Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR013C6.13ON48848825910.0
SAKL0E00946g6.13ON49349322220.0
Ecym_30166.13ON48948721970.0
KLLA0D00902g6.13ON49246221700.0
KLTH0C11462g6.13ON49247721590.0
Kwal_56.223626.13ON49348321560.0
TDEL0G045806.13ON48447021520.0
Kpol_1032.46.13ON46746320910.0
Kpol_1045.766.13ON48546020640.0
CAGL0A01045g6.13ON48348620460.0
ZYRO0C07964g6.13ON50550420320.0
Suva_16.436.13ON48847320260.0
Smik_6.4706.13ON48849420260.0
YPL262W (FUM1)6.13ON48847320260.0
Skud_16.166.13ON48847320220.0
TPHA0J002706.13ON49646120210.0
KNAG0E027506.13ON49847319820.0
NCAS0D026206.13ON49348919670.0
KAFR0B065206.13ON49547719510.0
TBLA0G010006.13ON46546119010.0
TBLA0A071306.13ON50048518930.0
NDAI0I024706.13ON47546118330.0
KLLA0A08404g1.354ON4612171204e-06
SAKL0D09746g1.354ON4642931189e-06
CAGL0I08987g1.354ON4612921107e-05
KNAG0I015601.354ON4622221035e-04
Ecym_27491.354ON4702781027e-04
ZYRO0G00748g1.354ON4622451018e-04
AEL019W1.354ON4693001010.001
KAFR0A009501.354ON4642291010.001
NCAS0A090101.354ON4622971000.001
Kpol_1018.1251.354ON4602471000.001
TPHA0A021901.354ON463240990.001
NDAI0G059401.354ON462244980.002
Kwal_27.127821.354ON465269950.005
TDEL0D022201.354ON465229930.009
Suva_15.2011.354ON463239930.009
Skud_8.701.354ON463238920.012
Smik_8.831.354ON463238900.019
YHR018C (ARG4)1.354ON463239890.027
TBLA0F034801.354ON466215870.048
KLTH0G19338g1.354ON465291850.070
CAGL0B02794g4.197ON482161790.37
Skud_12.4434.197ON482161790.42
Ecym_24524.197ON482158780.60
Kwal_47.180664.197ON482175760.99
Suva_10.4594.197ON482158761.0
KLLA0B13189g4.197ON482177751.1
SAKL0B04972g4.197ON482176751.2
YLR359W (ADE13)4.197ON482158751.3
Smik_12.4464.197ON482158741.5
NDAI0J019504.197ON482160741.6
KAFR0A062304.197ON482154741.6
NCAS0J012004.197ON482175732.0
TBLA0A083204.197ON482186722.6
TPHA0B010404.197ON482178704.8
Suva_4.4946.148ON85092705.8
ZYRO0B07964g4.197ON482160696.1
Kpol_1042.164.197ON482176696.8
KLLA0D15081g3.438ON1010111697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR013C
         (488 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...  1002   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   860   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   850   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   840   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   836   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   835   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   833   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   810   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   799   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   792   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   787   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   785   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   785   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   785   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   783   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   783   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   768   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   762   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   756   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   736   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   733   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   710   0.0  
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    51   4e-06
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    50   9e-06
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    47   7e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    44   5e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    44   7e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    44   8e-04
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    44   0.001
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    44   0.001
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    43   0.001
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    43   0.001
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    43   0.001
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    42   0.002
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    41   0.005
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    40   0.009
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    40   0.009
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    40   0.012
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    39   0.019
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    39   0.027
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    38   0.048
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    37   0.070
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    35   0.37 
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    35   0.42 
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    35   0.60 
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    34   0.99 
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    34   1.0  
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    33   1.1  
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    33   1.2  
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    33   1.3  
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    33   1.5  
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    33   1.6  
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    33   1.6  
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    33   2.0  
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    32   2.6  
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    32   4.8  
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...    32   5.8  
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    31   6.1  
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    31   6.8  
KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} som...    31   7.5  

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/488 (100%), Positives = 488/488 (100%)

Query: 1   MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 60
           MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG
Sbjct: 1   MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 60

Query: 61  ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 120
           ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ
Sbjct: 61  ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 120

Query: 121 TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 180
           TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI
Sbjct: 121 TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 180

Query: 181 TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 240
           TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE
Sbjct: 181 TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 240

Query: 241 HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 300
           HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE
Sbjct: 241 HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 300

Query: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 360
           ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA
Sbjct: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 360

Query: 361 CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 420
           CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED
Sbjct: 361 CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 420

Query: 421 RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 480
           RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP
Sbjct: 421 RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 480

Query: 481 EKMIGPRD 488
           EKMIGPRD
Sbjct: 481 EKMIGPRD 488

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/493 (83%), Positives = 453/493 (91%), Gaps = 5/493 (1%)

Query: 1   MLRLS----RGCVGSSAARRL-MSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLEN 55
           MLR++    R  + SS+ R L  S++ A Q++R+ETDAFGEI+VPADKYWGAQTQRS EN
Sbjct: 1   MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60

Query: 56  FRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFP 115
           F+IGGARERMPE VVRAFGVLKKSAA+VNE LGTL+P I+K IQ+AADEV QG+LM+HFP
Sbjct: 61  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120

Query: 116 LVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIA 175
           LVVFQTGSGTQSNMNANEVISNRAIE++GGE GSKQVHPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 176 AVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANG 235
           AVTEIT SLLPEL ALR SFQ+K+DEF+ IVKIGRTHLQDATPLTLGQEFSGY QQ+ NG
Sbjct: 181 AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 236 IARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAH 295
           IARVE +   L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAH
Sbjct: 241 IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 296 DAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           DAVVE SGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 356 ALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGI 415
           A+TQ CVQVMGNNAAITFAGASGQFELNVFKPVMI+NLLSSVRLLADA+ SFRVHCVDGI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420

Query: 416 QDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFD 475
           + NEDRI+KLLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SAL+LGVL + EFD
Sbjct: 421 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480

Query: 476 EWVVPEKMIGPRD 488
           EWV+PEKMIGP++
Sbjct: 481 EWVIPEKMIGPKE 493

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/487 (81%), Positives = 445/487 (91%), Gaps = 1/487 (0%)

Query: 1   MLRLSRGCVGSSAARRLMST-AGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIG 59
           M   S+       A R+MST AG  Q+FR+ETDAFGEI+VPA+KYWGAQTQRSLENF+IG
Sbjct: 1   MFSASKKIPAKRIADRMMSTTAGLNQKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIG 60

Query: 60  GARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVF 119
           G RERMPEP+++AFG+LKKSAA+VNE LGTL+P I+K IQQAADEV +G+L++HFPLVVF
Sbjct: 61  GPRERMPEPIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVF 120

Query: 120 QTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTE 179
           QTGSGTQSNMNANEVISNRAIEL+GGELG+KQ+HPNNHCNQAQSSNDTFPSVMHIAAVTE
Sbjct: 121 QTGSGTQSNMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTE 180

Query: 180 ITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARV 239
           IT +LLPEL ALR SFQ+KT+EF+HIVKIGRTHLQDATPLTLGQEF GYTQQI NGI RV
Sbjct: 181 ITNTLLPELTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRV 240

Query: 240 EHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVV 299
           E +   L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ET +EF+TAPNKFEALAAHDAVV
Sbjct: 241 EQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVV 300

Query: 300 EASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ 359
           E SGALNT+ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTVACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQ 360

Query: 360 ACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNE 419
           ACVQVMGNN+ ITFAGASGQFELNVFKPVMI+NLL+S+RLLADA+ SFRVHCVDGI+ NE
Sbjct: 361 ACVQVMGNNSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANE 420

Query: 420 DRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVV 479
           D+IAK+LHESLMLVTALNPKIGYD+A  VAKNAHKK ITL+ SALELGVL++ EF EWVV
Sbjct: 421 DKIAKILHESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVV 480

Query: 480 PEKMIGP 486
           PEKMIGP
Sbjct: 481 PEKMIGP 487

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/462 (85%), Positives = 435/462 (94%)

Query: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86
           +RVETDAFGEI+VP+DKYWGAQTQRSL+NF+IGG RERMPEP+V+AFGVLKKSAAVVNE+
Sbjct: 31  YRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNER 90

Query: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146
           LGTL+P IAK I+QAADEVAQG+LMEHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGE
Sbjct: 91  LGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 150

Query: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206
           LGSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEIT  LLPELE L+V+ ++K+DEF HIV
Sbjct: 151 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIV 210

Query: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGIARV+ +   L+FLAQGGTAVGTGLNT+ GF
Sbjct: 211 KIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGF 270

Query: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326
           AE IA QVS+ETG++F+TAPNKFEALAAHDAVVEASGALNTLA SLFKIANDIRYLGSGP
Sbjct: 271 AEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGP 330

Query: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386
           RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGN+AAITFAGASGQFELNVFK
Sbjct: 331 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFK 390

Query: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446
           PVMI+NLLSS+RLL DA+ SFR+HCV+GI+ NEDRIAKLLHESLMLVTALNPKIGYDAAS
Sbjct: 391 PVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAAS 450

Query: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD 488
            VAKNAHKKGITL+ SALEL VL+  EFD+WV+PEKMIGP++
Sbjct: 451 KVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGPKE 492

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/477 (83%), Positives = 434/477 (90%), Gaps = 1/477 (0%)

Query: 12  SAARRLMSTAGA-PQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVV 70
           S   RL+ST+ A  Q+ RVETDAFGEI VPADKYWGAQTQRSLENF+IGGARERMPEPVV
Sbjct: 16  SPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEPVV 75

Query: 71  RAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMN 130
           RAFG+LKKSAA+VNE LGTL+P I+K IQQAADEV  G+L++HFPLVVFQTGSGTQSNMN
Sbjct: 76  RAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSNMN 135

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190
           ANEVISNRAIE++GG++G+K +HPNNHCNQAQSSNDTFPSVMHIAAVTEIT SLLPEL A
Sbjct: 136 ANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195

Query: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250
           LR SF  K+ EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVE +   L+FLA
Sbjct: 196 LRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKFLA 255

Query: 251 QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLAC 310
           QGGTAVGTGLNT+ GF E+IA QVS+ETG++F+TAPNKFEALAAHDA+VE SGALNTLAC
Sbjct: 256 QGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTLAC 315

Query: 311 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA 370
           SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAA
Sbjct: 316 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 375

Query: 371 ITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESL 430
           ITFAGASGQFELNVFKPVMI+NLLSSVRLL DA  SFRVHCVDGI+ N D+IAKLLHESL
Sbjct: 376 ITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHESL 435

Query: 431 MLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           MLVTALNPKIGYDAAS VAKNAHKKGITL+ SALEL VLT AEFD+WVVPE M+GP+
Sbjct: 436 MLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGPK 492

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/483 (80%), Positives = 438/483 (90%)

Query: 5   SRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARER 64
           ++  +  S AR + +++   Q++RVETDAFGEI+VP DK WGAQTQRSLENF+IGG RER
Sbjct: 10  NKALISGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRER 69

Query: 65  MPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSG 124
           MPEP+V+AFG+LKKSAA+VNE LGTL+P ++K IQ AADEV  G+L++HFPLVVFQTGSG
Sbjct: 70  MPEPIVKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSG 129

Query: 125 TQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSL 184
           TQSNMNANEVISNRAI+L+GGE+GSK +HPNNHCNQAQSSNDTFPSVMHIAAVTE+T  L
Sbjct: 130 TQSNMNANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLL 189

Query: 185 LPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQE 244
           LPEL ALR +F +K  EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI+RVEH+  
Sbjct: 190 LPELIALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLH 249

Query: 245 SLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGA 304
           +L+FLAQGGTAVGTGLNT+ GFAE+IA QVS+ETG++F+TAPNKFEALAAHDAVVE SGA
Sbjct: 250 NLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGA 309

Query: 305 LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQV 364
           LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQV
Sbjct: 310 LNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 369

Query: 365 MGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAK 424
           MGNNAAITFAGASGQFELNVFKPVMI+NLLSS+RLL DA  SFRVHCV+GIQ NED+IAK
Sbjct: 370 MGNNAAITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAK 429

Query: 425 LLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMI 484
           LLHESLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALELGVL+ AEFDEWVVPE M+
Sbjct: 430 LLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMV 489

Query: 485 GPR 487
           GP+
Sbjct: 490 GPK 492

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/470 (85%), Positives = 431/470 (91%), Gaps = 2/470 (0%)

Query: 18  MSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLK 77
           MST     QFRVETDAFGEI+V AD+YWGAQTQRSLENFRIGG RERMPEP+VRAFGVLK
Sbjct: 16  MSTKAG--QFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLK 73

Query: 78  KSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISN 137
           KSAAVVNE LGTL+P +A+ I+QAADEVAQG+L  HFPLVVFQTGSGTQSNMNANEVISN
Sbjct: 74  KSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISN 133

Query: 138 RAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQR 197
           RAIEL+GGELGSKQ+HPNNHCNQAQSSNDTFPSVMHIAAVTEITR LLPEL  LR S   
Sbjct: 134 RAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDA 193

Query: 198 KTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVG 257
           K+ EF+ IVKIGRTHLQDATPLTLGQEFSGY QQ++NGI RVE +   L++LAQGGTAVG
Sbjct: 194 KSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVG 253

Query: 258 TGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 317
           TGLNT+ GFAE+IA QVS+ETGL+F+TAPNKFEALAAHDAVVEASGALNT+ACSLFKIA 
Sbjct: 254 TGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQ 313

Query: 318 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGAS 377
           DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFAGAS
Sbjct: 314 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGAS 373

Query: 378 GQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALN 437
           GQFELNVFKPVMI+NLLSSVRLLADA+ SFRVHCVDGI  N DRI KL+HESLMLVTALN
Sbjct: 374 GQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALN 433

Query: 438 PKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           PKIGYDAAS VAKNAHKKGITL+ SAL+LGVLT++EFDEWVVPE MIGP+
Sbjct: 434 PKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGPK 483

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/463 (81%), Positives = 422/463 (91%)

Query: 24  PQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVV 83
           P  FR+ETD FGEI+VPADKYWGAQTQRS ENF+IGG RERMPEPVV+AFGVLKKSAA+V
Sbjct: 4   PNGFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIV 63

Query: 84  NEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELL 143
           NE+ G L+ GI+K IQQAADEV +G+L EHFPLVVFQTGSGTQSNMNANEVISNRAIEL 
Sbjct: 64  NEEFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELK 123

Query: 144 GGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFA 203
           GG +GSK++HPNNHCN AQSSNDTFP+VMHIAAVTEIT  L+P++  L+ +   K+ EF 
Sbjct: 124 GGIMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFE 183

Query: 204 HIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTR 263
           HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIAR+EH+  +L+FLAQGGTAVGTGLNT+
Sbjct: 184 HIVKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTK 243

Query: 264 RGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLG 323
            GFAE+IA QVS+ETG+EF+TAPNKFEALAAHDA+VE+SGALNT+ACSLFKIA DIRYLG
Sbjct: 244 IGFAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLG 303

Query: 324 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELN 383
           SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAAITFAGASGQFELN
Sbjct: 304 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELN 363

Query: 384 VFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYD 443
           VFKPVMI+NLLSS+RLL DA  SF +HCV+GIQ NED+I KLLHESLMLVTALNPKIGYD
Sbjct: 364 VFKPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYD 423

Query: 444 AASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 486
           +A+ VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 424 SATKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGP 466

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/460 (81%), Positives = 422/460 (91%)

Query: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86
           FRVETD FGEI+VPA+KYWGAQT+RS ENF+IGG+RERMPE VVRAFGVLKK AA+VN +
Sbjct: 24  FRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRERMPEAVVRAFGVLKKCAAIVNTE 83

Query: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146
           LG L+P  +K IQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 84  LGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGV 143

Query: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206
           LGSK++HPNNHCN AQSSNDTFP+VMHIAAVT+I++ LLPEL  LR +   K+ EF HIV
Sbjct: 144 LGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQHLLPELTHLRDALAAKSAEFEHIV 203

Query: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E AQ++LRFLAQGGTAVGTGLNT+ G+
Sbjct: 204 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQQNLRFLAQGGTAVGTGLNTKNGW 263

Query: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326
           AE+IAA++S+ETGL F+TAPNKFEALAAHDA+VEASGALNT+ACSLFKIA DIRYLGSGP
Sbjct: 264 AERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 323

Query: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386
           RCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ CVQVMGNNAA+TFAGASGQFELNVFK
Sbjct: 324 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGASGQFELNVFK 383

Query: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446
           PV+I+NLLSSV+LL DA+RSFRVHCV+GI+ NE +I++LLH SLMLVTALNPKIGYDAA+
Sbjct: 384 PVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKISELLHRSLMLVTALNPKIGYDAAT 443

Query: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGP 486
            VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPEKM+GP
Sbjct: 444 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKMLGP 483

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/486 (77%), Positives = 423/486 (87%), Gaps = 5/486 (1%)

Query: 1   MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 60
           MLR S     S A   L+  +     +RVETD FGEI+VPADKYWGAQTQRS +NF+IGG
Sbjct: 1   MLRAS-----SRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGG 55

Query: 61  ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 120
           ARERMPEP+VRAFGVLKKSAA+VNE+LGTL+  IA  IQQAADEVA+G+L +HFPLVVFQ
Sbjct: 56  ARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQ 115

Query: 121 TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 180
           TGSGTQSNMNANEVISNRAIEL+GGELGSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEI
Sbjct: 116 TGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEI 175

Query: 181 TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 240
           T SLLPE+  L+ +  +K +EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIAR+E
Sbjct: 176 TNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIE 235

Query: 241 HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 300
           +    L++LAQGGTAVGTGLNT+ GF + IA Q+S+ETG++F+TAPNKFEALAAHDA+VE
Sbjct: 236 NTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVE 295

Query: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 360
           ASGALNT+ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ 
Sbjct: 296 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQV 355

Query: 361 CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 420
           CVQVMGNNAA+TFAGA+GQFELNVFKPVMI+NLLSS+RLLADA  SFRVHCV+GI+ N +
Sbjct: 356 CVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANRE 415

Query: 421 RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 480
           +I   LH SLMLVTALNPKIGYDAAS +AKNA KK ITL+ SALEL  LT  EFDEWV+P
Sbjct: 416 KINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIP 475

Query: 481 EKMIGP 486
           E M+GP
Sbjct: 476 ENMVGP 481

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/504 (76%), Positives = 426/504 (84%), Gaps = 17/504 (3%)

Query: 1   MLRLS-----RGCVGSSAARRLMS------------TAGAPQQFRVETDAFGEIRVPADK 43
           MLRLS       CV   ++ RL S            T    Q+ RVETDAFGEI+VPADK
Sbjct: 1   MLRLSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADK 60

Query: 44  YWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAAD 103
           YWGAQTQRS ENFRIGG RERMPE VV AFG+LKK+ A VNE  G L+P +A AI+QAAD
Sbjct: 61  YWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAAD 120

Query: 104 EVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQS 163
           EVA G+L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG+LGSK VHPNNH N +QS
Sbjct: 121 EVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQS 180

Query: 164 SNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQ 223
           SNDTFP+VMHIAAV  IT+ LLP L AL+ S Q+K++EFA IVKIGRTHLQDATPLTLGQ
Sbjct: 181 SNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQ 240

Query: 224 EFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFR 283
           EFSGY QQ+ANGI RVE   +SL+ LAQGGTAVGTGLNT+ G+AE +AA+V++ETG++F+
Sbjct: 241 EFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQ 300

Query: 284 TAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSS 343
           TAPNKFEALAAHDAVVEASGALNTLA SLFKIA DIRYLGSGPRCGYGELSLPENEPGSS
Sbjct: 301 TAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSS 360

Query: 344 IMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADA 403
           IMPGKVNPTQNEALTQ CVQV GN++AITFAGASGQFELNVFKPVMI+NLLSS+ LL+DA
Sbjct: 361 IMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDA 420

Query: 404 ARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASA 463
           + SFRVHCVDGIQ N + IAKLLHESLMLVTALNPKIGYDAAS VAKNAHK GITL+ SA
Sbjct: 421 SYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESA 480

Query: 464 LELGVLTDAEFDEWVVPEKMIGPR 487
           L+L +LT  EFD WVVPE MIGP+
Sbjct: 481 LQLNILTAEEFDHWVVPEHMIGPK 504

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/473 (78%), Positives = 418/473 (88%), Gaps = 6/473 (1%)

Query: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74
           RR+ ST      FR ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 22  RRMNST------FRTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75

Query: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134
           VLKKSAA+VNE LG L+P ++KAIQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 76  VLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEV 135

Query: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194
           ISNRAIE+LGG++GSKQVHPNN CNQ+QSSNDTFP+VMHIAA  +I + L+PEL  L+ +
Sbjct: 136 ISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNA 195

Query: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254
            + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H  ++L FLAQGGT
Sbjct: 196 LEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGT 255

Query: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           AVGTGLNT+ GF  +IA Q+S+ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 256 AVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374
           IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITF 
Sbjct: 316 IAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFG 375

Query: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434
           G+ GQFELNVFKPVMIANLL+S+RL+ADA+RSFR+HCV+GI+ NE RI +LL +SLMLVT
Sbjct: 376 GSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVT 435

Query: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 436 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/494 (76%), Positives = 427/494 (86%), Gaps = 13/494 (2%)

Query: 1   MLRLS----RGCVGSSAA---RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSL 53
           MLRL+    +  V SS     RR+ ST      FR ETDAFGEI VPADKYWGAQTQRS 
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNST------FRTETDAFGEINVPADKYWGAQTQRSF 54

Query: 54  ENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEH 113
           +NF+IGGARERMP P+V AFGVLKKSAA+VNE LG L+P I+KAIQ+AADEVA G+L +H
Sbjct: 55  QNFKIGGARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDH 114

Query: 114 FPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMH 173
           FPLVVFQTGSGTQSNMNANEVISNRAIE+LGG++GSK+VHPNNHCNQ+QSSNDTFP+VMH
Sbjct: 115 FPLVVFQTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMH 174

Query: 174 IAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIA 233
           IAA  +I   L+PEL  L+ + + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ 
Sbjct: 175 IAASLQIQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVE 234

Query: 234 NGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALA 293
           NGI RV H+ ++L FLAQGGTAVGTGLNT+ GF  +IA Q+S+ETGL+F+TAPNKFEALA
Sbjct: 235 NGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALA 294

Query: 294 AHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQ 353
           AHDA+VE SGALNTLACSLFKIA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQ
Sbjct: 295 AHDAIVECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQ 354

Query: 354 NEALTQACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVD 413
           NEALTQ CVQVMGNNAAITFAG+ GQFELNVFKPVMIANLL+S+RL+ DAA SFRVHCV+
Sbjct: 355 NEALTQVCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVE 414

Query: 414 GIQDNEDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAE 473
           GI+ NE RI +LL +SLMLVTALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ E
Sbjct: 415 GIKANEPRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKE 474

Query: 474 FDEWVVPEKMIGPR 487
           FDEWVVPE M+GP+
Sbjct: 475 FDEWVVPENMLGPK 488

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/473 (79%), Positives = 418/473 (88%), Gaps = 6/473 (1%)

Query: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74
           RR+ S+      FR ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 22  RRMNSS------FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75

Query: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134
           VLKKSAA+VNE LG L+P I+KAIQQAADEVA G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 76  VLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEV 135

Query: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194
           ISNRAIE+LGG++GSKQVHPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL  L+ +
Sbjct: 136 ISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNA 195

Query: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254
            + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H+ ++L FLAQGGT
Sbjct: 196 LEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGT 255

Query: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           AVGTGLNT+ GF  +IA Q+S+ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 256 AVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374
           IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFA
Sbjct: 316 IAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFA 375

Query: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434
           G+ GQFELNVFKPVMIANLL+S+RL+ DAA SFRVHCV+GI+ NE RI +LL +SLMLVT
Sbjct: 376 GSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVT 435

Query: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 436 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGPK 488

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/473 (78%), Positives = 417/473 (88%), Gaps = 6/473 (1%)

Query: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74
           RR+ ST      FR+ETDAFGEI VPADKYWGAQTQRS +NF+IGGARERMP P+V AFG
Sbjct: 22  RRMNST------FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFG 75

Query: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134
           VLKKSAAVVNE LG L+P I+KAIQQAADEV  G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 76  VLKKSAAVVNESLGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEV 135

Query: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194
           ISNRAIE+LGG++GSK+VHPNNHCNQ+QSSNDTFP+VMHIAA  +I   L+PEL  L+ +
Sbjct: 136 ISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNA 195

Query: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254
            + K+ EF HIVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV H+ ++L FLAQGGT
Sbjct: 196 LEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGT 255

Query: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           AVGTGLNT+ GF  +IA Q+S ETGL+F+TAPNKFEALAAHDA+VE SGALNTLACSLFK
Sbjct: 256 AVGTGLNTKPGFDIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFK 315

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374
           IA DIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEALTQ CVQVMGNNAAITFA
Sbjct: 316 IAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFA 375

Query: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434
           G+ GQFELNVFKPVMIANLL+S+RL+ D+A SFRVHCV+GI+ NE RI +LL +SLMLVT
Sbjct: 376 GSQGQFELNVFKPVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVT 435

Query: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           ALNPKIGYDAAS VAKNAHKKGITL+ SALELGVLT+ EFDEWVVPE M+GP+
Sbjct: 436 ALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGPK 488

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/461 (78%), Positives = 416/461 (90%)

Query: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86
           FR+ETD FGEI+VPA+KYWGAQT+RS ENFRIGG RERMP+PVV+AFGVLKKSAA+VNE 
Sbjct: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146
            GTL+P I+K IQ+AADEV QG+L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 
Sbjct: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206
           LGSKQVHPNNH NQAQSSND+FP+VMHIAAVTEIT  L+PE+  LR + + K+ +FAHIV
Sbjct: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+EH+  +L+FLAQGGTAVGTGLNTR GF
Sbjct: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326
           AE+IA Q+S+ETG+ F+TAPNKFEALAAHDA+VEASGA+ T+A SLFKIA DIRYLGSGP
Sbjct: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386
           RCGYGELSLPENEPGSSIMPGK+NPTQNEA+TQ C Q++GNN  I FAG  GQFELNVFK
Sbjct: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446
           PVMI+NLLSS+RLL D ++SFR+HCV+GI+ NE+RIA L+++SLMLVTALNPKIGYD A+
Sbjct: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
            VAKNAHKKGITL+ SA++LG LT++EFDEWVVPEKMIGP+
Sbjct: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGPK 496

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/473 (75%), Positives = 414/473 (87%)

Query: 15  RRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFG 74
           R + ++A   Q+FRVETD+FGEI VPAD+YWGAQTQRS +NF+IGG RE++PEPVVRAFG
Sbjct: 25  RNMSASAITNQEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFG 84

Query: 75  VLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEV 134
           +LKKSAA VNE LGTL+  IA  I+ AADEVA+G+L +HFPLVVFQTGSGTQSNMNANEV
Sbjct: 85  ILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEV 144

Query: 135 ISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVS 194
           ISNRAIELLGGELGSKQVHPNNH NQ+QSSNDTFP+VMHIAA TEI   L+PEL+ L+ +
Sbjct: 145 ISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDA 204

Query: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254
            Q K +EF+ IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI RV+ +   L FLAQGGT
Sbjct: 205 LQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGT 264

Query: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           AVGTGLNT+ GF + +A +VS+ETGL F TAPNKFEALAAHDA+VEASGALNTLACSLFK
Sbjct: 265 AVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFK 324

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374
           IA DIRYLGSGPRCGYGEL LP NEPGSSIMPGKVNPTQNEA+TQ CVQVMGNN+ ITFA
Sbjct: 325 IAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFA 384

Query: 375 GASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVT 434
           G+ GQFELNV+KP+MI+NLLSS+RLL DA++SFR+HC++ ++ N+D+I + L++SLMLVT
Sbjct: 385 GSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVT 444

Query: 435 ALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           ALNPKIGYDAA+ VAKNAH K ITL+ SALELGVLT+ EFDEWV+PE MI P+
Sbjct: 445 ALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISPK 497

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/489 (72%), Positives = 420/489 (85%), Gaps = 3/489 (0%)

Query: 2   LRLSRGCVGSSAARRL---MSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRI 58
           L+L+   +    A R+    +TA + QQ+R+ETD+FGEI+VPADKYWGAQTQRS +NF+I
Sbjct: 4   LKLANPTILRLQASRMSLSTTTAASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKI 63

Query: 59  GGARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVV 118
           GG+RER+P+P++ AFG+LKKSAA+VNE LGTL+P +A  I++AADEV QG+L +HFPLVV
Sbjct: 64  GGSRERIPDPIITAFGILKKSAAIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVV 123

Query: 119 FQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVT 178
           FQTGSGTQ+NMN NEVISNRAIEL+GG+LGSKQ+HPNNHCNQ+QSSNDTFPSVMHIAAV 
Sbjct: 124 FQTGSGTQTNMNVNEVISNRAIELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVL 183

Query: 179 EITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIAR 238
           EIT SL+PEL  L+ +   K  EFA IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R
Sbjct: 184 EITNSLIPELTKLKDALDVKAKEFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYR 243

Query: 239 VEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAV 298
           +E +   L+FLAQGGTAVGTGLNT+ GF + IA +VS+ETG+EF+TAPNKFEALAAHDA+
Sbjct: 244 IESSLYHLKFLAQGGTAVGTGLNTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAI 303

Query: 299 VEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALT 358
           V ASGALNT+A SLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+T
Sbjct: 304 VFASGALNTVAGSLFKIAQDIRYLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMT 363

Query: 359 QACVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDN 418
           Q CVQ+MGNN  I+ AG+ GQFELNV+KP+MIANLL+S+RL+ DA +SFR+HC+D ++ N
Sbjct: 364 QVCVQIMGNNQTISIAGSQGQFELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKAN 423

Query: 419 EDRIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWV 478
           +D+I + L++SLMLVTALNPKIGYDAAS +AKNAH K ITL+ SALEL  LT  EFDEWV
Sbjct: 424 KDKINENLNKSLMLVTALNPKIGYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWV 483

Query: 479 VPEKMIGPR 487
           VPE MIGP+
Sbjct: 484 VPENMIGPK 492

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/477 (73%), Positives = 410/477 (85%)

Query: 11  SSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVV 70
           +S   R  + +     FR ETD+FGEI VP DKYWGAQTQRSL+NF+IGG RE++P P++
Sbjct: 18  TSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPII 77

Query: 71  RAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMN 130
            AFG+LKKSAA+VNE+LGTL+  +AK I  AADEV+QG+L +HFPLVVFQTGSGTQSNMN
Sbjct: 78  EAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMN 137

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190
           ANEVISNRAIEL+GG+LGSK VHPNNH NQ+QSSNDTFP+VMHIAA+ EITR LLPEL +
Sbjct: 138 ANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNS 197

Query: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250
           L+ S  +K++EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGI R+E A   L+FLA
Sbjct: 198 LKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLA 257

Query: 251 QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLAC 310
           QGGTAVGTGLNT+ GF + IA Q+S ETG+ F TAPNKFEALAAHDA+VE SGALNTLAC
Sbjct: 258 QGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLAC 317

Query: 311 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA 370
           SLFKIA DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEA+TQ C+QVMGN++ 
Sbjct: 318 SLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHST 377

Query: 371 ITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESL 430
           ITFAG+ GQFELNV+KP++I+NLLSS+RLL DA+ SFRVHC+DG++ N + I + L++SL
Sbjct: 378 ITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSL 437

Query: 431 MLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
           MLVTALNP IGYD AS +AKNAH K ITL+ SALELG+LT+ +F EWV+PEKMIGP+
Sbjct: 438 MLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGPK 494

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/461 (72%), Positives = 404/461 (87%)

Query: 28  RVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQL 87
           R+E D FGE+ VPA+KYWGAQTQR+L NF IGG RERMPEP++ A+G+LKKS A+VNE L
Sbjct: 5   RIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNESL 64

Query: 88  GTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGEL 147
           GTL+P I+KAIQ+AADEVA+G L EHFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG+L
Sbjct: 65  GTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQL 124

Query: 148 GSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVK 207
           GSK VHPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPELE LR + + K+ EF  IVK
Sbjct: 125 GSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIVK 184

Query: 208 IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFA 267
           IGRTHLQDATPLTLGQEFSGY QQ+ NGI RV+++  +L+F+AQGGTAVGTG+NT++ F 
Sbjct: 185 IGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDFD 244

Query: 268 EQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPR 327
             +A Q+S ETG+EF+TAPNKFEALA+HDA+VE SGALNTLACSLFKI+ DIR+LGSGPR
Sbjct: 245 ILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGPR 304

Query: 328 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFKP 387
           CGYGELSLPENEPGSSIMPGKVNPTQNEA+ QAC+QVMGNN+AITFAGASGQFELN +KP
Sbjct: 305 CGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYKP 364

Query: 388 VMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAASA 447
           +MI+NLL+S+RLL D+  SFR+HC+ GI+ NED+I KLL+ESLMLVTALNPKIGYDAA+A
Sbjct: 365 LMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAATA 424

Query: 448 VAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPRD 488
           +AK+AHK G+TL+ +AL+  +LT  +FDEW+VPE M+ P +
Sbjct: 425 IAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/485 (71%), Positives = 399/485 (82%)

Query: 2   LRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGA 61
           L + R C  S +   +  +    Q  R ETD+FGEI+VPA+KYWGAQTQRS  NF+IGG 
Sbjct: 15  LNIFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGE 74

Query: 62  RERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQT 121
           RERMPEP++RAFG  KK+AA+VN  LGTL+  +  AI QAA+EV+QG L EHFPLVVFQT
Sbjct: 75  RERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQT 134

Query: 122 GSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEIT 181
           GSGTQSNMNANEVISNRAIELLGG LGSKQVHPNNH NQ+QSSNDTFP+VMHIAA+TEIT
Sbjct: 135 GSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEIT 194

Query: 182 RSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEH 241
            +LLP L  LR +   K  EF  I+KIGRTHLQDATPLTLGQEFSGYTQQ+ N I R+E 
Sbjct: 195 NTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK 254

Query: 242 AQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEA 301
               L+++AQGGTAVGTGLNT+ GFAEQ A Q+S +T L F T+PNKFE+LAAHDA+V  
Sbjct: 255 NLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNV 314

Query: 302 SGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQAC 361
             +LNTLACSLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEA+ QAC
Sbjct: 315 HASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQAC 374

Query: 362 VQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDR 421
           VQVMGNN+ I+FAGASGQFELN +KP+MIANLLSS RLL+DA  SF +HC  GIQ N+D+
Sbjct: 375 VQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDK 434

Query: 422 IAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPE 481
           I +LLHESLMLVT+LNPKIGYDAAS VAKNAH KGITL+ SALEL +L+  +FDEWV PE
Sbjct: 435 IDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPE 494

Query: 482 KMIGP 486
            M+GP
Sbjct: 495 NMLGP 499

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/461 (71%), Positives = 400/461 (86%)

Query: 27  FRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGARERMPEPVVRAFGVLKKSAAVVNEQ 86
           FRVETD+FGEI+VP++KYWGAQTQRS +NF+IGG RE++P P+++AFG+LKKSAA+VN+ 
Sbjct: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73

Query: 87  LGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 146
           LGTL+P IA  I +A+DEV QG+L +HFPLVVFQTGSGTQ+NMNANEVISNRA EL+G E
Sbjct: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133

Query: 147 LGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIV 206
           LGSK++HPNNH NQ+QSSNDTFPSVMHIAAV E+  +L+P+L  L+ S   K  E+A+IV
Sbjct: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193

Query: 207 KIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF 266
           KIGRTHLQDATPLTLGQEFSGY QQ+ NGI R++ +   L+FLAQGGTAVGTGLNT+ GF
Sbjct: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253

Query: 267 AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGP 326
            + IA +VS+ETG++F TAPNKFEALAAHDA+V AS A+ T+A SLFKIA DIRYLGSGP
Sbjct: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313

Query: 327 RCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFAGASGQFELNVFK 386
           RCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ  +Q+MGNN  I  AG+ GQFELNV+K
Sbjct: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373

Query: 387 PVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDRIAKLLHESLMLVTALNPKIGYDAAS 446
           P+MIANLL+S+RL++DA  SF++HCVDG++ N D+I + LH+SLMLVTALNPKIGYDAAS
Sbjct: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433

Query: 447 AVAKNAHKKGITLRASALELGVLTDAEFDEWVVPEKMIGPR 487
            +AKNAH K ITL+ SALELG+LT+ EFD+WV+PE MIGP+
Sbjct: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGPK 474

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 86/217 (39%), Gaps = 15/217 (6%)

Query: 158 CNQAQSSNDTFPSVMHIAAVTEITRSLLPELEAL-RVSFQRKTDEFAHIVKIGRTHLQDA 216
            +  +S ND   + M I     +  ++LP L +L +V  QR  +E   ++  G THLQ A
Sbjct: 107 VHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEI-DVLMPGYTHLQRA 165

Query: 217 TPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GTAVGTGLNTRRGFAEQIAAQVS 275
            P+      S Y         R++   E L     G G   G      R F   +AA   
Sbjct: 166 QPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALAGHPYGIDREF---LAA--- 219

Query: 276 RETGLEFR-TAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELS 334
              GL F     N   A+A  D VVE     +     + + A D+  + S    G+ +LS
Sbjct: 220 ---GLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDL-IIYSTAEFGFIQLS 275

Query: 335 LPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAI 371
                 GSS+MP K NP   E L     +V G  A  
Sbjct: 276 -DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAGF 311

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 109/293 (37%), Gaps = 36/293 (12%)

Query: 76  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 135
           L+K   + +++L  +  G+    +Q   E A G+   H            +    ANE  
Sbjct: 50  LQKIGLLTSDELTKVHHGL----EQIEKEWAAGEFARH---------PSDEDIHTANE-- 94

Query: 136 SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSF 195
             R  E++G E+  K VH        +S ND   + M I     +   LLP L+A     
Sbjct: 95  -RRLGEIIGREISGK-VHT------GRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVL 146

Query: 196 QRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GT 254
             +  E   ++  G THLQ A P+      S Y         R++   E L     G G 
Sbjct: 147 TTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGA 206

Query: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTLACSLF 313
             G      R F  +         GL F+    N   A++  D VVE           + 
Sbjct: 207 LAGHPYGIDREFLAR---------GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHIS 257

Query: 314 KIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 366
           + + D+  + S    G+ +LS      GSS+MP K NP   E L     +V G
Sbjct: 258 RFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 110/292 (37%), Gaps = 34/292 (11%)

Query: 76  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 135
           L K   +   +L  +  G+ K I+   DE   G+ + H            +S+ + +   
Sbjct: 50  LTKLGLITESELAKIHSGL-KDIENEWDE---GKFVRH------------ESDEDIHTAN 93

Query: 136 SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSF 195
             R  EL+G ++  K VH        +S ND   + M I     +   + P +++L    
Sbjct: 94  ERRLGELIGRDIAGK-VHT------GRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVL 146

Query: 196 QRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTA 255
             + ++   I+  G THLQ A P+      S Y       + R+E   E L     G  A
Sbjct: 147 VNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGA 206

Query: 256 VGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           +        G   Q  A+     GL F     N   A++  D VVE           + +
Sbjct: 207 LA---GHPYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSR 258

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 366
            + D+  + S    G+ +LS      GSS+MP K N    E L     +V G
Sbjct: 259 FSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 83/222 (37%), Gaps = 15/222 (6%)

Query: 153 HPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPEL-EALRVSFQRKTDEFAHIVKIGRT 211
           H     +  +S ND   + M I     +   LLP + + ++V  +R  +E   ++  G T
Sbjct: 103 HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENEIDTLMP-GYT 161

Query: 212 HLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GTAVGTGLNTRRGFAEQI 270
           HLQ A P+      S Y         R++   E L     G G   G      R F  + 
Sbjct: 162 HLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALAGHPYGIDREFLAE- 220

Query: 271 AAQVSRETGLEF-RTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCG 329
                   GL F     N   A++  D VVE           + + A D+  + S    G
Sbjct: 221 --------GLNFGGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-IIYSTAEFG 271

Query: 330 YGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAI 371
           + +LS      GSS+MP K N    E L     +V G+ A  
Sbjct: 272 FVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 107/278 (38%), Gaps = 38/278 (13%)

Query: 94  IAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGELGSKQVH 153
           I K + +   E + G+  EH            +    ANE    R  EL+G  +  K VH
Sbjct: 63  IHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGELIGTAVAGK-VH 109

Query: 154 PNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA-LRVSFQRKTDEFAHIVKIGRTH 212
                   +S ND   + M I     +   +LP + + +RV   R  +E   ++  G TH
Sbjct: 110 T------GRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRAREE-VDVLMPGYTH 162

Query: 213 LQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVG---TGLNTRRGFAEQ 269
           LQ A P+      S Y         R+    E L     G  A+     G++ R+  AEQ
Sbjct: 163 LQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSPLGAGALAGHPYGID-RKYLAEQ 221

Query: 270 IAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCG 329
           +        G+      N   A++  D V+E     +     + + A D+    +     
Sbjct: 222 LGFN-----GI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLIIYSTAE--- 269

Query: 330 YGELSLPE-NEPGSSIMPGKVNPTQNEALTQACVQVMG 366
           +G ++L +    GSS+MP K NP   E L     +V G
Sbjct: 270 FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 95/245 (38%), Gaps = 27/245 (11%)

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPEL-E 189
           ANE    R  E++G ++  K VH        +S ND   + M I     +   LLP L E
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHT------GRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 190 ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 249
            + V  +R   E  +++  G THLQ A P+      S Y       + R+    E     
Sbjct: 141 LVSVMVKRAEKEIGYLMP-GYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQS 199

Query: 250 AQGGTAVG---TGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALN 306
             G  A+     G++ R   AE++  Q             N   A++  D VVE      
Sbjct: 200 PLGAGALAGHPYGID-REFLAEELGFQ---------GVIGNSLVAVSDRDFVVELMFWGT 249

Query: 307 TLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 366
                + + A D+  + S    G+ +L+      GSS+MP K N    E L     +V G
Sbjct: 250 LFMNHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 367 NNAAI 371
           + A  
Sbjct: 308 DLAGF 312

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 115/300 (38%), Gaps = 34/300 (11%)

Query: 76  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 135
           L+K+  +  ++L ++  G+    +Q   E  QG  ++H            +    ANE  
Sbjct: 49  LQKTGLLTKDELESIHEGL----KQVEQEWEQGVFVKHVD---------DEDIHTANE-- 93

Query: 136 SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPEL-EALRVS 194
             R  E++G  +  K VH        +S ND   + M +     +   + P L E ++V 
Sbjct: 94  -RRLGEIIGRHISGK-VHT------GRSRNDQVATDMRLYCREMLQDKVEPALFELIKVL 145

Query: 195 FQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT 254
             R  +E   ++  G THLQ A P+      S Y         R+   +E +  L Q   
Sbjct: 146 LHRAREEID-VLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRL---KEVIARLNQSPL 201

Query: 255 AVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
             G       G   +  A    E G +     N   A++  D VVE     +     + +
Sbjct: 202 GAGALAGHPYGIDREYLAC---ELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFMNHISR 257

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374
           +A D+  + S    G+ +L+      GSS+MP K NP   E L     +V G  A    +
Sbjct: 258 LAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLAGFLMS 315

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 89/229 (38%), Gaps = 11/229 (4%)

Query: 158 CNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDAT 217
            +  +S ND   + M I     +T +LL  L+ L     R+ +E   I+  G THLQ A 
Sbjct: 109 VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKELISVICRRANEEMDILMPGYTHLQRAQ 168

Query: 218 PLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRE 277
           P+      S Y         R+   QE L  L       G       G   +  AQ    
Sbjct: 169 PIRWSHWLSFYATYFTEDYKRL---QEILARLNVSPLGAGALAGHPYGIDREFLAQDLGF 225

Query: 278 TGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPE 337
           +G+      N   A++  D VVE     +     + + + D+  + S    G+ +LS   
Sbjct: 226 SGV----IGNSLVAVSDRDFVVEIMFWGSLFMNHISRFSEDL-IIYSTAEFGFIKLS-DA 279

Query: 338 NEPGSSIMPGKVNPTQNEALTQACVQVMGNNAA--ITFAGASGQFELNV 384
              GSS+MP K N    E L     +V G+ A   +T  G    ++ ++
Sbjct: 280 YSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGFLMTLKGVPSTYDKDL 328

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 112/297 (37%), Gaps = 42/297 (14%)

Query: 76  LKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVI 135
           L+K   +  E+L  +  G+     Q   E  + + + H            +    ANE  
Sbjct: 49  LQKIGLLTEEELAKIHVGL----DQIKKEWDEDKFVRH---------PNDEDIHTANE-- 93

Query: 136 SNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSF 195
             R  E++G ++  K VH        +S ND   + + I     +   L P L +L    
Sbjct: 94  -RRLGEIIGRDIAGK-VHT------GRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVL 145

Query: 196 QRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRF----LAQ 251
            ++ +E   I+  G THLQ A P+      S Y       + R++  Q  +RF    L  
Sbjct: 146 IKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLK--QILVRFNKSPLGA 203

Query: 252 GGTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTLAC 310
           G  A G      R F  +         GLEF     N   A++  D VVE          
Sbjct: 204 GALA-GHPYGIDREFLAE---------GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMN 253

Query: 311 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
            + + A D+  + S    G+ +L+      GSS+MP K N    E L     +V G+
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 94/247 (38%), Gaps = 25/247 (10%)

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190
           ANE    R  EL+G ++  K VH        +S ND   + + I     I   LLP L++
Sbjct: 89  ANE---RRLGELIGTDISGK-VHT------GRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 191 L-RVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 249
           L +V  +R   E   I+  G THLQ A P+      S Y         R++   + L   
Sbjct: 139 LIQVLVKRGEGEIG-ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVS 197

Query: 250 AQG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNT 307
             G G   G      R F            GL F     N   A++  D VVE       
Sbjct: 198 PLGAGALAGHPYGIDREFLAN---------GLGFNGVIGNSLVAVSDRDFVVELLFWGTL 248

Query: 308 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
               + + A D+  + S    G+  LS      GSS+MP K N    E L     +V GN
Sbjct: 249 FMNHISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

Query: 368 NAAITFA 374
            + +  +
Sbjct: 307 LSGLLMS 313

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 91/240 (37%), Gaps = 25/240 (10%)

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190
           ANE    R  E++G ++  K VH        +S ND   + + I     ++  LL  LE 
Sbjct: 91  ANE---RRLGEIIGTKISGK-VHT------GRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250
           L      + +E    +  G THLQ A P+      S Y         R+   +E L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 251 QGGTAVG---TGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNT 307
            G  A+     G++ R   AE++                N   A++  D VVE       
Sbjct: 201 LGAGALAGHPYGID-REYLAEKLGFD---------SVIGNSLVAVSDRDFVVEILFWSTL 250

Query: 308 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
               + + A D+  + S    G+ +LS      GSS+MP K N    E L     +V GN
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 91/244 (37%), Gaps = 23/244 (9%)

Query: 130 NANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELE 189
            ANE    R  E++G ++  K VH        +S ND   + + I     +   L P + 
Sbjct: 90  TANE---RRLGEIIGRDIAGK-VHT------GRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 190 ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 249
           +L     ++ +E   I+  G THLQ A P+      S Y       + R++   E     
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 250 AQG-GTAVGTGLNTRRGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNT 307
             G G   G      R F  +         GL F     N   A++  D VVE       
Sbjct: 200 PLGAGALAGHPYGIDREFLAE---------GLGFDGVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 308 LACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
               + + A D+  + S    G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 251 FMNHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 368 NAAI 371
            A  
Sbjct: 309 LAGF 312

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 101/269 (37%), Gaps = 46/269 (17%)

Query: 119 FQTGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVT 178
           F    G +    ANE    R  E++G  +  K VH        +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-VHT------GRSRNDQVATDMRIYC-R 129

Query: 179 EITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIAR 238
           E   +L   LE L  +  +++++    +  G THLQ A P+      + Y         R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 239 VEHAQESLRFLAQGGTAVG--------TGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFE 290
           ++  +E L     G  A+           L  R GF++ I                N  +
Sbjct: 190 LKQIRERLNVSPLGCGALAGHPYGIDREFLAERLGFSDVIG---------------NSLQ 234

Query: 291 ALAAHDAVVEASGALNTLACSLF-----KIANDIRYLGSGPRCGYGELSLPENEPGSSIM 345
           A++  D VVE         CSLF     + + D+  + S     + +LS      GSS+M
Sbjct: 235 AVSDRDFVVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLM 287

Query: 346 PGKVNPTQNEALTQACVQVMGNNAAITFA 374
           P K NP   E L     +V G+ A    +
Sbjct: 288 PQKKNPDSLELLRGKSGRVFGSLAGFMMS 316

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 86/229 (37%), Gaps = 15/229 (6%)

Query: 145 GELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAH 204
           GE+  + +    H    +S ND   + + I     +   L P+L+AL     ++  E   
Sbjct: 97  GEIIGRNIAGKVHT--GRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEID 154

Query: 205 IVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GTAVGTGLNTR 263
           ++  G THLQ A P+      S Y         R+    + +     G G   G      
Sbjct: 155 VLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRINQSPLGAGALAGHPYGID 214

Query: 264 RGFAEQIAAQVSRETGLEFR-TAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYL 322
           R F   +AA      GL F     N   A++  D +VE           + + A D+  +
Sbjct: 215 REF---LAA------GLGFDGVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-II 264

Query: 323 GSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAI 371
            S    G+ +L+      GSS+MP K N    E L     +V G+ A  
Sbjct: 265 YSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGF 312

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 90/239 (37%), Gaps = 21/239 (8%)

Query: 130 NANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELE 189
            ANE    R  EL+G ++  K VH        +S ND   + + I     +  SL P ++
Sbjct: 90  TANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDVVNDSLFPAMK 139

Query: 190 ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 249
            L     ++ +    I+  G THLQ A P+      S Y         R+    + L  L
Sbjct: 140 GLVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRL---VQILHRL 196

Query: 250 AQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTL 308
            Q     G       G   +  A+     GL F +   N   A++  D +VE        
Sbjct: 197 NQSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 309 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
              + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 91/238 (38%), Gaps = 21/238 (8%)

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190
           ANE    R  E++G ++  K VH        +S ND   + + I     +  +L P L+ 
Sbjct: 91  ANE---RRLGEIIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250
           L     ++     +I+  G THLQ A P+      S Y         R++   + L  L 
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLD---QILHRLN 197

Query: 251 QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTLA 309
           Q     G       G   +  A+     GL F +   N   A++  D +VE         
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSMVAVSDRDFIVELMFWGTLFM 252

Query: 310 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
             + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 90/238 (37%), Gaps = 21/238 (8%)

Query: 131 ANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEA 190
           ANE    R  EL+G ++  K VH        +S ND   + + I     +  +L P L+ 
Sbjct: 91  ANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 191 LRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLA 250
           L     ++ +    I+  G THLQ A P+      S Y         R+    + L  L 
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRL---GQILHRLN 197

Query: 251 QGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTLA 309
           Q     G       G   +  A+     GL F +   N   A++  D +VE         
Sbjct: 198 QSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 310 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
             + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 253 NHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 90/239 (37%), Gaps = 21/239 (8%)

Query: 130 NANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELE 189
            ANE    R  EL+G ++  K VH        +S ND   + + I     +  +L P L+
Sbjct: 90  TANE---RRLGELIGRDIAGK-VHT------GRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 190 ALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFL 249
            L     ++ +    ++  G THLQ A P+      S Y         R+    + L  L
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRL---GQILHRL 196

Query: 250 AQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTA-PNKFEALAAHDAVVEASGALNTL 308
            Q     G       G   +  A+     GL F +   N   A++  D +VE        
Sbjct: 197 NQSPLGAGALAGHPYGIDREFLAE-----GLGFNSVIGNSLVAVSDRDFIVELMFWGTLF 251

Query: 309 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
              + + A D+  +      G+ +LS      GSS+MP K N    E L     +V G+
Sbjct: 252 MNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 78/215 (36%), Gaps = 11/215 (5%)

Query: 153 HPNNHCNQAQSSNDTFPSVMHIAAVTEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTH 212
           H     +  +S ND   + + I     +   LLP +  L     ++ +    I+  G TH
Sbjct: 103 HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEIDILMPGYTH 162

Query: 213 LQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFAEQIAA 272
           LQ A P+      S Y         R++   E L     G  A+        G    I  
Sbjct: 163 LQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA-------GHPYGIDR 215

Query: 273 Q-VSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRYLGSGPRCGYG 331
           Q +S E G       N   A++  D +V+           + + + D+  + S    G+ 
Sbjct: 216 QYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-IIYSTAEFGFI 273

Query: 332 ELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMG 366
           +LS      GSS+MP K N    E L     +V G
Sbjct: 274 KLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 113/291 (38%), Gaps = 42/291 (14%)

Query: 88  GTLEPGIAKAIQQAADEVAQGQ--LMEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 145
           G L+ G+    Q+  DE+ +G   +   +    F    G +    ANE    R  E++G 
Sbjct: 50  GLLKAGLL--TQEELDEIHRGLEIIRGEWASNSFVEKDGDEDIHTANE---RRLGEIIGR 104

Query: 146 ELGSKQVHPNNHCNQAQSSNDTFPSVMHIA---AVTEITRSLLPELEALRVSFQRKTDEF 202
            +  K VH        +S ND   + M I    A+  + + L   + A+    QR   E 
Sbjct: 105 HIAGK-VHT------GRSRNDQVATDMRIYCREALDNMAKILKDLVGAI---LQRAEQEI 154

Query: 203 AHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQG-GTAVGTGLN 261
             ++  G THLQ A P+      + Y         R++  +E L     G G   G    
Sbjct: 155 DALMP-GYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALAGHPYG 213

Query: 262 TRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLF-----KIA 316
             R   E IA ++  +         N  +A++  D VVE         CSLF     + +
Sbjct: 214 IDR---EHIAERLGFDG-----VIGNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFS 260

Query: 317 NDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGN 367
            D+  + S     + +LS      GSS+MP K NP   E L     +V G+
Sbjct: 261 EDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 12/161 (7%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGL 260
           E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTT-GTQA 203

Query: 261 NTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           +    F       E++  +V+   G  F T         +    ++    L++ A S  K
Sbjct: 204 SFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKIDIDVLAPLSSFAASAHK 261

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           +A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 262 MATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 69/161 (42%), Gaps = 12/161 (7%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGL 260
           E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTT-GTQA 203

Query: 261 NTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           +    F       E + A+V+   G + +  P   +   +    ++    L++ A +  K
Sbjct: 204 SFLALFHGNHDKVEALDARVTELLGFD-KVYPVTGQTY-SRKIDIDVLAPLSSFAATAHK 261

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           +A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 262 MATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 67/158 (42%), Gaps = 20/158 (12%)

Query: 208 IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGFA 267
           +G TH Q A   TLG+  + + Q++   +     A+  + F    GT   TG  T+  F 
Sbjct: 152 LGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRARNDIGFRGVKGT---TG--TQASFL 206

Query: 268 EQIAAQVSRETGLEFRTAP-NKFEAL-------AAHDAVVEASGALNTLACSLFKIANDI 319
                   +   L+ R A  + F+ +        +    ++  G L++ A +  K+A DI
Sbjct: 207 ALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTYSRKVDIDVLGPLSSFAATSHKLATDI 266

Query: 320 RYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 355
           R L +       EL  P   ++ GSS M  K NP + E
Sbjct: 267 RLLAN-----LKELEEPFEASQIGSSAMAYKRNPMRCE 299

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 6/175 (3%)

Query: 184 LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 243
           L+P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 244 ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVE 300
             +      GT    G+ L       +++ A   R T L  F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
               L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 65/158 (41%), Gaps = 6/158 (3%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT--AVGT 258
           E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT     +
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERARNDIGLRGVKGTTGTQAS 204

Query: 259 GLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 317
            L    G  +++ A   R T L  F           +    ++    L++ A +  K+A 
Sbjct: 205 FLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDIDVLAPLSSFAATAHKMAT 264

Query: 318 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           DIR L +       E    +++ GSS M  K NP + E
Sbjct: 265 DIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 73/177 (41%), Gaps = 10/177 (5%)

Query: 184 LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 243
           L+P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 244 ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVE 300
             +      GT     + L    G  +++ A   R   L  F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKIDID 247

Query: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 355
               L++ A +  K+A DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 248 VLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 73/176 (41%), Gaps = 8/176 (4%)

Query: 184 LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 243
           L+P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 244 ESLRFLAQGGTAVGTG---LNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVV 299
             +      GT  GT    L    G  +++ A   R T L  F T         +    +
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDI 246

Query: 300 EASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           +    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 247 DVLAPLSSFAATAHKMATDIRLLANLKEM---EEPFEKSQIGSSAMAYKRNPMRCE 299

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 65/158 (41%), Gaps = 6/158 (3%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT--AVGT 258
           E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT     +
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTTGTQAS 204

Query: 259 GLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 317
            L    G  +++ A   R T L  F           +    ++    L++ A +  K+A 
Sbjct: 205 FLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDIDVLAPLSSFAATAHKMAT 264

Query: 318 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           DIR L +       E    +++ GSS M  K NP + E
Sbjct: 265 DIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 64/158 (40%), Gaps = 6/158 (3%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT--AVGT 258
           E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT     +
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTTGTQAS 204

Query: 259 GLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 317
            L    G  +++ A   R T L  F           +    ++    L++ A +  K+A 
Sbjct: 205 FLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKIDIDVLAPLSSFAATAHKMAT 264

Query: 318 DIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           DIR L +       E    + + GSS M  K NP + E
Sbjct: 265 DIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 10/160 (6%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGT--AVGT 258
           E+  +  +G TH Q A   TLG+  + + Q++   +     A+  +      GT     +
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQAS 204

Query: 259 GLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVEASGALNTLACSLFKIAN 317
            L    G  +++ A   R T L  F T         +    ++    L++ A +  K+A 
Sbjct: 205 FLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDIDVLAPLSSFAATAHKMAT 264

Query: 318 DIRYLGSGPRCGYGELSLP--ENEPGSSIMPGKVNPTQNE 355
           DIR L +       EL  P  +++ GSS M  K NP + E
Sbjct: 265 DIRLLAN-----LKELEEPFEKSQIGSSAMAYKRNPMRCE 299

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 64/154 (41%), Gaps = 12/154 (7%)

Query: 208 IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF- 266
           +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  +    F 
Sbjct: 152 LGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTT-GTQASFLALFH 210

Query: 267 -----AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFKIANDIRY 321
                 E++  +V    G  F T         +    ++A   L++ A +  K+A DIR 
Sbjct: 211 GDHNKVEKLDERVVELLG--FDTVYPVTGQTYSRKIDIDAFAPLSSFAATAHKMATDIRL 268

Query: 322 LGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           L +       E    +++ GSS M  K NP + E
Sbjct: 269 LANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 6/175 (3%)

Query: 184 LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 243
           ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 244 ESLRFLAQGGT--AVGTGLNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVVE 300
             +      GT     + L    G  +++ A   R T L  F T         +    ++
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKIDID 247

Query: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
               L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 248 VLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNPMRCE 299

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 77/186 (41%), Gaps = 13/186 (6%)

Query: 201 EFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGL 260
           E+  +  +G TH Q A   TLG+  + + Q++   +   E A+  +      GT  GT  
Sbjct: 145 EYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERARNDIGLRGVKGTT-GTQA 203

Query: 261 NTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEASGALNTLACSLFK 314
           +    F       E++  +V    G  F T         +    ++    L + A +  K
Sbjct: 204 SFLALFHGNHDKVEELDERVVELLG--FDTVYPVTGQTYSRKIDIDVVSPLVSFAATAHK 261

Query: 315 IANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQACVQVMGNNAAITFA 374
           +A DIR L +       E    +++ GSS M  K NP + E +  +  + +G+  + T  
Sbjct: 262 MATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCERVC-SLARHLGSLLSDTVQ 317

Query: 375 GASGQF 380
            AS Q+
Sbjct: 318 TASVQW 323

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 72/178 (40%), Gaps = 12/178 (6%)

Query: 184 LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 243
           ++P+L  +     +   E+  +  +G TH Q A   TLG+  + + Q++   +     A+
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVRAR 187

Query: 244 ESLRFLAQGGTAVGTGLNTRRGF------AEQIAAQVSRETGLEFRTAPNKFEALAAHDA 297
             L      GT  GT  +    F       E++  +V+   G  F T         +   
Sbjct: 188 NDLGLRGVKGTT-GTQASFLALFHGNHDKVEELDERVTELLG--FDTVYPVTGQTYSRKI 244

Query: 298 VVEASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
            ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 245 DIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 79  SAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQTGSGTQSNMNANEVISNR 138
           S A+ +++L   +P   K + + +D+   G     F L     G G ++  +  E   N+
Sbjct: 641 SKAMRDDELKASDPLQTKELHEMSDKFESGMKKGKFRLSKGFGGKGLENIKSKREEAQNK 700

Query: 139 AIELLGGELGSKQVH------PNNHCNQAQSS 164
            +E   G+  + Q+       PN H N+A+SS
Sbjct: 701 ELEHKKGQKNNDQLENKSDHSPNEHANEAESS 732

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 63/160 (39%), Gaps = 24/160 (15%)

Query: 208 IGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQESLRFLAQGGTAVGTGLNTRRGF- 266
           +G TH Q A   TLG+  + + Q +   +   + A+  +      GT  GT  +    F 
Sbjct: 152 LGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDRARNDIGLRGVKGTT-GTQASFLALFH 210

Query: 267 -----AEQIAAQVSRETGLEF------RTAPNKFEALAAHDAVVEASGALNTLACSLFKI 315
                 E++  +V+   G E       +T   K +        ++    L + A +  K+
Sbjct: 211 GNHDKVEELDQRVTELLGFETVYPVTGQTYSRKID--------IDVLAPLASFAATAHKM 262

Query: 316 ANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           A DIR L +       E    + + GSS M  K NP + E
Sbjct: 263 ATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE 299

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 8/176 (4%)

Query: 184 LLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEHAQ 243
           ++P+L  +     +   E+  +  +G TH Q A   T+G+  + + Q++   +     A+
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 244 ESLRFLAQGGTAVGTG---LNTRRGFAEQIAAQVSRETGLE-FRTAPNKFEALAAHDAVV 299
             +      GT  GT    L    G  +++ A   R   L  F T         +    +
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKIDI 246

Query: 300 EASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 355
           +    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E
Sbjct: 247 DVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE 299

>KLLA0D15081g Chr4 (1271696..1274728) [3033 bp, 1010 aa] {ON} some
           similarities with Saccharomyces cerevisiae YPR115W
           Hypothetical ORF and to YGR097W uniprot|P48361
           Saccharomyces cerevisiae YGR097W ASK10 Component of the
           RNA polymerase II holoenzyme phosphorylated in response
           to oxidative stress has a role in destruction of Ssn8p
           which relieves repression of stress-response genes
          Length = 1010

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 21/111 (18%)

Query: 134 VISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAV---------------- 177
            ++N +I+L G EL   Q+ PN+ C+ A   N    S+  I  +                
Sbjct: 218 TLNNSSIDL-GQEL---QLEPNDSCSGAGFMNFGSGSIQDIQVILKKYHLSLASQQVKSS 273

Query: 178 TEITRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGY 228
            EIT  ++P+LE LR     K  E   +    +T++Q+   LT GQ    Y
Sbjct: 274 KEITLQIIPKLEDLRKDLSHKIKEIKELNADFKTNIQEHVALT-GQLLHKY 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,309,212
Number of extensions: 1702727
Number of successful extensions: 4151
Number of sequences better than 10.0: 63
Number of HSP's gapped: 4209
Number of HSP's successfully gapped: 63
Length of query: 488
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 374
Effective length of database: 40,409,475
Effective search space: 15113143650
Effective search space used: 15113143650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)