Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR013C6.13ON48848824660.0
SAKL0E00946g6.13ON49349321000.0
Ecym_30166.13ON48947420780.0
KLLA0D00902g6.13ON49248620560.0
Kwal_56.223626.13ON49348320500.0
KLTH0C11462g6.13ON49247820440.0
TDEL0G045806.13ON48446220410.0
Kpol_1032.46.13ON46746319920.0
Kpol_1045.766.13ON48546019690.0
CAGL0A01045g6.13ON48348619460.0
YPL262W (FUM1)6.13ON48846119270.0
Suva_16.436.13ON48847319260.0
ZYRO0C07964g6.13ON50547619260.0
Smik_6.4706.13ON48847319240.0
Skud_16.166.13ON48847319210.0
TPHA0J002706.13ON49646119170.0
KNAG0E027506.13ON49847318760.0
NCAS0D026206.13ON49346918590.0
KAFR0B065206.13ON49547718420.0
TBLA0G010006.13ON46546118050.0
TBLA0A071306.13ON50048517950.0
NDAI0I024706.13ON47546817800.0
SAKL0D09746g1.354ON4642931152e-05
KLLA0A08404g1.354ON4612411143e-05
CAGL0I08987g1.354ON4612921091e-04
ZYRO0G00748g1.354ON462242970.003
KAFR0A009501.354ON464296970.003
Kpol_1018.1251.354ON460239960.004
AEL019W1.354ON469295960.004
NCAS0A090101.354ON462241950.005
TPHA0A021901.354ON463238950.005
NDAI0G059401.354ON462241940.007
KNAG0I015601.354ON462242940.007
Ecym_27491.354ON470278940.007
Suva_15.2011.354ON463238890.029
Skud_8.701.354ON463238880.038
Smik_8.831.354ON463238870.050
Kwal_27.127821.354ON465253870.050
TDEL0D022201.354ON465241870.050
YHR018C (ARG4)1.354ON463238860.066
TBLA0F034801.354ON466260850.087
KLTH0G19338g1.354ON465288830.15
CAGL0B02794g4.197ON482161780.62
Suva_4.4946.148ON85092780.70
Ecym_24524.197ON482182770.81
Skud_12.4434.197ON482178761.1
Kwal_47.180664.197ON482175751.4
SAKL0B04972g4.197ON482175751.4
KLLA0B13189g4.197ON482177751.4
Suva_3.1851.47ON391147741.7
NDAI0J019504.197ON482177741.9
Suva_10.4594.197ON482175741.9
YLR359W (ADE13)4.197ON482175741.9
TBLA0A10760singletonON2329104742.3
TDEL0B07680singletonON480129732.4
TDEL0A00100singletonON482129732.4
Smik_12.4464.197ON482175732.5
KLLA0D15081g3.438ON1010102732.8
NCAS0J012004.197ON482175723.2
KNAG0B058404.197ON482158723.2
Kwal_55.21713singletonOFF7449653.6
Kwal_47.18394singletonOFF9857664.2
KAFR0A062304.197ON482154714.3
ZYRO0G05104g2.90ON467118705.6
TBLA0A083204.197ON482261705.6
KLTH0D05236g2.464ON558117705.8
TDEL0E017604.197ON482151697.4
Kpol_1042.164.197ON482175697.4
TPHA0B010404.197ON482178697.4
ZYRO0A13662gsingletonON920126698.3
ZYRO0B07964g4.197ON482256689.8
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACR013C
         (1467 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   954   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   813   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   805   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   796   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   794   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   791   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   790   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   771   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   763   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   754   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   746   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   746   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   746   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   745   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   744   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   743   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   727   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   720   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   714   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   699   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   696   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   690   0.0  
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    49   2e-05
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    49   3e-05
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    47   1e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    42   0.003
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    42   0.003
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    42   0.004
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    42   0.004
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    41   0.005
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    41   0.005
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    41   0.007
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    41   0.007
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    41   0.007
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    39   0.029
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    39   0.038
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    38   0.050
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    38   0.050
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    38   0.050
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    38   0.066
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    37   0.087
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    37   0.15 
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    35   0.62 
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    35   0.70 
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    34   0.81 
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    34   1.1  
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    33   1.4  
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    33   1.4  
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    33   1.4  
Suva_3.185 Chr3 (280674..281846) [1173 bp, 391 aa] {ON} YCL028W ...    33   1.7  
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    33   1.9  
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    33   1.9  
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    33   1.9  
TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa]...    33   2.3  
TDEL0B07680 Chr2 (1348302..1349744) [1443 bp, 480 aa] {ON}   pos...    33   2.4  
TDEL0A00100 Chr1 complement(5449..6897) [1449 bp, 482 aa] {ON}         33   2.4  
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    33   2.5  
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    33   2.8  
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    32   3.2  
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    32   3.2  
Kwal_55.21713 s55 complement(949962..950186) [225 bp, 74 aa] {OF...    30   3.6  
Kwal_47.18394 s47 (808025..808321) [297 bp, 98 aa] {OFF} [contig...    30   4.2  
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    32   4.3  
ZYRO0G05104g Chr7 complement(410797..412200) [1404 bp, 467 aa] {...    32   5.6  
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    32   5.6  
KLTH0D05236g Chr4 (469109..470785) [1677 bp, 558 aa] {ON} conser...    32   5.8  
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    31   7.4  
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    31   7.4  
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    31   7.4  
ZYRO0A13662g Chr1 (1088049..1090811) [2763 bp, 920 aa] {ON} some...    31   8.3  
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    31   9.8  

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL262W
            (FUM1)
          Length = 488

 Score =  954 bits (2466), Expect = 0.0
 Identities = 488/488 (100%), Positives = 488/488 (100%)
 Frame = +1

Query: 1    MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 180
            MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG
Sbjct: 1    MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 60

Query: 181  ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 360
            ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ
Sbjct: 61   ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 120

Query: 361  TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 540
            TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI
Sbjct: 121  TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 180

Query: 541  TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 720
            TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE
Sbjct: 181  TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 240

Query: 721  HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 900
            HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE
Sbjct: 241  HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 300

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 1080
            ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA
Sbjct: 301  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 360

Query: 1081 CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 1260
            CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED
Sbjct: 361  CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 420

Query: 1261 RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 1440
            RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP
Sbjct: 421  RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 480

Query: 1441 EKMIGPRD 1464
            EKMIGPRD
Sbjct: 481  EKMIGPRD 488

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 493

 Score =  813 bits (2100), Expect = 0.0
 Identities = 410/493 (83%), Positives = 453/493 (91%), Gaps = 5/493 (1%)
 Frame = +1

Query: 1    MLRLS----RGCVGSSAARRLMSTAG-APQQFRVETDAFGEIRVPADKYWGAQTQRSLEN 165
            MLR++    R  + SS+ R L +++  A Q++R+ETDAFGEI+VPADKYWGAQTQRS EN
Sbjct: 1    MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60

Query: 166  FRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFP 345
            F+IGGARERMPE VVRAFGVLKKSAA+VNE LGTL+P I+K IQ+AADEV QG+LM+HFP
Sbjct: 61   FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120

Query: 346  LVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIA 525
            LVVFQTGSGTQSNMNANEVISNRAIE++GGE GSKQVHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121  LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 526  AVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANG 705
            AVTEIT SLLPEL ALR SFQ+K+DEF+ IVKIGRTHLQDATPLTLGQEFSGY QQ+ NG
Sbjct: 181  AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 706  IARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAH 885
            IARVE +   L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAH
Sbjct: 241  IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 886  DAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
            DAVVE SGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301  DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 1066 ALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGI 1245
            A+TQ CVQVMGNNAAITFAGASGQFELNVFKPVMI+NLLSSVRLLADA+ SFRVHCVDGI
Sbjct: 361  AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420

Query: 1246 QDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFD 1425
            + NEDRI+KLLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SAL+LGVL + EFD
Sbjct: 421  KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480

Query: 1426 EWVVPEKMIGPRD 1464
            EWV+PEKMIGP++
Sbjct: 481  EWVIPEKMIGPKE 493

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
            Ashbya gossypii ACR013C
          Length = 489

 Score =  805 bits (2078), Expect = 0.0
 Identities = 395/474 (83%), Positives = 441/474 (93%)
 Frame = +1

Query: 37   AARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRA 216
            A R + +TAG  Q+FR+ETDAFGEI+VPA+KYWGAQTQRSLENF+IGG RERMPEP+++A
Sbjct: 14   ADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKA 73

Query: 217  FGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNAN 396
            FG+LKKSAA+VNE LGTL+P I+K IQQAADEV +G+L++HFPLVVFQTGSGTQSNMNAN
Sbjct: 74   FGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNAN 133

Query: 397  EVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALR 576
            EVISNRAIEL+GGELG+KQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEIT +LLPEL ALR
Sbjct: 134  EVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALR 193

Query: 577  VSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG 756
             SFQ+KT+EF+HIVKIGRTHLQDATPLTLGQEF GYTQQI NGI RVE +   L+FLAQG
Sbjct: 194  DSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQG 253

Query: 757  GTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSL 936
            GTAVGTGLNT+ GFAE+IA QVS+ET +EF+TAPNKFEALAAHDAVVE SGALNT+ACSL
Sbjct: 254  GTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSL 313

Query: 937  FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAIT 1116
            FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQACVQVMGNN+ IT
Sbjct: 314  FKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTIT 373

Query: 1117 FAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLML 1296
            FAGASGQFELNVFKPVMI+NLL+S+RLLADA+ SFRVHCVDGI+ NED+IAK+LHESLML
Sbjct: 374  FAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLML 433

Query: 1297 VTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 1458
            VTALNPKIGYD+A  VAKNAHKK ITL+ SALELGVL++ EF EWVVPEKMIGP
Sbjct: 434  VTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
            similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  796 bits (2056), Expect = 0.0
 Identities = 397/486 (81%), Positives = 444/486 (91%), Gaps = 1/486 (0%)
 Frame = +1

Query: 10   LSRGCVGSSAARRLMSTAGAPQ-QFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGAR 186
            +SRG   +  + ++   A      +RVETDAFGEI+VP+DKYWGAQTQRSL+NF+IGG R
Sbjct: 7    VSRGLAQTRVSAKVNRLASLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPR 66

Query: 187  ERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTG 366
            ERMPEP+V+AFGVLKKSAAVVNE+LGTL+P IAK I+QAADEVAQG+LMEHFPLVVFQTG
Sbjct: 67   ERMPEPIVKAFGVLKKSAAVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTG 126

Query: 367  SGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITR 546
            SGTQSNMNANEVISNRAIEL+GGELGSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEIT 
Sbjct: 127  SGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITH 186

Query: 547  SLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHA 726
             LLPELE L+V+ ++K+DEF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIARV+ +
Sbjct: 187  HLLPELEGLKVALKQKSDEFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQS 246

Query: 727  QESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEAS 906
               L+FLAQGGTAVGTGLNT+ GFAE IA QVS+ETG++F+TAPNKFEALAAHDAVVEAS
Sbjct: 247  LYHLKFLAQGGTAVGTGLNTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEAS 306

Query: 907  GALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACV 1086
            GALNTLA SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CV
Sbjct: 307  GALNTLAVSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCV 366

Query: 1087 QVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRI 1266
            QVMGN+AAITFAGASGQFELNVFKPVMI+NLLSS+RLL DA+ SFR+HCV+GI+ NEDRI
Sbjct: 367  QVMGNHAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRI 426

Query: 1267 AKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEK 1446
            AKLLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALEL VL+  EFD+WV+PEK
Sbjct: 427  AKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEK 486

Query: 1447 MIGPRD 1464
            MIGP++
Sbjct: 487  MIGPKE 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
            (FUM1) - mitochondrial and cytoplasmic fumarase (fumarate
            hydralase) [contig 186] FULL
          Length = 493

 Score =  794 bits (2050), Expect = 0.0
 Identities = 390/483 (80%), Positives = 438/483 (90%)
 Frame = +1

Query: 13   SRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARER 192
            ++  +  S AR + +++   Q++RVETDAFGEI+VP DK WGAQTQRSLENF+IGG RER
Sbjct: 10   NKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRER 69

Query: 193  MPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSG 372
            MPEP+V+AFG+LKKSAA+VNE LGTL+P ++K IQ AADEV  G+L++HFPLVVFQTGSG
Sbjct: 70   MPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSG 129

Query: 373  TQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSL 552
            TQSNMNANEVISNRAI+L+GGE+GSK +HPNNHCNQAQSSNDTFPSVMHIAAVTE+T  L
Sbjct: 130  TQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLL 189

Query: 553  LPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQE 732
            LPEL ALR +F +K  EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVEH+  
Sbjct: 190  LPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLH 249

Query: 733  SLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGA 912
            +L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAHDAVVE SGA
Sbjct: 250  NLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGA 309

Query: 913  LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQV 1092
            LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQV
Sbjct: 310  LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 369

Query: 1093 MGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAK 1272
            MGNNAAITFAGASGQFELNVFKPVMI+NLLSS+RLL DA  SFRVHCV+GIQ NED+IAK
Sbjct: 370  MGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAK 429

Query: 1273 LLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMI 1452
            LLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALELGVL+ AEFDEWVVPE M+
Sbjct: 430  LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMV 489

Query: 1453 GPR 1461
            GP+
Sbjct: 490  GPK 492

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 492

 Score =  791 bits (2044), Expect = 0.0
 Identities = 394/478 (82%), Positives = 433/478 (90%)
 Frame = +1

Query: 28   GSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPV 207
            GS   R + +++   Q+ RVETDAFGEI VPADKYWGAQTQRSLENF+IGGARERMPEPV
Sbjct: 15   GSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPV 74

Query: 208  VRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNM 387
            VRAFG+LKKSAA+VNE LGTL+P I+K IQQAADEV  G+L++HFPLVVFQTGSGTQSNM
Sbjct: 75   VRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNM 134

Query: 388  NANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELE 567
            NANEVISNRAIE++GG++G+K +HPNNHCNQAQSSNDTFPSVMHIAAVTEIT SLLPEL 
Sbjct: 135  NANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELT 194

Query: 568  ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 747
            ALR SF  K+ EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVE +   L+FL
Sbjct: 195  ALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFL 254

Query: 748  AQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLA 927
            AQGGTAVGTGLNT+ GF E+IA QVS+ETG++F+TAPNKFEALAAHDA+VE SGALNTLA
Sbjct: 255  AQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLA 314

Query: 928  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNA 1107
            CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNA
Sbjct: 315  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 374

Query: 1108 AITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHES 1287
            AITFAGASGQFELNVFKPVMI+NLLSSVRLL DA  SFRVHCVDGI+ N D+IAKLLHES
Sbjct: 375  AITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHES 434

Query: 1288 LMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            LMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALEL VLT AEFD+WVVPE M+GP+
Sbjct: 435  LMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
            Anc_6.13 YPL262W
          Length = 484

 Score =  790 bits (2041), Expect = 0.0
 Identities = 397/462 (85%), Positives = 428/462 (92%)
 Frame = +1

Query: 76   QFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNE 255
            QFRVETDAFGEI+V AD+YWGAQTQRSLENFRIGG RERMPEP+VRAFGVLKKSAAVVNE
Sbjct: 22   QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNE 81

Query: 256  QLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 435
             LGTL+P +A+ I+QAADEVAQG+L  HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG
Sbjct: 82   SLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGG 141

Query: 436  ELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHI 615
            ELGSKQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEITR LLPEL  LR S   K+ EF+ I
Sbjct: 142  ELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDI 201

Query: 616  VKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRG 795
            VKIGRTHLQDATPLTLGQEFSGY QQ++NGI RVE +   L++LAQGGTAVGTGLNT+ G
Sbjct: 202  VKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIG 261

Query: 796  FAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSG 975
            FAE+IA QVS+ETGL+F+TAPNKFEALAAHDAVVEASGALNT+ACSLFKIA DIRYLGSG
Sbjct: 262  FAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSG 321

Query: 976  PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVF 1155
            PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFAGASGQFELNVF
Sbjct: 322  PRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVF 381

Query: 1156 KPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAA 1335
            KPVMI+NLLSSVRLLADA+ SFRVHCVDGI  N DRI KL+HESLMLVTALNPKIGYDAA
Sbjct: 382  KPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAA 441

Query: 1336 SAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            S VAKNAHKKGITL+ SAL+LGVLT++EFDEWVVPE MIGP+
Sbjct: 442  SKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
            [1404 nt, 468 aa]
          Length = 467

 Score =  771 bits (1992), Expect = 0.0
 Identities = 378/463 (81%), Positives = 422/463 (91%)
 Frame = +1

Query: 70   PQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVV 249
            P  FR+ETD FGEI+VPADKYWGAQTQRS ENF+IGG RERMPEPVV+AFGVLKKSAA+V
Sbjct: 4    PNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIV 63

Query: 250  NEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELL 429
            NE+ G L+ GI+K IQQAADEV +G+L EHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 64   NEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELK 123

Query: 430  GGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFA 609
            GG +GSK++HPNNHCN AQSSNDTFP+VMHIAAVTEIT  L+P++  L+ +   K+ EF 
Sbjct: 124  GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183

Query: 610  HIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTR 789
            HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIAR+EH+  +L+FLAQGGTAVGTGLNT+
Sbjct: 184  HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTK 243

Query: 790  RGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLG 969
             GFAE+IA QVS+ETG+EF+TAPNKFEALAAHDA+VE+SGALNT+ACSLFKIA DIRYLG
Sbjct: 244  IGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLG 303

Query: 970  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELN 1149
            SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAAITFAGASGQFELN
Sbjct: 304  SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 363

Query: 1150 VFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYD 1329
            VFKPVMI+NLLSS+RLL DA  SF +HCV+GIQ NED+I KLLHESLMLVTALNPKIGYD
Sbjct: 364  VFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYD 423

Query: 1330 AASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 1458
            +A+ VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 424  SATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] {ON}
            complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  763 bits (1969), Expect = 0.0
 Identities = 375/460 (81%), Positives = 422/460 (91%)
 Frame = +1

Query: 79   FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 258
            FRVETD FGEI+VPA+KYWGAQT+RS ENF+IGG+RERMPE VVRAFGVLKK AA+VN +
Sbjct: 24   FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 259  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 438
            LG L+P  +K IQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 84   LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 439  LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 618
            LGSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I++ LLPEL  LR +   K+ EF HIV
Sbjct: 144  LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 619  KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 798
            KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E AQ++LRFLAQGGTAVGTGLNT+ G+
Sbjct: 204  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 799  AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 978
            AE+IAA++S+ETGL F+TAPNKFEALAAHDA+VEASGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 264  AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 979  RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 1158
            RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 324  RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 1159 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 1338
            PV+I+NLLSSV+LL DA+RSFRVHCV+GI+ NE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 384  PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 1339 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 1458
             VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 444  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  754 bits (1946), Expect = 0.0
 Identities = 375/486 (77%), Positives = 423/486 (87%)
 Frame = +1

Query: 1    MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 180
            MLR S     S A   L+  +     +RVETD FGEI+VPADKYWGAQTQRS +NF+IGG
Sbjct: 1    MLRAS-----SRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGG 55

Query: 181  ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 360
            ARERMPEP+VRAFGVLKKSAA+VNE+LGTL+  IA  IQQAADEVA+G+L +HFPLVVFQ
Sbjct: 56   ARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQ 115

Query: 361  TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 540
            TGSGTQSNMNANEVISNRAIEL+GGELGSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEI
Sbjct: 116  TGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEI 175

Query: 541  TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 720
            T SLLPE+  L+ +  +K +EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIAR+E
Sbjct: 176  TNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIE 235

Query: 721  HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 900
            +    L++LAQGGTAVGTGLNT+ GF + IA Q+S+ETG++F+TAPNKFEALAAHDA+VE
Sbjct: 236  NTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVE 295

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 1080
            ASGALNT+ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ 
Sbjct: 296  ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQV 355

Query: 1081 CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 1260
            CVQVMGNNAA+TFAGA+GQFELNVFKPVMI+NLLSS+RLLADA  SFRVHCV+GI+ N +
Sbjct: 356  CVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANRE 415

Query: 1261 RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 1440
            +I   LH SLMLVTALNPKIGYDAAS +AKNA KK ITL+ SALEL  LT  EFDEWV+P
Sbjct: 416  KINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIP 475

Query: 1441 EKMIGP 1458
            E M+GP
Sbjct: 476  ENMVGP 481

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
            converts fumaric acid to L-malic acid in the TCA cycle;
            cytosolic and mitochondrial distribution determined by
            the N-terminal targeting sequence, protein conformation,
            and status of glyoxylate shunt; phosphorylated in
            mitochondria
          Length = 488

 Score =  746 bits (1927), Expect = 0.0
 Identities = 371/461 (80%), Positives = 413/461 (89%)
 Frame = +1

Query: 79   FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 258
            FR ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFGVLKKSAA+VNE 
Sbjct: 28   FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 259  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 438
            LG L+P I+KAIQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG+
Sbjct: 88   LGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 439  LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 618
            +GSKQVHPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL  L+ + + K+ EF HIV
Sbjct: 148  IGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIV 207

Query: 619  KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 798
            KIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H+ ++L FLAQGGTAVGTGLNT+ GF
Sbjct: 208  KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 799  AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 978
              +IA Q+S+ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFKIA DIRYLGSGP
Sbjct: 268  DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 979  RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 1158
            RCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFAG+ GQFELNVFK
Sbjct: 328  RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 1159 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 1338
            PVMIANLL+S+RL+ DAA SFRVHCV+GI+ NE RI +LL +SLMLVTALNPKIGYDAAS
Sbjct: 388  PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 1339 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
             VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 448  KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  746 bits (1926), Expect = 0.0
 Identities = 372/473 (78%), Positives = 418/473 (88%)
 Frame = +1

Query: 43   RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 222
            RR+ ST      FR ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 22   RRMNST------FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75

Query: 223  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 402
            VLKKSAA+VNE LG L+P ++KAIQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 76   VLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEV 135

Query: 403  ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 582
            ISNRAIE+LGG++GSKQVHPNN CNQ+QSSNDTFP+VMHIAA  +I + L+PEL  L+ +
Sbjct: 136  ISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNA 195

Query: 583  FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 762
             + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H  ++L FLAQGGT
Sbjct: 196  LEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGT 255

Query: 763  AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            AVGTGLNT+ GF  +IA Q+S+ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 256  AVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 1122
            IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITF 
Sbjct: 316  IAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFG 375

Query: 1123 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 1302
            G+ GQFELNVFKPVMIANLL+S+RL+ADA+RSFR+HCV+GI+ NE RI +LL +SLMLVT
Sbjct: 376  GSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVT 435

Query: 1303 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 436  ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
            highly similar to uniprot|P08417 Saccharomyces cerevisiae
            YPL262W FUM1 Fumarase converts fumaric acid to L-malic
            acid in the TCA cycle cytosolic and mitochondrial
            localization determined by the N-terminal mitochondrial
            targeting sequence and protein conformation
          Length = 505

 Score =  746 bits (1926), Expect = 0.0
 Identities = 376/476 (78%), Positives = 418/476 (87%)
 Frame = +1

Query: 34   SAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVR 213
            S   +L +T    Q+ RVETDAFGEI+VPADKYWGAQTQRS ENFRIGG RERMPE VV 
Sbjct: 29   SQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVH 88

Query: 214  AFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNA 393
            AFG+LKK+ A VNE  G L+P +A AI+QAADEVA G+L +HFPLVVFQTGSGTQSNMNA
Sbjct: 89   AFGILKKATATVNEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNA 148

Query: 394  NEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEAL 573
            NEVISNRAIELLGG+LGSK VHPNNH N +QSSNDTFP+VMHIAAV  IT+ LLP L AL
Sbjct: 149  NEVISNRAIELLGGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTAL 208

Query: 574  RVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQ 753
            + S Q+K++EFA IVKIGRTHLQDATPLTLGQEFSGY QQ+ANGI RVE   +SL+ LAQ
Sbjct: 209  KDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQ 268

Query: 754  GGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACS 933
            GGTAVGTGLNT+ G+AE +AA+V++ETG++F+TAPNKFEALAAHDAVVEASGALNTLA S
Sbjct: 269  GGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVS 328

Query: 934  LFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAI 1113
            LFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ CVQV GN++AI
Sbjct: 329  LFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAI 388

Query: 1114 TFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLM 1293
            TFAGASGQFELNVFKPVMI+NLLSS+ LL+DA+ SFRVHCVDGIQ N + IAKLLHESLM
Sbjct: 389  TFAGASGQFELNVFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLM 448

Query: 1294 LVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            LVTALNPKIGYDAAS VAKNAHK GITL+ SAL+L +LT  EFD WVVPE MIGP+
Sbjct: 449  LVTALNPKIGYDAASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGPK 504

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
            YPL262W (REAL)
          Length = 488

 Score =  745 bits (1924), Expect = 0.0
 Identities = 373/473 (78%), Positives = 418/473 (88%)
 Frame = +1

Query: 43   RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 222
            RR+ ST      FR ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 22   RRMNST------FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75

Query: 223  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 402
            VLKKSAA+VNE LG L+P I+KAIQ+AADEVA G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 76   VLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEV 135

Query: 403  ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 582
            ISNRAIE+LGG++GSK+VHPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL  L+ +
Sbjct: 136  ISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNA 195

Query: 583  FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 762
             + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H+ ++L FLAQGGT
Sbjct: 196  LEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGT 255

Query: 763  AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            AVGTGLNT+ GF  +IA Q+S+ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 256  AVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 1122
            IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFA
Sbjct: 316  IAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFA 375

Query: 1123 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 1302
            G+ GQFELNVFKPVMIANLL+S+RL+ DAA SFRVHCV+GI+ NE RI +LL +SLMLVT
Sbjct: 376  GSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVT 435

Query: 1303 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 436  ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (REAL)
          Length = 488

 Score =  744 bits (1921), Expect = 0.0
 Identities = 373/473 (78%), Positives = 417/473 (88%)
 Frame = +1

Query: 43   RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 222
            RR+ ST      FR+ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 22   RRMNST------FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75

Query: 223  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 402
            VLKKSAAVVNE LG L+P I+KAIQQAADEV  G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 76   VLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEV 135

Query: 403  ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 582
            ISNRAIE+LGG++GSK+VHPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL  L+ +
Sbjct: 136  ISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNA 195

Query: 583  FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 762
             + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H+ ++L FLAQGGT
Sbjct: 196  LEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGT 255

Query: 763  AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            AVGTGLNT+ GF  +IA Q+S ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 256  AVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 1122
            IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFA
Sbjct: 316  IAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFA 375

Query: 1123 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 1302
            G+ GQFELNVFKPVMIANLL+S+RL+ D+A SFRVHCV+GI+ NE RI +LL +SLMLVT
Sbjct: 376  GSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVT 435

Query: 1303 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 436  ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
            YPL262W
          Length = 496

 Score =  743 bits (1917), Expect = 0.0
 Identities = 361/461 (78%), Positives = 416/461 (90%)
 Frame = +1

Query: 79   FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 258
            FR+ETD FGEI+VPA+KYWGAQT+RS ENFRIGG RERMP+PVV+AFGVLKKSAA+VNE 
Sbjct: 36   FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 259  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 438
             GTL+P I+K IQ+AADEV QG+L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 
Sbjct: 96   YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 439  LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 618
            LGSKQVHPNNH NQAQSSND+FP+VMHIAAVTEIT  L+PE+  LR + + K+ +FAHIV
Sbjct: 156  LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 619  KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 798
            KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+EH+  +L+FLAQGGTAVGTGLNTR GF
Sbjct: 216  KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 799  AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 978
            AE+IA Q+S+ETG+ F+TAPNKFEALAAHDA+VEASGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 276  AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 979  RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 1158
            RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ C Q++GNN  I FAG  GQFELNVFK
Sbjct: 336  RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 1159 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 1338
            PVMI+NLLSS+RLL D ++SFR+HCV+GI+ NE+RIA L+++SLMLVTALNPKIGYD A+
Sbjct: 396  PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 1339 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
             VAKNAHKKGITL+ SA++LG LT++EFDEWVVPEKMIGP+
Sbjct: 456  KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
            YPL262W
          Length = 498

 Score =  727 bits (1876), Expect = 0.0
 Identities = 357/473 (75%), Positives = 414/473 (87%)
 Frame = +1

Query: 43   RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 222
            R + ++A   Q+FRVETD+FGEI VPAD+YWGAQTQRS +NF+IGG RE++PEPVVRAFG
Sbjct: 25   RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84

Query: 223  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 402
            +LKKSAA VNE LGTL+  IA  I+ AADEVA+G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 85   ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144

Query: 403  ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 582
            ISNRAIELLGGELGSKQVHPNNH NQ+QSSNDTFP+VMHIAA TEI   L+PEL+ L+ +
Sbjct: 145  ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204

Query: 583  FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 762
             Q K +EF+ IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV+ +   L FLAQGGT
Sbjct: 205  LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264

Query: 763  AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            AVGTGLNT+ GF + +A +VS+ETGL F TAPNKFEALAAHDA+VEASGALNTLACSLFK
Sbjct: 265  AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 1122
            IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFA
Sbjct: 325  IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384

Query: 1123 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 1302
            G+ GQFELNV+KP+MI+NLLSS+RLL DA++SFR+HC++ ++ N+D+I + L++SLMLVT
Sbjct: 385  GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444

Query: 1303 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            ALNPKIGYDAA+ VAKNAH K ITL+ SALELGVLT+ EFDEWV+PE MI P+
Sbjct: 445  ALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
            Anc_6.13 YPL262W
          Length = 493

 Score =  720 bits (1859), Expect = 0.0
 Identities = 349/469 (74%), Positives = 412/469 (87%)
 Frame = +1

Query: 55   STAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKK 234
            +TA + QQ+R+ETD+FGEI+VPADKYWGAQTQRS +NF+IGG+RER+P+P++ AFG+LKK
Sbjct: 24   TTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKK 83

Query: 235  SAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNR 414
            SAA+VNE LGTL+P +A  I++AADEV QG+L +HFPLVVFQTGSGTQ+NMN NEVISNR
Sbjct: 84   SAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNR 143

Query: 415  AIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRK 594
            AIEL+GG+LGSKQ+HPNNHCNQ+QSSNDTFPSVMHIAAV EIT SL+PEL  L+ +   K
Sbjct: 144  AIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVK 203

Query: 595  TDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGT 774
              EFA IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E +   L+FLAQGGTAVGT
Sbjct: 204  AKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGT 263

Query: 775  GLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAND 954
            GLNT+ GF + IA +VS+ETG+EF+TAPNKFEALAAHDA+V ASGALNT+A SLFKIA D
Sbjct: 264  GLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQD 323

Query: 955  IRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASG 1134
            IRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ CVQ+MGNN  I+ AG+ G
Sbjct: 324  IRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQG 383

Query: 1135 QFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNP 1314
            QFELNV+KP+MIANLL+S+RL+ DA +SFR+HC+D ++ N+D+I + L++SLMLVTALNP
Sbjct: 384  QFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNP 443

Query: 1315 KIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            KIGYDAAS +AKNAH K ITL+ SALEL  LT  EFDEWVVPE MIGP+
Sbjct: 444  KIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGPK 492

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
            YPL262W
          Length = 495

 Score =  714 bits (1842), Expect = 0.0
 Identities = 349/477 (73%), Positives = 410/477 (85%)
 Frame = +1

Query: 31   SSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVV 210
            +S   R  + +     FR ETD+FGEI VP DKYWGAQTQRSL+NF+IGG RE++P P++
Sbjct: 18   TSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPII 77

Query: 211  RAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMN 390
             AFG+LKKSAA+VNE+LGTL+  +AK I  AADEV+QG+L +HFPLVVFQTGSGTQSNMN
Sbjct: 78   EAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMN 137

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANEVISNRAIEL+GG+LGSK VHPNNH NQ+QSSNDTFP+VMHIAA+ EITR LLPEL +
Sbjct: 138  ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L+ S  +K++EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E A   L+FLA
Sbjct: 198  LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257

Query: 751  QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLAC 930
            QGGTAVGTGLNT+ GF + IA Q+S ETG+ F TAPNKFEALAAHDA+VE SGALNTLAC
Sbjct: 258  QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317

Query: 931  SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA 1110
            SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ C+QVMGN++ 
Sbjct: 318  SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHST 377

Query: 1111 ITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESL 1290
            ITFAG+ GQFELNV+KP++I+NLLSS+RLL DA+ SFRVHC+DG++ N + I + L++SL
Sbjct: 378  ITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSL 437

Query: 1291 MLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            MLVTALNP IGYD AS +AKNAH K ITL+ SALELG+LT+ +F EWV+PEKMIGP+
Sbjct: 438  MLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
            YPL262W
          Length = 465

 Score =  699 bits (1805), Expect = 0.0
 Identities = 335/461 (72%), Positives = 404/461 (87%)
 Frame = +1

Query: 82   RVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQL 261
            R+E D FGE+ VPA+KYWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+VNE L
Sbjct: 5    RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 262  GTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGEL 441
            GTL+P I+KAIQ+AADEVA+G L EHFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG+L
Sbjct: 65   GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 442  GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVK 621
            GSK VHPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPELE LR + + K+ EF  IVK
Sbjct: 125  GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 622  IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFA 801
            IGRTHLQDATPLTLGQEFSGY QQ+ NGI RV+++  +L+F+AQGGTAVGTG+NT++ F 
Sbjct: 185  IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 802  EQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPR 981
              +A Q+S ETG+EF+TAPNKFEALA+HDA+VE SGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 245  ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 982  CGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKP 1161
            CGYGELSLPENEPGSSIMPGKVNPTQNEA+ QAC+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305  CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 1162 VMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASA 1341
            +MI+NLL+S+RLL D+  SFR+HC+ GI+ NED+I KLL+ESLMLVTALNPKIGYDAA+A
Sbjct: 365  LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 1342 VAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD 1464
            +AK+AHK G+TL+ +AL+  +LT  +FDEW+VPE M+ P +
Sbjct: 425  IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
            YPL262W
          Length = 500

 Score =  696 bits (1795), Expect = 0.0
 Identities = 347/485 (71%), Positives = 399/485 (82%)
 Frame = +1

Query: 4    LRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGA 183
            L + R C  S +   +  +    Q  R ETD+FGEI+VPA+KYWGAQTQRS  NF+IGG 
Sbjct: 15   LNIFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGE 74

Query: 184  RERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQT 363
            RERMPEP++RAFG  KK+AA+VN  LGTL+  +  AI QAA+EV+QG L EHFPLVVFQT
Sbjct: 75   RERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQT 134

Query: 364  GSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEIT 543
            GSGTQSNMNANEVISNRAIELLGG LGSKQVHPNNH NQ+QSSNDTFP+VMHIAA+TEIT
Sbjct: 135  GSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEIT 194

Query: 544  RSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEH 723
             +LLP L  LR +   K  EF  I+KIGRTHLQDATPLTLGQEFSGYTQQ+ N I R+E 
Sbjct: 195  NTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK 254

Query: 724  AQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEA 903
                L+++AQGGTAVGTGLNT+ GFAEQ A Q+S +T L F T+PNKFE+LAAHDA+V  
Sbjct: 255  NLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNV 314

Query: 904  SGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQAC 1083
              +LNTLACSLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEA+ QAC
Sbjct: 315  HASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQAC 374

Query: 1084 VQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDR 1263
            VQVMGNN+ I+FAGASGQFELN +KP+MIANLLSS RLL+DA  SF +HC  GIQ N+D+
Sbjct: 375  VQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDK 434

Query: 1264 IAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPE 1443
            I +LLHESLMLVT+LNPKIGYDAAS VAKNAH KGITL+ SALEL +L+  +FDEWV PE
Sbjct: 435  IDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPE 494

Query: 1444 KMIGP 1458
             M+GP
Sbjct: 495  NMLGP 499

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
            Anc_6.13 YPL262W
          Length = 475

 Score =  690 bits (1780), Expect = 0.0
 Identities = 332/468 (70%), Positives = 401/468 (85%)
 Frame = +1

Query: 58   TAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKS 237
            T      FRVETD+FGEI+VP++KYWGAQTQRS +NF+IGG RE++P P+++AFG+LKKS
Sbjct: 7    TPSNESSFRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKS 66

Query: 238  AAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRA 417
            AA+VN+ LGTL+P IA  I +A+DEV QG+L +HFPLVVFQTGSGTQ+NMNANEVISNRA
Sbjct: 67   AAIVNQSLGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRA 126

Query: 418  IELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKT 597
             EL+G ELGSK++HPNNH NQ+QSSNDTFPSVMHIAAV E+  +L+P+L  L+ S   K 
Sbjct: 127  NELIGAELGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKA 186

Query: 598  DEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTG 777
             E+A+IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R++ +   L+FLAQGGTAVGTG
Sbjct: 187  KEYANIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTG 246

Query: 778  LNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDI 957
            LNT+ GF + IA +VS+ETG++F TAPNKFEALAAHDA+V AS A+ T+A SLFKIA DI
Sbjct: 247  LNTKVGFDKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDI 306

Query: 958  RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQ 1137
            RYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ  +Q+MGNN  I  AG+ GQ
Sbjct: 307  RYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQ 366

Query: 1138 FELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPK 1317
            FELNV+KP+MIANLL+S+RL++DA  SF++HCVDG++ N D+I + LH+SLMLVTALNPK
Sbjct: 367  FELNVYKPLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPK 426

Query: 1318 IGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 1461
            IGYDAAS +AKNAH K ITL+ SALELG+LT+ EFD+WV+PE MIGP+
Sbjct: 427  IGYDAASKLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 464

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 71/293 (24%), Positives = 109/293 (37%), Gaps = 2/293 (0%)
 Frame = +1

Query: 226  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 405
            L+K   + +++L  +  G+    +Q   E A G+   H             S+ + +   
Sbjct: 50   LQKIGLLTSDELTKVHHGL----EQIEKEWAAGEFARH------------PSDEDIHTAN 93

Query: 406  SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSF 585
              R  E++G E+  K VH        +S ND   + M I     +   LLP L+A     
Sbjct: 94   ERRLGEIIGREISGK-VHTG------RSRNDQVATDMRIYCRDILNEVLLPALQAFIKVL 146

Query: 586  QRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GT 762
              +  E   ++  G THLQ A P+      S Y         R++   E L     G G 
Sbjct: 147  TTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGA 206

Query: 763  AVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTLACSLF 939
              G      R F  +         GL F+    N   A++  D VVE           + 
Sbjct: 207  LAGHPYGIDREFLAR---------GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHIS 257

Query: 940  KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 1098
            + + D+  + S    G+ +LS      GSS+MP K NP   E L     +V G
Sbjct: 258  RFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 461

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 67/241 (27%), Positives = 95/241 (39%), Gaps = 2/241 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  E++G  +  K VH        +S ND   + M I     +  ++LP L +
Sbjct: 90   ANE---RRLGEIIGRGIAGK-VHTG------RSRNDQVATDMRIYCRDILNGTVLPALSS 139

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +E   ++  G THLQ A P+      S Y         R++   E L    
Sbjct: 140  LIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSP 199

Query: 751  QG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTL 924
             G G   G      R F   +AA      GL F     N   A+A  D VVE     +  
Sbjct: 200  LGAGALAGHPYGIDREF---LAA------GLNFNGVIGNSLTAVADRDFVVEIMFWGSLF 250

Query: 925  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNN 1104
               + + A D+  + S    G+ +LS      GSS+MP K NP   E L     +V G  
Sbjct: 251  MNHISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQL 308

Query: 1105 A 1107
            A
Sbjct: 309  A 309

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018c ARLY
          Length = 461

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 69/292 (23%), Positives = 110/292 (37%), Gaps = 1/292 (0%)
 Frame = +1

Query: 226  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 405
            L K   +   +L  +  G+ K I+   DE   G+ + H            +S+ + +   
Sbjct: 50   LTKLGLITESELAKIHSGL-KDIENEWDE---GKFVRH------------ESDEDIHTAN 93

Query: 406  SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSF 585
              R  EL+G ++  K VH        +S ND   + M I     +   + P +++L    
Sbjct: 94   ERRLGELIGRDIAGK-VHTG------RSRNDQVVTDMRIYCREILNEKIFPAMKSLINVL 146

Query: 586  QRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTA 765
              + ++   I+  G THLQ A P+      S Y       + R+E   E L     G  A
Sbjct: 147  VNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGA 206

Query: 766  VGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            +        G   Q  A+     GL F     N   A++  D VVE           + +
Sbjct: 207  LA---GHPYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSR 258

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 1098
             + D+  + S    G+ +LS      GSS+MP K N    E L     +V G
Sbjct: 259  FSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
            similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 462

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 64/242 (26%), Positives = 93/242 (38%), Gaps = 3/242 (1%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPEL-E 567
            ANE    R  E++G ++  K VH        +S ND   + M I     +   LLP L E
Sbjct: 91   ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 568  ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 747
             + V  +R   E  +++  G THLQ A P+      S Y       + R+    E     
Sbjct: 141  LVSVMVKRAEKEIGYLMP-GYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQS 199

Query: 748  AQG-GTAVGTGLNTRRGF-AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNT 921
              G G   G      R F AE++  Q             N   A++  D VVE       
Sbjct: 200  PLGAGALAGHPYGIDREFLAEELGFQ---------GVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 922  LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
                + + A D+  + S    G+ +L+      GSS+MP K N    E L     +V G+
Sbjct: 251  FMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 1102 NA 1107
             A
Sbjct: 309  LA 310

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
            YHR018C
          Length = 464

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 73/296 (24%), Positives = 113/296 (38%), Gaps = 7/296 (2%)
 Frame = +1

Query: 277  GIAKAIQQAADEVAQ-----GQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGEL 441
            G+ K      DE+++     G++ E +    F      +    ANE    R  E++G  +
Sbjct: 49   GLQKLGLLTEDELSEIHYGLGKIKEEWENNTFIRLPSDEDIHTANE---RRLGEIIGTGI 105

Query: 442  GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVK 621
              K VH        +S ND   + M I     +T +LL  L+ L     R+ +E   I+ 
Sbjct: 106  AGK-VHTG------RSRNDQVATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILM 158

Query: 622  IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFA 801
             G THLQ A P+      S Y         R+   QE L  L       G       G  
Sbjct: 159  PGYTHLQRAQPIRWSHWLSFYATYFTEDYKRL---QEILARLNVSPLGAGALAGHPYGID 215

Query: 802  EQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPR 981
             +  AQ    +G+      N   A++  D VVE     +     + + + D+  + S   
Sbjct: 216  REFLAQDLGFSGV----IGNSLVAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTAE 270

Query: 982  CGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA--ITFAGASGQFE 1143
             G+ +LS      GSS+MP K N    E L     +V G+ A   +T  G    ++
Sbjct: 271  FGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGFLMTLKGVPSTYD 325

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa] {ON}
            complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 41.6 bits (96), Expect = 0.004
 Identities = 64/239 (26%), Positives = 89/239 (37%), Gaps = 2/239 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  EL+G ++  K VH        +S ND   + + I     I   LLP L++
Sbjct: 89   ANE---RRLGELIGTDISGK-VHTG------RSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +    I+  G THLQ A P+      S Y         R++   + L    
Sbjct: 139  LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 751  QG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTL 924
             G G   G      R F            GL F     N   A++  D VVE        
Sbjct: 199  LGAGALAGHPYGIDREFL---------ANGLGFNGVIGNSLVAVSDRDFVVELLFWGTLF 249

Query: 925  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
               + + A D+  + S    G+  LS      GSS+MP K N    E L     +V GN
Sbjct: 250  MNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 41.6 bits (96), Expect = 0.004
 Identities = 71/295 (24%), Positives = 114/295 (38%), Gaps = 1/295 (0%)
 Frame = +1

Query: 226  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 405
            L+K+  +  ++L ++  G+    +Q   E  QG  ++H       T         ANE  
Sbjct: 49   LQKTGLLTKDELESIHEGL----KQVEQEWEQGVFVKHVDDEDIHT---------ANE-- 93

Query: 406  SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPEL-EALRVS 582
              R  E++G  +  K VH        +S ND   + M +     +   + P L E ++V 
Sbjct: 94   -RRLGEIIGRHISGK-VHTG------RSRNDQVATDMRLYCREMLQDKVEPALFELIKVL 145

Query: 583  FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 762
              R  +E   ++  G THLQ A P+      S Y         R++   E +  L Q   
Sbjct: 146  LHRAREEI-DVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLK---EVIARLNQSPL 201

Query: 763  AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
              G       G   +  A    E G +     N   A++  D VVE     +     + +
Sbjct: 202  GAGALAGHPYGIDREYLAC---ELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISR 257

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNA 1107
            +A D+  + S    G+ +L+      GSS+MP K NP   E L     +V G  A
Sbjct: 258  LAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] {ON}
            Anc_1.354 YHR018C
          Length = 462

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 62/241 (25%), Positives = 93/241 (38%), Gaps = 4/241 (1%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  E++G ++  K VH        +S ND   + + I     +   L P L +
Sbjct: 91   ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +E   I+  G THLQ A P+      S Y       + R++  Q  +RF  
Sbjct: 141  LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLK--QILVRFNK 198

Query: 751  Q---GGTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALN 918
                 G   G      R F  +         GLEF     N   A++  D VVE      
Sbjct: 199  SPLGAGALAGHPYGIDREFLAE---------GLEFNGVIGNSLVAVSDRDFVVELMFWST 249

Query: 919  TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 1098
                 + + A D+  + S    G+ +L+      GSS+MP K N    E L     +V G
Sbjct: 250  LFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 1099 N 1101
            +
Sbjct: 308  D 308

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
            YHR018C
          Length = 463

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 61/238 (25%), Positives = 92/238 (38%), Gaps = 1/238 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  E++G ++  K VH        +S ND   + + I     ++  LL  LE 
Sbjct: 91   ANE---RRLGEIIGTKISGK-VHTG------RSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L      + +E    +  G THLQ A P+      S Y         R+   +E L    
Sbjct: 141  LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 751  QG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLA 927
             G G   G      R   E +A ++  ++ +      N   A++  D VVE         
Sbjct: 201  LGAGALAGHPYGIDR---EYLAEKLGFDSVIG-----NSLVAVSDRDFVVEILFWSTLFM 252

Query: 928  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
              + + A D+  + S    G+ +LS      GSS+MP K N    E L     +V GN
Sbjct: 253  NHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 40.8 bits (94), Expect = 0.007
 Identities = 61/241 (25%), Positives = 91/241 (37%), Gaps = 2/241 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  E++G ++  K VH        +S ND   + + I     +   L P + +
Sbjct: 91   ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQCVTDLRIYCRDVLNEKLFPGMTS 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +E   I+  G THLQ A P+      S Y       + R++   E      
Sbjct: 141  LIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKSP 200

Query: 751  QG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTL 924
             G G   G      R F  +         GL F     N   A++  D VVE        
Sbjct: 201  LGAGALAGHPYGIDREFLAE---------GLGFDGVIGNSLVAVSDRDFVVELMFWGTLF 251

Query: 925  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNN 1104
               + + A D+  + S    G+ +LS      GSS+MP K N    E L     +V G+ 
Sbjct: 252  MNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 1105 A 1107
            A
Sbjct: 310  A 310

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
            YHR018C
          Length = 462

 Score = 40.8 bits (94), Expect = 0.007
 Identities = 64/242 (26%), Positives = 93/242 (38%), Gaps = 3/242 (1%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPEL-E 567
            ANE    R  E++G  +  K VH        +S ND   + M I     +   LLP + +
Sbjct: 91   ANE---RRLGEIIGRHIAGK-VHTG------RSRNDQVVTDMRIYCRDILNEKLLPFMAD 140

Query: 568  ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 747
             ++V  +R  +E   ++  G THLQ A P+      S Y         R++   E L   
Sbjct: 141  LIKVLVKRAENEIDTLMP-GYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVS 199

Query: 748  AQG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEF-RTAPNKFEALAAHDAVVEASGALNT 921
              G G   G      R F  +         GL F     N   A++  D VVE       
Sbjct: 200  PLGAGALAGHPYGIDREFLAE---------GLNFGGVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 922  LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
                + + A D+  + S    G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 251  FMNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 1102 NA 1107
             A
Sbjct: 309  LA 310

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
            similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 40.8 bits (94), Expect = 0.007
 Identities = 67/278 (24%), Positives = 105/278 (37%), Gaps = 5/278 (1%)
 Frame = +1

Query: 280  IAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVH 459
            I K + +   E + G+  EH            +    ANE    R  EL+G  +  K VH
Sbjct: 63   IHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGELIGTAVAGK-VH 109

Query: 460  PNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA-LRVSFQRKTDEFAHIVKIGRTH 636
                    +S ND   + M I     +   +LP + + +RV   R  +E   ++  G TH
Sbjct: 110  TG------RSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREE-VDVLMPGYTH 162

Query: 637  LQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVG---TGLNTRRGFAEQ 807
            LQ A P+      S Y         R+    E L     G  A+     G++ R+  AEQ
Sbjct: 163  LQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPYGID-RKYLAEQ 221

Query: 808  IAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCG 987
            +                N   A++  D V+E     +     + + A D+    +     
Sbjct: 222  LGFN---------GIIGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLIIYSTAE--- 269

Query: 988  YGELSLPE-NEPGSSIMPGKVNPTQNEALTQACVQVMG 1098
            +G ++L +    GSS+MP K NP   E L     +V G
Sbjct: 270  FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 38.9 bits (89), Expect = 0.029
 Identities = 59/238 (24%), Positives = 90/238 (37%), Gaps = 1/238 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  EL+G ++  K VH        +S ND   + + I     +  SL P ++ 
Sbjct: 91   ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +    I+  G THLQ A P+      S Y         R+    + L  L 
Sbjct: 141  LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLV---QILHRLN 197

Query: 751  QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTLA 927
            Q     G       G   +  A+     GL F +   N   A++  D +VE         
Sbjct: 198  QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 928  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
              + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 38.5 bits (88), Expect = 0.038
 Identities = 58/238 (24%), Positives = 91/238 (38%), Gaps = 1/238 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  E++G ++  K VH        +S ND   + + I     +  +L P L+ 
Sbjct: 91   ANE---RRLGEIIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++     +I+  G THLQ A P+      S Y         R++   + L  L 
Sbjct: 141  LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLD---QILHRLN 197

Query: 751  QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTLA 927
            Q     G       G   +  A+     GL F +   N   A++  D +VE         
Sbjct: 198  QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 928  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
              + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
            YHR018C (REAL)
          Length = 463

 Score = 38.1 bits (87), Expect = 0.050
 Identities = 59/238 (24%), Positives = 90/238 (37%), Gaps = 1/238 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  EL+G ++  K VH        +S ND   + + I     +  +L P L+ 
Sbjct: 91   ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +    I+  G THLQ A P+      S Y         R+    + L  L 
Sbjct: 141  LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLG---QILHRLN 197

Query: 751  QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTLA 927
            Q     G       G   +  A+     GL F +   N   A++  D +VE         
Sbjct: 198  QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 928  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
              + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa] {ON}
            YHR018C (ARG4) - argininosuccinate lyase [contig 260]
            FULL
          Length = 465

 Score = 38.1 bits (87), Expect = 0.050
 Identities = 62/253 (24%), Positives = 97/253 (38%), Gaps = 2/253 (0%)
 Frame = +1

Query: 355  FQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVT 534
            F    G +    ANE    R  E++G  +  K VH        +S ND   + M I    
Sbjct: 81   FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-VHTG------RSRNDQVATDMRIYC-R 129

Query: 535  EITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIAR 714
            E   +L   LE L  +  +++++    +  G THLQ A P+      + Y         R
Sbjct: 130  EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 715  VEHAQESLRFLAQG-GTAVGTGLNTRRGF-AEQIAAQVSRETGLEFRTAPNKFEALAAHD 888
            ++  +E L     G G   G      R F AE++                N  +A++  D
Sbjct: 190  LKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFS---------DVIGNSLQAVSDRD 240

Query: 889  AVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA 1068
             VVE     +     + + + D+  + S     + +LS      GSS+MP K NP   E 
Sbjct: 241  FVVEIMFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLEL 298

Query: 1069 LTQACVQVMGNNA 1107
            L     +V G+ A
Sbjct: 299  LRGKSGRVFGSLA 311

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
            YHR018C
          Length = 465

 Score = 38.1 bits (87), Expect = 0.050
 Identities = 61/241 (25%), Positives = 92/241 (38%), Gaps = 2/241 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  E++G  +  K VH        +S ND   + + I     +   L P+L+A
Sbjct: 91   ANE---RRLGEIIGRNIAGK-VHTG------RSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++  E   ++  G THLQ A P+      S Y         R+    + +    
Sbjct: 141  LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSP 200

Query: 751  QG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEF-RTAPNKFEALAAHDAVVEASGALNTL 924
             G G   G      R F   +AA      GL F     N   A++  D +VE        
Sbjct: 201  LGAGALAGHPYGIDREF---LAA------GLGFDGVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 925  ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNN 1104
               + + A D+  + S    G+ +L+      GSS+MP K N    E L     +V G+ 
Sbjct: 252  MNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 1105 A 1107
            A
Sbjct: 310  A 310

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
            ARG4Argininosuccinate lyase, catalyzes the final step in
            the arginine biosynthesis pathway
          Length = 463

 Score = 37.7 bits (86), Expect = 0.066
 Identities = 58/238 (24%), Positives = 90/238 (37%), Gaps = 1/238 (0%)
 Frame = +1

Query: 391  ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 570
            ANE    R  EL+G ++  K VH        +S ND   + + I     +  +L P L+ 
Sbjct: 91   ANE---RRLGELIGRDIAGK-VHTG------RSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 571  LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 750
            L     ++ +    ++  G THLQ A P+      S Y         R+    + L  L 
Sbjct: 141  LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLG---QILHRLN 197

Query: 751  QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTLA 927
            Q     G       G   +  A+     GL F +   N   A++  D +VE         
Sbjct: 198  QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 928  CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
              + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253  NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
            YHR018C
          Length = 466

 Score = 37.4 bits (85), Expect = 0.087
 Identities = 60/260 (23%), Positives = 96/260 (36%), Gaps = 1/260 (0%)
 Frame = +1

Query: 322  GQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDT 501
            G++ + +    F+     +    ANE    R  E++G  +  K VH        +S ND 
Sbjct: 68   GEIKKEWDNGTFKRHPNDEDIHTANE---RRLGEIIGTHIAGK-VHTG------RSRNDQ 117

Query: 502  FPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSG 681
              + + I     +   LLP +  L     ++ +    I+  G THLQ A P+      S 
Sbjct: 118  CVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTHLQRAQPIRWSHWLSS 177

Query: 682  YTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQ-VSRETGLEFRTAP 858
            Y         R++   E L     G  A+        G    I  Q +S E G       
Sbjct: 178  YATYFTEDYKRLKQVLERLNKCPLGAGAIA-------GHPYGIDRQYLSDELGFN-SIIG 229

Query: 859  NKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMP 1038
            N   A++  D +V+           + + + D+  + S    G+ +LS      GSS+MP
Sbjct: 230  NSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMP 287

Query: 1039 GKVNPTQNEALTQACVQVMG 1098
             K N    E L     +V G
Sbjct: 288  QKKNADSLELLRGKSGRVFG 307

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa] {ON}
            highly similar to uniprot|P04076 Saccharomyces cerevisiae
            YHR018C ARG4 Argininosuccinate lyase catalyzes the final
            step in the arginine biosynthesis pathway
          Length = 465

 Score = 36.6 bits (83), Expect = 0.15
 Identities = 70/288 (24%), Positives = 113/288 (39%), Gaps = 8/288 (2%)
 Frame = +1

Query: 262  GTLEPGIAKAIQQAADEVAQGQ--LMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 435
            G L+ G+    Q+  DE+ +G   +   +    F    G +    ANE    R  E++G 
Sbjct: 50   GLLKAGLLT--QEELDEIHRGLEIIRGEWASNSFVEKDGDEDIHTANE---RRLGEIIGR 104

Query: 436  ELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHI 615
             +  K VH        +S ND   + M I    E   ++   L+ L  +  ++ ++    
Sbjct: 105  HIAGK-VHTG------RSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDA 156

Query: 616  VKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GTAVGTGLNTRR 792
            +  G THLQ A P+      + Y         R++  +E L     G G   G      R
Sbjct: 157  LMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYGIDR 216

Query: 793  GFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLF-----KIANDI 957
               E IA ++  +  +      N  +A++  D VVE         CSLF     + + D+
Sbjct: 217  ---EHIAERLGFDGVIG-----NSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL 263

Query: 958  RYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 1101
              + S     + +LS      GSS+MP K NP   E L     +V G+
Sbjct: 264  -IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359w ADE13
          Length = 482

 Score = 34.7 bits (78), Expect = 0.62
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 6/161 (3%)
 Frame = +1

Query: 601  EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGL 780
            E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  
Sbjct: 145  EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGT-TGTQA 203

Query: 781  NTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            +    F       E++  +V+   G  F T         +    ++    L++ A S  K
Sbjct: 204  SFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKIDIDVLAPLSSFAASAHK 261

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
            +A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 262  MATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 34.7 bits (78), Expect = 0.70
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 6/92 (6%)
 Frame = +1

Query: 235 SAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNR 414
           S A+ +++L   +P   K + + +D+   G     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 415 AIELLGGELGSKQVH------PNNHCNQAQSS 492
            +E   G+  + Q+       PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
            Ashbya gossypii ABL006C
          Length = 482

 Score = 34.3 bits (77), Expect = 0.81
 Identities = 42/182 (23%), Positives = 74/182 (40%), Gaps = 10/182 (5%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            L+P+L  +         ++  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAP-NKFEAL-------AAH 885
              + F    GT       T+  F         +   L+ R A  + F+ +        + 
Sbjct: 188  NDIGFRGVKGTT-----GTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTYSR 242

Query: 886  DAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQ 1059
               ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M  K NP +
Sbjct: 243  KVDIDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMAYKRNPMR 297

Query: 1060 NE 1065
             E
Sbjct: 298  CE 299

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 41/178 (23%), Positives = 76/178 (42%), Gaps = 6/178 (3%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +   E A+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 730  ESLRFLAQGGTAVGTGLNTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDA 891
              +      GT  GT  +    F       E + A+V+   G + +  P   +   +   
Sbjct: 188  NDIGLRGVKGT-TGTQASFLALFHGNHDKVEALDARVTELLGFD-KVYPVTGQTY-SRKI 244

Query: 892  VVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
             ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
            (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            L+P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT    G+ L       +++ A   R T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
            similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            L+P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 42/177 (23%), Positives = 73/177 (41%), Gaps = 5/177 (2%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            L+P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R    L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_3.185 Chr3 (280674..281846) [1173 bp, 391 aa] {ON} YCL028W
           (REAL)
          Length = 391

 Score = 33.1 bits (74), Expect = 1.7
 Identities = 37/147 (25%), Positives = 54/147 (36%), Gaps = 3/147 (2%)
 Frame = +1

Query: 73  QQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVN 252
           QQ + ++ AF  +   A  Y G QTQ + + +   G                       N
Sbjct: 257 QQQQGQSGAFSSLASMAQSYLGGQTQSNQQQYSQQGQ----------------------N 294

Query: 253 EQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQT---GSGTQSNMNANEVISNRAIE 423
           +Q    + G  +  QQ   +  QGQ      L    +   G+   SN N+N   SN   +
Sbjct: 295 QQQQYQQQGQNQQYQQQGQQQQQGQSGSFSALASMASSYLGNHQNSNSNSN---SNSGGQ 351

Query: 424 LLGGELGSKQVHPNNHCNQAQSSNDTF 504
               E G     P N  NQ  +SND+F
Sbjct: 352 YQSNEYG----RPQNGGNQNSNSNDSF 374

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 42/177 (23%), Positives = 74/177 (41%), Gaps = 5/177 (2%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 40/175 (22%), Positives = 72/175 (41%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +   E A+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
            ADE13Adenylosuccinate lyase, catalyzes two steps in the
            'de novo' purine nucleotide biosynthetic pathway;
            expression is repressed by adenine and activated by Bas1p
            and Pho2p; mutations in human ortholog ADSL cause
            adenylosuccinase deficiency
          Length = 482

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 40/175 (22%), Positives = 72/175 (41%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +   E A+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa] {ON}
            
          Length = 2329

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 28/104 (26%), Positives = 50/104 (48%), Gaps = 2/104 (1%)
 Frame = -2

Query: 356  NTTSGKCSISWPWATSSAACWIAFAMPGSSVPSCSLTTAADFLSTPNARTTGSGMRSRAP 177
            +T+SG  S S    +SS AC  + + P SSV + S ++ A   S  ++ ++G+       
Sbjct: 1437 STSSGASSASSAAVSSSVACSSSSSNPSSSV-AYSASSGAPSSSVGSSASSGA------- 1488

Query: 176  PIRKFSSDRCVCAP--QYLSAGTRISPKASVSTLNCCGAPAVDI 51
            P     S   + AP     S+ +  +  +SV++  C GAP+  +
Sbjct: 1489 PSSSVVSSASIAAPSSSVASSASSAAASSSVASSACSGAPSSSV 1532

>TDEL0B07680 Chr2 (1348302..1349744) [1443 bp, 480 aa] {ON} 
           possible pseudogene; NNN added to avoid internal stop
           codon
          Length = 480

 Score = 32.7 bits (73), Expect = 2.4
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 9/129 (6%)
 Frame = -2

Query: 365 PVWNTTSGKCSISWPW--ATSSAACWIAFAMPGSSVPSCSLTTAADFLSTPNARTTGSGM 192
           P+W   + KCS S     +TSSA      ++P SS  S  +  ++   S P + ++ + +
Sbjct: 196 PLWYWNNPKCSPSSTTSSSTSSAPSSSTSSVPTSSSSSTPVKPSSSTSSVPTSSSSSTPV 255

Query: 191 R----SRAPPIRKFSSDRCVCAPQYLSAGTRISPKASVSTLNCCGAP---AVDINLRAAL 33
           +    S + P++  SS   V  P   S+ T + P +S S+     AP   +V  + + + 
Sbjct: 256 KPSSSSSSTPVKPSSSTSSV--PTSSSSSTPVKPSSSTSS-----APKSFSVSSSHQPST 308

Query: 32  LPTQPLLSL 6
           LPT+   S+
Sbjct: 309 LPTRNTTSI 317

>TDEL0A00100 Chr1 complement(5449..6897) [1449 bp, 482 aa] {ON}
          Length = 482

 Score = 32.7 bits (73), Expect = 2.4
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 9/129 (6%)
 Frame = -2

Query: 365 PVWNTTSGKCSISWPW--ATSSAACWIAFAMPGSSVPSCSLTTAADFLSTPNARTTGSGM 192
           P+W   + KCS S     +TSSA      ++P SS  S  +  ++   S P + ++ + +
Sbjct: 198 PLWYWNNPKCSPSSTTSSSTSSAPSSSTSSVPTSSSSSTPVKPSSSTSSVPTSSSSSTPV 257

Query: 191 R----SRAPPIRKFSSDRCVCAPQYLSAGTRISPKASVSTLNCCGAP---AVDINLRAAL 33
           +    S + P++  SS   V  P   S+ T + P +S S+     AP   +V  + + + 
Sbjct: 258 KPSSSSSSTPVKPSSSTSSV--PTSSSSSTPVKPSSSTSS-----APKSFSVSSSHQPST 310

Query: 32  LPTQPLLSL 6
           LPT+   S+
Sbjct: 311 LPTRNTTSI 319

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
            (REAL)
          Length = 482

 Score = 32.7 bits (73), Expect = 2.5
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +   E A+
Sbjct: 128  IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R T  L F           +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       E    + + GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
           similarities with Saccharomyces cerevisiae YPR115W
           Hypothetical ORF and to YGR097W uniprot|P48361
           Saccharomyces cerevisiae YGR097W ASK10 Component of the
           RNA polymerase II holoenzyme phosphorylated in response
           to oxidative stress has a role in destruction of Ssn8p
           which relieves repression of stress-response genes
          Length = 1010

 Score = 32.7 bits (73), Expect = 2.8
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 16/102 (15%)
 Frame = +1

Query: 403 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVT---------------- 534
           ++N +I+L G EL   Q+ PN+ C+ A   N    S+  I  +                 
Sbjct: 219 LNNSSIDL-GQEL---QLEPNDSCSGAGFMNFGSGSIQDIQVILKKYHLSLASQQVKSSK 274

Query: 535 EITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLT 660
           EIT  ++P+LE LR     K  E   +    +T++Q+   LT
Sbjct: 275 EITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALT 316

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 32.3 bits (72), Expect = 3.2
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R T  L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4.197
            YLR359W
          Length = 482

 Score = 32.3 bits (72), Expect = 3.2
 Identities = 38/158 (24%), Positives = 65/158 (41%), Gaps = 3/158 (1%)
 Frame = +1

Query: 601  EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT--AVGT 774
            ++  +  +G TH Q A   TLG+  + + Q++   +     A+  +      GT     +
Sbjct: 145  QYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQAS 204

Query: 775  GLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 951
             L    G  +++ A   R T  L F T         +    ++    L++ A S  K+A 
Sbjct: 205  FLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDIDVLAPLSSFAASAHKMAT 264

Query: 952  DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
            DIR L +       E    +++ GSS M  K NP + E
Sbjct: 265  DIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kwal_55.21713 s55 complement(949962..950186) [225 bp, 74 aa] {OFF}
           [contig 126] FULL
          Length = 74

 Score = 29.6 bits (65), Expect = 3.6
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 3/49 (6%)
 Frame = -2

Query: 188 SRAPPIRKFSSDRCVCAPQYLSAGT---RISPKASVSTLNCCGAPAVDI 51
           +RAPP+    S  C+ +P   S+G    RI P   +ST+ CC A ++D+
Sbjct: 24  TRAPPLY---STTCLRSPA--SSGMLYMRIVPSRYISTIRCCDARSIDL 67

>Kwal_47.18394 s47 (808025..808321) [297 bp, 98 aa] {OFF} [contig
           195] FULL
          Length = 98

 Score = 30.0 bits (66), Expect = 4.2
 Identities = 19/57 (33%), Positives = 27/57 (47%)
 Frame = -2

Query: 398 SLAFMLLCVPDPVWNTTSGKCSISWPWATSSAACWIAFAMPGSSVPSCSLTTAADFL 228
           S+  M  C P P+   T   CS         + CW + +  GSS PS S+ T++ FL
Sbjct: 2   SVPAMFTCSP-PISTKTGVSCS---------SLCWSSSSSLGSSSPSVSVCTSSSFL 48

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 32.0 bits (71), Expect = 4.3
 Identities = 39/154 (25%), Positives = 64/154 (41%), Gaps = 6/154 (3%)
 Frame = +1

Query: 622  IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF- 798
            +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  +    F 
Sbjct: 152  LGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGT-TGTQASFLALFH 210

Query: 799  -----AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRY 963
                  E++  +V    G  F T         +    ++A   L++ A +  K+A DIR 
Sbjct: 211  GDHNKVEKLDERVVELLG--FDTVYPVTGQTYSRKIDIDAFAPLSSFAATAHKMATDIRL 268

Query: 964  LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
            L +       E    +++ GSS M  K NP + E
Sbjct: 269  LANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>ZYRO0G05104g Chr7 complement(410797..412200) [1404 bp, 467 aa] {ON}
           some similarities with uniprot|P38844 Saccharomyces
           cerevisiae YHR143W
          Length = 467

 Score = 31.6 bits (70), Expect = 5.6
 Identities = 31/118 (26%), Positives = 51/118 (43%), Gaps = 2/118 (1%)
 Frame = -2

Query: 371 PDPVWNTTSGKCSISWPWATSSAACWIAFAMPGSSVPSCSL-TTAADFLSTPNARTTGSG 195
           P     + S  CS + P  T S++   + + P SS PS S  +++    STP++ T  S 
Sbjct: 113 PSVTTPSVSSSCSSTTPSTTPSSST-PSSSTPSSSTPSSSTPSSSTPSSSTPSSSTPSSS 171

Query: 194 MRSRAPPIRKF-SSDRCVCAPQYLSAGTRISPKASVSTLNCCGAPAVDINLRAALLPT 24
             S + P     SS+    +    SA +  SP +S    +   + +   N R  L P+
Sbjct: 172 TPSSSTPSSSTPSSNSPSSSSPSTSAPSSSSPSSSSQVYSTSSSDSQSSNSRFTLQPS 229

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 31.6 bits (70), Expect = 5.6
 Identities = 57/261 (21%), Positives = 102/261 (39%), Gaps = 7/261 (2%)
 Frame = +1

Query: 601  EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGL 780
            E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  
Sbjct: 145  EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGT-TGTQA 203

Query: 781  NTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 942
            +    F       E++  +V    G  F T         +    ++    L + A +  K
Sbjct: 204  SFLALFHGNHDKVEELDERVVELLG--FDTVYPVTGQTYSRKIDIDVVSPLVSFAATAHK 261

Query: 943  IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 1122
            +A DIR L +       E    +++ GSS M  K NP + E +  +  + +G+  + T  
Sbjct: 262  MATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCERVC-SLARHLGSLLSDTVQ 317

Query: 1123 GASGQ-FELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLV 1299
             AS Q FE  +    +    L S  L  D   +  ++   G+      IA+ +   L  +
Sbjct: 318  TASVQWFERTLDDSAIRRISLPSAFLTTDILLTTLLNISSGLVVYPKVIARRIQSELPFM 377

Query: 1300 TALNPKIGYDAASAVAKNAHK 1362
               N  +      A  ++ H+
Sbjct: 378  ATENIIMAMVEKGASRQDVHE 398

>KLTH0D05236g Chr4 (469109..470785) [1677 bp, 558 aa] {ON} conserved
           hypothetical protein
          Length = 558

 Score = 31.6 bits (70), Expect = 5.8
 Identities = 35/117 (29%), Positives = 50/117 (42%)
 Frame = -2

Query: 362 VWNTTSGKCSISWPWATSSAACWIAFAMPGSSVPSCSLTTAADFLSTPNARTTGSGMRSR 183
           V  + S + ++S   AT +A+   A +   S+ PS    TAA   STP      +   S 
Sbjct: 88  VQQSASAQSALSGQSATGTAS---ATSRRSSAAPS----TAASTTSTPVTAPAAARRASP 140

Query: 182 APPIRKFSSDRCVCAPQYLSAGTRISPKASVSTLNCCGAPAVDINLRAALLPTQPLL 12
           APP+   S D  + APQ          ++SV+      APA      AA  PT+  L
Sbjct: 141 APPVSPHSQDPGL-APQ-------PKQRSSVAGTATVSAPATSTATAAAKKPTKTAL 189

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 31.2 bits (69), Expect = 7.4
 Identities = 37/151 (24%), Positives = 62/151 (41%), Gaps = 3/151 (1%)
 Frame = +1

Query: 622  IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT--AVGTGLNTRRG 795
            +G TH Q A   TLG+  + + Q++   +     A+  +      GT     + L    G
Sbjct: 152  LGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHG 211

Query: 796  FAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGS 972
              +++ A   R T  L F T         +    ++    L++ A +  K+A DIR L +
Sbjct: 212  DHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDIDVLSPLSSFAATAHKMATDIRLLAN 271

Query: 973  GPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                   E    +++ GSS M  K NP + E
Sbjct: 272  LKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
            (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 31.2 bits (69), Expect = 7.4
 Identities = 38/175 (21%), Positives = 71/175 (40%), Gaps = 3/175 (1%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   T+G+  + + Q++   +     A+
Sbjct: 128  IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETG-LEFRTAPNKFEALAAHDAVVE 900
              +      GT     + L    G  +++ A   R    L F T         +    ++
Sbjct: 188  NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKIDID 247

Query: 901  ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
                L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248  VLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
            Anc_4.197 YLR359W
          Length = 482

 Score = 31.2 bits (69), Expect = 7.4
 Identities = 41/178 (23%), Positives = 72/178 (40%), Gaps = 6/178 (3%)
 Frame = +1

Query: 550  LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 729
            ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128  IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 730  ESLRFLAQGGTAVGTGLNTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDA 891
              L      GT  GT  +    F       E++  +V+   G  F T         +   
Sbjct: 188  NDLGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 892  VVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 1065
             ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 245  DIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>ZYRO0A13662g Chr1 (1088049..1090811) [2763 bp, 920 aa] {ON} some
           similarities with uniprot|P08640 Saccharomyces
           cerevisiae YIR019C MUC1 GPI-anchored cell surface
           glycoprotein required for diploid pseudohyphal formation
           and haploid invasive growth transcriptionally regulated
           by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
           pathway (via Flo8p)
          Length = 920

 Score = 31.2 bits (69), Expect = 8.3
 Identities = 37/126 (29%), Positives = 55/126 (43%), Gaps = 5/126 (3%)
 Frame = -2

Query: 371 PDPVWNTTSGKCSISWPWATSSAACWIAFAMPGSSVPSCSLTTAADFLSTPNARTTGSGM 192
           P P+ +  SG  S + P +  SA      + P SS+PS   ++      +P      SG 
Sbjct: 431 PSPLPSAPSGSWSSAPPSSLPSAPSGSWSSAPPSSLPSAPPSSLPSAPFSPKT-IVPSGS 489

Query: 191 RSRAP----PIRKFSSDRCVCAPQYLSAGTRISPKASVSTLNCCGAPAVDINLRAALLP- 27
            S AP    P   FSS   V +  + SA +  SP A  S+      P V    R++  P 
Sbjct: 490 WSSAPSSSLPSASFSSKAIVSSGSWSSAPSSSSPSAPSSS-----KPFVSSCSRSSAPPS 544

Query: 26  TQPLLS 9
           ++PL+S
Sbjct: 545 SKPLVS 550

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
            highly similar to uniprot|Q05911 Saccharomyces cerevisiae
            YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
            in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 30.8 bits (68), Expect = 9.8
 Identities = 57/256 (22%), Positives = 98/256 (38%), Gaps = 8/256 (3%)
 Frame = +1

Query: 622  IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF- 798
            +G TH Q A   TLG+  + + Q +   +   + A+  +      GT  GT  +    F 
Sbjct: 152  LGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRARNDIGLRGVKGT-TGTQASFLALFH 210

Query: 799  -----AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRY 963
                  E++  +V+   G  F T         +    ++    L + A +  K+A DIR 
Sbjct: 211  GNHDKVEELDQRVTELLG--FETVYPVTGQTYSRKIDIDVLAPLASFAATAHKMATDIRL 268

Query: 964  LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN--NAAITFAGASGQ 1137
            L +       E    + + GSS M  K NP + E +  +  + MG+  N A+  A     
Sbjct: 269  LANLKEV---EEPFEKTQIGSSAMAYKRNPMRCERVC-SLARHMGSLFNDAVQTASVQ-W 323

Query: 1138 FELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPK 1317
            FE  +    +    L S  L AD   S  ++   G+      I + ++  L  +   N  
Sbjct: 324  FERTLDDSAIRRISLPSAFLTADILLSTLLNISSGMVVYPKVIERRINSELPFMATENII 383

Query: 1318 IGYDAASAVAKNAHKK 1365
            +      A  +  H+K
Sbjct: 384  MAMVEKGASRQEVHEK 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,461,347
Number of extensions: 1275856
Number of successful extensions: 5026
Number of sequences better than 10.0: 71
Number of HSP's gapped: 4995
Number of HSP's successfully gapped: 71
Length of query: 489
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 375
Effective length of database: 40,409,475
Effective search space: 15153553125
Effective search space used: 15153553125
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)