Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR014C6.12ON70703663e-47
Ecym_30156.12ON70692864e-35
Kwal_56.223596.12ON91702148e-24
SAKL0E00924g6.12ON97781931e-20
KLTH0C11484g6.12ON89701912e-20
KLLA0D00880g6.12ON71701684e-17
TDEL0G045906.12ON74741607e-16
Kpol_1032.36.12ON78791417e-13
YEL059C-A (SOM1)6.12ON74731408e-13
ZYRO0F00528g6.12ON77761409e-13
Smik_5.286.12ON74731363e-12
Suva_5.96.12ON73731321e-11
Skud_5.306.12ON74731252e-10
TPHA0M002206.12ON78601226e-10
NCAS0F002106.12ON79841043e-07
KNAG0E009306.12ON109521045e-07
TBLA0G009906.12ON7882879e-05
KAFR0L003506.12ON7153770.003
Smik_4.1472.369ON52542592.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR014C
         (70 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...   145   3e-47
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...   114   4e-35
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    87   8e-24
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    79   1e-20
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    78   2e-20
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    69   4e-17
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    66   7e-16
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    59   7e-13
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    59   8e-13
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    59   9e-13
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    57   3e-12
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    55   1e-11
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    53   2e-10
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    52   6e-10
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    45   3e-07
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    45   5e-07
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    38   9e-05
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    34   0.003
Smik_4.147 Chr4 complement(274906..276483) [1578 bp, 525 aa] {ON...    27   2.8  

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score =  145 bits (366), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 70/70 (100%), Positives = 70/70 (100%)

Query: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRVR 60
          MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRVR
Sbjct: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRVR 60

Query: 61 IEITERNTNM 70
          IEITERNTNM
Sbjct: 61 IEITERNTNM 70

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score =  114 bits (286), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%)

Query: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRVR 60
          MAPPTP++TR+EV P L+ ++DC+LASL QNECHFDG  YVC+PF+RLF ECTLNKRRVR
Sbjct: 1  MAPPTPIITRDEVEPILSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTLNKRRVR 60

Query: 61 IEITERNTN 69
          IE+T+ +TN
Sbjct: 61 IEVTDISTN 69

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 87.0 bits (214), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 1/70 (1%)

Query: 1  MAPPTPVLTREEVAPAL-ATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRV 59
          MAPPT V  +EE+ P L      C+  SLTQ+EC+FDG  YVCVPF+R+F+EC ++ + +
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGKSI 60

Query: 60 RIEITERNTN 69
          RIE+T+RNTN
Sbjct: 61 RIEVTDRNTN 70

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 79.0 bits (193), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 9/78 (11%)

Query: 1  MAPPTPVLTREEVAPALATSRD-CVLASLTQNECHFDGRGYVCVPFQRLFRECTLN---- 55
          MAPPTPV  ++E+   L   +  C L SL QNEC F+G  Y+CVPF+RLF+EC L+    
Sbjct: 1  MAPPTPVFGKDELESLLKKVKPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSKTK 60

Query: 56 ----KRRVRIEITERNTN 69
               R VRIEIT+R+TN
Sbjct: 61 DGRTSRTVRIEITDRHTN 78

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 78.2 bits (191), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 48/70 (68%), Gaps = 1/70 (1%)

Query: 1  MAPPTPVLTREEVAPALATSRD-CVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRV 59
          MAPPT V  +EE+      + + C L +L QNEC F+G  YVC PF+RLF+EC   KR V
Sbjct: 1  MAPPTLVFGKEELKGIWEKAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGAGKRIV 60

Query: 60 RIEITERNTN 69
          RIE+T+++TN
Sbjct: 61 RIEVTDQDTN 70

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 69.3 bits (168), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 42/70 (60%), Gaps = 1/70 (1%)

Query: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLNKRRV- 59
          MAPPT +L  +     L    +C L SL QNEC F+G  YVC PF+RLF +C +   RV 
Sbjct: 1  MAPPTKILGLDTQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDGRVL 60

Query: 60 RIEITERNTN 69
           IE+T  NTN
Sbjct: 61 NIEVTNLNTN 70

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 66.2 bits (160), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (64%), Gaps = 6/74 (8%)

Query: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRG---YVCVPFQRLFREC--TLN 55
          MAPPTPVL REE+ P +  S++CVL SLTQ +C     G   Y CVPF+RLF+EC     
Sbjct: 1  MAPPTPVLAREEL-PEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRDPSG 59

Query: 56 KRRVRIEITERNTN 69
          + + RIE+T   TN
Sbjct: 60 RFKSRIEVTSPLTN 73

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 58.9 bits (141), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 14/79 (17%)

Query: 1  MAPPTPVLTREEV--APALATSRD-----CVLASLTQNECHFDGR---GYVCVPFQRLFR 50
          MAPPTP+ +REEV       T  D     C L S+TQ +C F+      Y+C+PF+RLF 
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 51 ECTLNKRRVRIEITERNTN 69
          EC+     +RIE+T+R TN
Sbjct: 61 ECS----GIRIEVTDRFTN 75

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 58.5 bits (140), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 1  MAPPTPVLTREEVAPALAT---SRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTL-NK 56
          MAPPT + TR++    LAT     +C L  L Q EC F G  YVC PF+RLF  C   +K
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 57 RRVRIEITERNTN 69
               E+T+  TN
Sbjct: 61 SATNYEVTDTYTN 73

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 58.5 bits (140), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 11/76 (14%)

Query: 1  MAPPTPVLTREEVA------PALATSRDCVLASLTQNECHFDGRG-YVCVPFQRLFRECT 53
          MAPPTP+LT E+V+        L     C L SLTQ+ CH +  G Y+CVPF+R+F +C 
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 54 LNKRRVRIEITERNTN 69
           +     +E+T+ +TN
Sbjct: 61 GHA----LEVTDADTN 72

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 57.0 bits (136), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 1  MAPPTPVLTREE-VAP--ALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTLN-K 56
          MAPPT + +R++ +AP  AL +   C L  L Q EC F G  YVC PF+RLF  C  + K
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 57 RRVRIEITERNTN 69
               E+T+  TN
Sbjct: 61 PATNYEVTDTYTN 73

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 55.5 bits (132), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 1  MAPPTPVLTREEVAPALAT--SR-DCVLASLTQNECHFDGRGYVCVPFQRLFRECTL-NK 56
          MAPPT +  R++    LAT  SR  C L  L Q EC F G  YVC PF+RLF  CT   +
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 57 RRVRIEITERNTN 69
               E+T+  TN
Sbjct: 61 AATNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 52.8 bits (125), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 1  MAPPTPVLTREE-VAP--ALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTL-NK 56
          MAPPT + +R++ +AP  AL +   C L  L Q EC F    YVC PF+RLF  C   +K
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 57 RRVRIEITERNTN 69
               E+T+  TN
Sbjct: 61 SATDYEVTDTYTN 73

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 51.6 bits (122), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 35/60 (58%), Gaps = 8/60 (13%)

Query: 1  MAPPTPVLTREEVAPALATSR-----DCVLASLTQNECHF---DGRGYVCVPFQRLFREC 52
          MAP TPV+ RE VA  L  S+     +C L +LTQ EC F   +   Y+C PF+RLF  C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 44.7 bits (104), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 19/84 (22%)

Query: 1  MAPPTPVLTREE--VAPALATSR----------DCVLASLTQNECHF--DGRGYVCVPFQ 46
          MAPP  V  +++  V  AL+ +R           C    LTQ +C    DG+ Y+C PF+
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQ-YICFPFK 59

Query: 47 RLFRECTLNKRRVRIEITERNTNM 70
          R+F+EC    + VR E+T  ++NM
Sbjct: 60 RVFQEC----QGVRTEVTNVDSNM 79

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 44.7 bits (104), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQRLFREC 52
          MAP   VLTR +V P       CVL  L Q  C  DG  + C PF+RLF +C
Sbjct: 1  MAPNVRVLTRNDV-PLPQPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC 51

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 38.1 bits (87), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 16/82 (19%)

Query: 1  MAPPTPVLTREEVAPALATSR-----DCVLA------SLTQNECHFDGRGYV-CVPFQRL 48
          MAPP  + T+EE+      +R     D   +      S+TQ EC  + +G + C PF+R+
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRI 60

Query: 49 FRECTLNKRRVRIEITERNTNM 70
          F++    +R    EIT+  TNM
Sbjct: 61 FQQVGEYRR----EITDETTNM 78

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%)

Query: 1  MAPPTPVLTREEVAPALATSRDCVLASLTQNECHFDGRGYV-CVPFQRLFREC 52
          MAP   V+  +     +  +  C L SL Q  C +   G + C PF+R+F EC
Sbjct: 1  MAPMIRVMDGDAAEREVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLEC 53

>Smik_4.147 Chr4 complement(274906..276483) [1578 bp, 525 aa] {ON}
           YDL088C (REAL)
          Length = 525

 Score = 27.3 bits (59), Expect = 2.8,   Method: Composition-based stats.
 Identities = 13/42 (30%), Positives = 18/42 (42%)

Query: 6   PVLTREEVAPALATSRDCVLASLTQNECHFDGRGYVCVPFQR 47
           P+ T E        S  C L +L +N   F G    C+P+ R
Sbjct: 345 PIFTGESWVKLTYNSPSCALRALQENGSIFHGALIGCIPYSR 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,769,150
Number of extensions: 196736
Number of successful extensions: 490
Number of sequences better than 10.0: 19
Number of HSP's gapped: 472
Number of HSP's successfully gapped: 19
Length of query: 70
Length of database: 53,481,399
Length adjustment: 43
Effective length of query: 27
Effective length of database: 48,550,761
Effective search space: 1310870547
Effective search space used: 1310870547
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)