSLFDKYIKKLKLSKKAMARYKFDDQILYYDDRVCIPRSRRTE 286

>YOL078W Chr15 (181682..185212) [3531 bp, 1176 aa] {ON}  AVO1Component
            of a membrane-bound complex containing the Tor2p kinase
            and other proteins, which may have a role in regulation
            of cell growth
          Length = 1176

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 495  IDDIVMVYDSGRS------FVRASGTEDAVRIYAEAASQQQADELATKVSTLV 541
            I  +V+V  S R       FVR  G +D  R Y EA S Q+  E+ T++  L+
Sbjct: 1116 ISQVVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSGQECTEIVTRLQNLL 1168

>Suva_15.87 Chr15 (154447..157974) [3528 bp, 1175 aa] {ON} YOL078W
            (REAL)
          Length = 1175

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 495  IDDIVMVYDSGRS------FVRASGTEDAVRIYAEAASQQQADELATKVSTLV 541
            I  +V+V  S R       FVR  G +D  R Y EA S Q+  E+ T++  L+
Sbjct: 1115 ISQLVLVKKSKRVPEHFKIFVRREGQDDIKRYYFEAVSGQECTEIVTRLQNLL 1167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,800,857
Number of extensions: 1962494
Number of successful extensions: 4445
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4466
Number of HSP's successfully gapped: 57
Length of query: 552
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 437
Effective length of database: 40,294,809
Effective search space: 17608831533
Effective search space used: 17608831533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)