Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR012C6.14ON54154127570.0
SAKL0E01012g6.14ON54455316040.0
Kwal_56.223876.14ON54355216040.0
Ecym_30186.14ON57559115720.0
KLLA0D00979g6.14ON56157215500.0
KLTH0C11396g6.14ON55056215280.0
Suva_5.76.14ON66450914980.0
Smik_5.276.14ON60848314880.0
YEL060C (PRB1)6.14ON63548214760.0
Skud_5.296.14ON60849914700.0
TDEL0G045506.14ON56447414260.0
ZYRO0C07942g6.14ON54856313910.0
TBLA0A073006.14ON57347313930.0
CAGL0B03619g6.14ON46848613400.0
NCAS0F002206.14ON69542113600.0
KNAG0E009206.14ON53156413281e-179
NDAI0K028806.14ON70448013371e-178
Kpol_1032.56.14ON68047213231e-176
KAFR0L003606.14ON50243612701e-170
Kpol_1045.756.14ON47743712661e-170
Smik_15.1726.14ON47842111211e-148
YOR003W (YSP3)6.14ON47842111071e-146
Suva_15.1786.14ON47642111011e-145
TPHA0M002306.14ON58547611081e-145
CAGL0E02651g6.14ON48542010861e-143
Skud_15.1646.14ON48242410791e-142
KAFR0B065506.14ON4563519061e-116
NCAS0D026306.14ON4514378471e-107
NDAI0I022806.14ON4824287882e-98
KNAG0F02970singletonON4203467605e-95
CAGL0L13266gsingletonON5794936707e-80
TBLA0F039706.313ON7343204633e-49
Kpol_1028.616.313ON5183274431e-47
Kpol_1018.56.313ON4654194401e-47
NCAS0D043906.313ON4923834392e-47
KNAG0I024706.313ON4754164331e-46
TDEL0A072806.313ON4362884302e-46
SAKL0A02002g6.313ON4794634278e-46
Suva_3.846.313ON5273854291e-45
ZYRO0D08822g6.313ON4903464243e-45
YCR045C (RRT12)6.313ON4914324201e-44
Smik_3.1496.313ON4914324182e-44
Skud_3.1246.313ON5404334202e-44
KLTH0A06094g6.313ON4963614122e-43
Ecym_21056.313ON6103154135e-43
CAGL0L10802g6.313ON5173464001e-41
NDAI0I005606.313ON4834603943e-41
Kwal_23.61836.313ON4934433945e-41
KAFR0J024506.313ON4783143865e-40
KLLA0F06028g6.313ON5083283841e-39
TPHA0D037606.313ON6073183872e-39
AAR069W6.313ON7683583804e-38
TBLA0A067006.313ON4973073401e-33
Kwal_33.133721.78ON3773103154e-31
KLTH0F02288g1.78ON3803153146e-31
Kpol_2000.691.78ON3863112892e-27
TDEL0C062301.78ON3643212457e-22
ZYRO0F16764g1.78ON3863562389e-21
TPHA0B045201.78ON3882752211e-18
TBLA0A054101.78ON3823471971e-15
Skud_14.1012.6ON81971723.8
ZYRO0F15598g2.6ON79063715.4
SAKL0G00440g2.6ON83668698.0
NDAI0F038902.6ON83376698.4
Smik_14.972.6ON81468698.9
YNL238W (KEX2)2.6ON81468699.1
TDEL0B017308.462ON97091699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR012C
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...  1066   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   622   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   622   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   610   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   601   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   593   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   581   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   577   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   573   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   570   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   553   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   540   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   541   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   520   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   528   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   516   e-179
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   519   e-178
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   514   e-176
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   493   e-170
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   492   e-170
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   436   e-148
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   431   e-146
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   428   e-145
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   431   e-145
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   422   e-143
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   420   e-142
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   353   e-116
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     330   e-107
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   308   2e-98
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              297   5e-95
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   262   7e-80
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   182   3e-49
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   175   1e-47
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   174   1e-47
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   173   2e-47
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   171   1e-46
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   170   2e-46
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   169   8e-46
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   169   1e-45
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   167   3e-45
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   166   1e-44
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   165   2e-44
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   166   2e-44
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   163   2e-43
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   163   5e-43
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   158   1e-41
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    156   3e-41
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   156   5e-41
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   153   5e-40
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   152   1e-39
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   153   2e-39
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   150   4e-38
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   135   1e-33
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   125   4e-31
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   125   6e-31
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   115   2e-27
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    99   7e-22
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...    96   9e-21
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    90   1e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    80   1e-15
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    32   3.8  
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    32   5.4  
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    31   8.0  
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    31   8.4  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    31   8.9  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    31   9.1  
TDEL0B01730 Chr2 (309698..312610) [2913 bp, 970 aa] {ON} Anc_8.4...    31   9.7  

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score = 1066 bits (2757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/541 (95%), Positives = 517/541 (95%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMARENQERKAQGAEQQSP 60
           MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMARENQERKAQGAEQQSP
Sbjct: 1   MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMARENQERKAQGAEQQSP 60

Query: 61  LFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGEN 120
           LFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGEN
Sbjct: 61  LFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGEN 120

Query: 121 NEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFT 180
           NEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFT
Sbjct: 121 NEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFT 180

Query: 181 TQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGK 240
           TQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGK
Sbjct: 181 TQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGK 240

Query: 241 TIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAV 300
           TIPNNDADYDGNGHGTHCAGTIASKTYG            LRSNGTGSMSDVLRGVEYAV
Sbjct: 241 TIPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAV 300

Query: 301 KAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTS 360
           KAHRKAAEKADKGFKGSTANMSLGGGRSQ            GIHFAVAAGNENQDACNTS
Sbjct: 301 KAHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTS 360

Query: 361 PAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASP 420
           PAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASP
Sbjct: 361 PAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASP 420

Query: 421 HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480
           HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG
Sbjct: 421 HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480

Query: 481 GADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNI 540
           GADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNI
Sbjct: 481 GADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNI 540

Query: 541 I 541
           I
Sbjct: 541 I 541

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/553 (55%), Positives = 394/553 (71%), Gaps = 21/553 (3%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAED---ELVVAEAHRG--QLVQWMARENQERKAQGA 55
           MK+Q  + P  ALTT  A L++P+ +    ++ V E +    +++   A+E     A+  
Sbjct: 1   MKVQSTILPIAALTTLAAALVIPEVDKSSKDVSVKEINSDSQEVLASFAKEITRAAAEKG 60

Query: 56  EQ--QSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFF 113
           E+   +PL         IPH+YI+VF++  + EE +FH E++  AHAESVA+LD + +FF
Sbjct: 61  EEVKLAPLVSSPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFF 120

Query: 114 RSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSM 173
            +T+G  +E+GIAA  +EGGI+  F +   L GY+GYFT+++V  +R N  V F+E+DS+
Sbjct: 121 AATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDSL 180

Query: 174 VFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFE 233
           VFAS+F TQNGAPWGL+R+SHRE+LN GSFNKYLYDD++G+GVTSYVIDTGIN++H DF 
Sbjct: 181 VFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDFN 240

Query: 234 DRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVL 293
            RA+WGKT+P ND D DGNGHGTHCAGTIAS+ YG            LRSNG+G+MSDV+
Sbjct: 241 GRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDVV 300

Query: 294 RGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNEN 353
           +GVE+A ++H++A++K  KGFKGSTANMSLGGG+S             GIHFAVAAGNEN
Sbjct: 301 KGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNEN 360

Query: 354 QDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLS 413
           QDACNTSPAA++ AITVGASTL+DDRAYFSNWG+CVD+FAPG+N+LSTYIGS+TA ATLS
Sbjct: 361 QDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLS 420

Query: 414 GTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTAN 473
           GTSMASPHVAGLLTYFLSLQPD DSEF     I+P  LKKK+I + TKD L  LP  T N
Sbjct: 421 GTSMASPHVAGLLTYFLSLQPDSDSEFFQASGITPAQLKKKLIAYSTKDVLYELPEDTPN 480

Query: 474 VLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSD-----LDRLIHELESSTDAMF 528
            LIYNGGG DLSDFWG   ++V          EE    D     L  LI   ++ TD +F
Sbjct: 481 YLIYNGGGQDLSDFWGKSEEQVK---------EEGSIQDFKDFKLSELIESFDTKTDLLF 531

Query: 529 SGFRTILDRMNII 541
              R++ D++NII
Sbjct: 532 EEVRSVFDKLNII 544

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/552 (58%), Positives = 387/552 (70%), Gaps = 20/552 (3%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAE----DELVVAE---AHRGQ-LVQWMARENQERKA 52
           MKLQ  +  A+    A AL +LP+ E    D LV  E   A  G+ ++   ++E  ++ A
Sbjct: 1   MKLQTTLPVAMVAALASAL-VLPEVEEASKDALVAVEETAASLGESILSSFSKEVTKKAA 59

Query: 53  QGAE--QQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQH 110
           +       SPL    ++  AIPH+YIVVF++ V  EE  FHME+V  AHA+SV +LD   
Sbjct: 60  ESGAGVTLSPLVTARNMYDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDAND 119

Query: 111 AFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEE 170
           AFF +T  E  E GI AT  EGGI   F +   LRGY+GYFT+++V  +R NP V FVE+
Sbjct: 120 AFFEATMDE--EMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQ 177

Query: 171 DSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHV 230
           DSMV+A++F TQNGAPWGL+R+SHREKLN GSFNKYLYDD +G+GVTSYVIDTGINIDH 
Sbjct: 178 DSMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHK 237

Query: 231 DFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMS 290
           DFE RA WGKT+P ND D DGNGHGTHCAGTIASK YG            LRSNG+GSMS
Sbjct: 238 DFEGRAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMS 297

Query: 291 DVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAG 350
           DV++GVE+A K+H+ A +K  KGFKGSTANMSLGGG+S             GIHFAVAAG
Sbjct: 298 DVVKGVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAG 357

Query: 351 NENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVA 410
           NENQDACN+SPAA++ AITVGASTLADDRAYFSNWG+CVD+FAPG+N+LSTYIGS+TA A
Sbjct: 358 NENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATA 417

Query: 411 TLSGTSMASPHVAGLLTYFLSLQPDGDSE-FRNKQTISPEVLKKKVIDFGTKDALSSLPA 469
           TLSGTSMASPHVAGLLTYFLSLQPD DSE F     I+P  LKKK+I + TK+AL  LP 
Sbjct: 418 TLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYSTKNALGDLPE 477

Query: 470 RTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFS 529
            T N LIYNGGG DL DFW      V   +   AD ++   S+ + +I  LE  TD ++ 
Sbjct: 478 DTVNYLIYNGGGQDLDDFW------VKDLEEKVADAKDNTASEFESIIDALEEKTDGLYE 531

Query: 530 GFRTILDRMNII 541
             R I + +NII
Sbjct: 532 EIREIFEGLNII 543

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/591 (54%), Positives = 393/591 (66%), Gaps = 66/591 (11%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAEDELVVAEA-------------------------- 34
           MK+Q  V P    +T  A LILP  + E+ +                             
Sbjct: 1   MKVQSVVLPVAVFSTLGAALILPWMDPEIRLDVGLHGRGPHGRVPPPHHHKMGEHGRGRG 60

Query: 35  ---HRGQLVQWMARENQERKAQGAEQQSPLFR-----------------VDDVTRAIPHK 74
              HRG  V  +  +++E K       SP+F                  + D +RAIPH+
Sbjct: 61  KGHHRGSSV--LLVDDEEDKV------SPMFEYFEFDSSQDFVDMKLASLSDNSRAIPHR 112

Query: 75  YIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGI 134
           YIV+F++GV+D +   H +LV  AH E++A+LD  H+FF +T G ++E GI+A   EGGI
Sbjct: 113 YIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHE-GISARSVEGGI 171

Query: 135 EGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSH 194
           E  F +   LRGY GYFT+ M+ L+R +  V  +E+DS+V ASDF TQ GAPWGLARVSH
Sbjct: 172 EEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLARVSH 231

Query: 195 REKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGH 254
           RE+LN GSFNKYLYDDN+G+GVT+YVIDTGINIDHV+FE RA WGKTIP+NDADYDGNGH
Sbjct: 232 RERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDGNGH 291

Query: 255 GTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGF 314
           GTHCAGTIASKTYG            LR+NGTG+MSDVLRGVEY V  HRKA+   D  F
Sbjct: 292 GTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKAS--GDPNF 349

Query: 315 KGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGAST 374
           KGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSPA+S+K ITV AST
Sbjct: 350 KGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCITVAAST 409

Query: 375 LADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQP 434
           L+DDRAYFSNWG CVD+FAPG+NILSTYIGSDTAVATLSGTSMASPHVAGLL YFLSLQP
Sbjct: 410 LSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAYFLSLQP 469

Query: 435 DGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKK 494
           D  SE+    +ISPE LKKK++ +G+K+ L+++PARTAN LI+NGGG  L  FW +K   
Sbjct: 470 DSGSEYYTGSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDSFWNSKCDG 529

Query: 495 VSGPKFT----YADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541
               K +     ADD E+     + L+  L S++ ++F   R  LDR+++I
Sbjct: 530 CEQEKVSSSHGKADDFES-----ESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/572 (52%), Positives = 381/572 (66%), Gaps = 42/572 (7%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAE------DELVVAEAHRGQLV---QWMARENQERK 51
           MK +  +    AL+T    L++P+        D+ V  + H    +   Q  A      K
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQHHANGKARSK 60

Query: 52  AQGAEQQS-----------------PLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMEL 94
           ++G    S                 PL  V+D+   IP++YI+VF++  S +E  FH EL
Sbjct: 61  SRGRCADSKKFDKLRPVDDASAILAPLSTVNDIANKIPNRYIIVFKKDASADEVKFHQEL 120

Query: 95  VEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTED 154
           V   HA+++  L +   FF +T GE++EFG+ A   EGGI+  F +   L GYVGYFT++
Sbjct: 121 VSVEHAKALGSLADNDPFFTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKE 180

Query: 155 MVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGE 214
           ++  +R +P V FVEEDSMVF++ F TQN APWGLAR+SHREKLN GSFNKYLYDD++G+
Sbjct: 181 VIDFIRRSPLVEFVEEDSMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGK 240

Query: 215 GVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXX 274
           GVT+YV+DTG+N++H DF+ RA+WGKTIP +D D DGNGHGTHCAGTI S  YG      
Sbjct: 241 GVTAYVVDTGVNVNHKDFDGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNAD 300

Query: 275 XXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXX 334
                 LRSNG+G+MSDV++GVEY  +AH+KA E+  KGFKGSTANMSLGGG+S      
Sbjct: 301 IVAVKVLRSNGSGTMSDVVKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLA 360

Query: 335 XXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAP 394
                  G+HFAVAAGNENQDACNTSPAA++ AITVGASTL+D+RAYFSNWG+CVD+F P
Sbjct: 361 VNAAVKAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGP 420

Query: 395 GMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSE-FRNKQTISPEVLKK 453
           G+NILSTYIGSDTA ATLSGTSMA+PHV GLLTYFLSLQPD DSE F     I+P  LKK
Sbjct: 421 GLNILSTYIGSDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGGITPSQLKK 480

Query: 454 KVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNK----PKKVSGPKFTYADDEEAM 509
           K+IDF TK+ LS LP  T N LIYNGGG DL D WG       +  + P+F+        
Sbjct: 481 KLIDFSTKNVLSDLPEDTVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFS-------- 532

Query: 510 GSDLDRLIHELESSTDAMFSGFRTILDRMNII 541
              L+ LI+ L+S TDA+F   R +LD+ NII
Sbjct: 533 ---LESLINSLDSKTDAIFDDVRQLLDQFNII 561

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/562 (54%), Positives = 381/562 (67%), Gaps = 33/562 (5%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAE-----------DELVVAEAHRGQLVQWMARENQE 49
           MKLQ A+ P   + +  A L+LP  E           D +   E+      + M ++   
Sbjct: 1   MKLQTAL-PVAVVASVGAALVLPDLEEASNTVALKVKDVITAGESIVSSFSKQMTKD-AA 58

Query: 50  RKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQ 109
            K +  E  SPL        AIPH+YIVVF++ +S EE  FH ++V  AH +SVA+L+  
Sbjct: 59  SKGESVEL-SPLVSSSGKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLEST 117

Query: 110 HAFFRSTRG--ENNEFGIAATRA------EGGIEGEFALGEQLRGYVGYFTEDMVGLLRS 161
           H FF ST    E+ +F +   R+      EGGI+  F +   L GY+GYFT+++V  +R 
Sbjct: 118 HEFFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRM 177

Query: 162 NPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVI 221
           NP V FVE+DS+VFA +F TQNGAPWGL+R+SHREKLN GSFNKYLYDD++G+GVTSYVI
Sbjct: 178 NPLVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVI 237

Query: 222 DTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXL 281
           DTG+N+DH DFE RA WGKTIP ND D DGNGHGTHCAGTIASK YG            L
Sbjct: 238 DTGVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVL 297

Query: 282 RSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXX 341
           RSNG+GSMSDV++GVE+A K+H+ A ++  KGFKGSTANMSLGGG+S             
Sbjct: 298 RSNGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKA 357

Query: 342 GIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILST 401
           GIHFAVAAGNENQDACN+SPA+++ A+TVGASTLADDRAYFSNWG+CVD+FAPG+N+LST
Sbjct: 358 GIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLST 417

Query: 402 YIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSE-FRNKQTISPEVLKKKVIDFGT 460
           YIGSDTA ATLSGTSMASPHVAGLLTYFLSLQPD DSE F     I+P  LKKK+I + T
Sbjct: 418 YIGSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGGITPSQLKKKLIAYST 477

Query: 461 KDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADD-EEAMGSDLDRLIHE 519
           K+ L  +P  T N LI+NGGG  L DFWG         K +  D+ E+ + S+++  I  
Sbjct: 478 KNVLGDIPDDTVNYLIFNGGGEGLDDFWG---------KESVVDEVEDTISSEIESFIDA 528

Query: 520 LESSTDAMFSGFRTILDRMNII 541
           LE  TD ++   R + D MNII
Sbjct: 529 LEEKTDVLYEEIREVFDHMNII 550

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/509 (58%), Positives = 359/509 (70%), Gaps = 31/509 (6%)

Query: 35  HRGQLVQWMARENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMEL 94
           HRG+L   ++ E               F  D +T+ IP++YI+VF++ V  EEAAFH E 
Sbjct: 185 HRGKLAPLVSTEQ--------------FNPDAITKIIPNRYIIVFKKDVPPEEAAFHRET 230

Query: 95  VEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTED 154
           V+ A  +SV  L  + AFF STR    +  ++++ A GGI+  F +     GY+GYFT++
Sbjct: 231 VQQAQLQSVENLAAEDAFFISTR----DAALSSSEA-GGIQDSFNIDSLFSGYIGYFTQE 285

Query: 155 MVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGE 214
           +V L+R NP V FVE+DS+V A+DF TQN APWGLARVSHRE+LN GSFNKYLYDD++G 
Sbjct: 286 IVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGR 345

Query: 215 GVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXX 274
           GVTSYVIDTG+N++H DFE RA+WGKTIP ND D DGNGHGTHCAGTIASK YG      
Sbjct: 346 GVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNAN 405

Query: 275 XXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXX 334
                 LRSNG+G+MSDVL+GVEYA KAH+K AE+  KGFKGSTANMSLGGG+S      
Sbjct: 406 VVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLA 465

Query: 335 XXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAP 394
                  GIHFAVAAGNENQDACNTSPA++ KAITVGASTL+DDRAYFSN+G+CVD+FAP
Sbjct: 466 VNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAP 525

Query: 395 GMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEF--RNKQTISPEVLK 452
           G+NILSTYIGSD A ATLSGTSMASPHVAGLLTYFLSLQP  DSEF    + +++P+ LK
Sbjct: 526 GLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLK 585

Query: 453 KKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSD 512
           KK+I + TKD L  +P  T N LIYNGGG DLS FW +  K  S   F           +
Sbjct: 586 KKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQE-------LN 638

Query: 513 LDRLIHELESSTDAMFSGFRTILDRMNII 541
           LD  I    S TD +F   R +LD++NII
Sbjct: 639 LDEFI---GSKTDLIFEQVRDVLDKLNII 664

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/483 (59%), Positives = 346/483 (71%), Gaps = 20/483 (4%)

Query: 62  FRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENN 121
           F  D +++ IP++YIVVF++GV +EE  FH E V  A  +SV  L  + AFF STR    
Sbjct: 143 FNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRDT-- 200

Query: 122 EFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTT 181
                +T   GGI+  F +     GY+GYFT++++ L+R NP V FVE DS+V A++F T
Sbjct: 201 ---YLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEATEFDT 257

Query: 182 QNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKT 241
           QN APWGLAR+SHRE+LN GSFNKYLYDD++G GVTSYVIDTG+NI+H DFE RA+WGKT
Sbjct: 258 QNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKT 317

Query: 242 IPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVK 301
           IP ND D DGNGHGTHCAGTIASK YG            LRSNG+G+MSDV++GVEYA K
Sbjct: 318 IPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAK 377

Query: 302 AHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSP 361
           AH+K A++  KGFKGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSP
Sbjct: 378 AHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDACNTSP 437

Query: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPH 421
           A++ KAITVGASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPH
Sbjct: 438 ASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPH 497

Query: 422 VAGLLTYFLSLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNG 479
           VAGLLTYFLSLQP  DSEF    + +++P+ LKKK+I + TKD L  +P  T N LIYNG
Sbjct: 498 VAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFLIYNG 557

Query: 480 GGADLSDFWGNKPKK-VSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRM 538
           GG DLS FW +  K   SG K            ++D  I    S TD +F   R +LD++
Sbjct: 558 GGQDLSAFWNDTKKSHPSGSKHEL---------NMDEFIG---SKTDLLFEQVRDVLDKL 605

Query: 539 NII 541
           NII
Sbjct: 606 NII 608

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/482 (59%), Positives = 345/482 (71%), Gaps = 18/482 (3%)

Query: 62  FRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENN 121
           F  D +++ IP++YI+VF+ G   EE  FH E V+ A  +SV  L  + AFF ST+  + 
Sbjct: 170 FNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTS- 228

Query: 122 EFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTT 181
                +T   GGI+  F +     GY+GYFT+++V L+R NP V FVE DS+V A++F T
Sbjct: 229 ----LSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDT 284

Query: 182 QNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKT 241
           QN APWGLAR+SHRE+LN GSFNKYLYDD++G GVTSYVIDTG+NI+H DFE RA+WGKT
Sbjct: 285 QNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKT 344

Query: 242 IPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVK 301
           IP ND D DGNGHGTHCAGTIASK YG            LRSNG+G+MSDV++GVEYA K
Sbjct: 345 IPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAK 404

Query: 302 AHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSP 361
           AH+K A++  KGFKGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSP
Sbjct: 405 AHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSP 464

Query: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPH 421
           A++ KAITVGASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPH
Sbjct: 465 ASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPH 524

Query: 422 VAGLLTYFLSLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNG 479
           VAGLLTYFLSLQP  DSEF    + +++P+ LKKK+I + TKD L  +P  T NVLIYNG
Sbjct: 525 VAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNG 584

Query: 480 GGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMN 539
           GG DLS FW +  K  S       + +E +G           S TD +F   R ILD++N
Sbjct: 585 GGQDLSAFWNDTKKSHSSGFKQELNMDEFIG-----------SKTDLIFDQVRDILDKLN 633

Query: 540 II 541
           II
Sbjct: 634 II 635

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/499 (57%), Positives = 350/499 (70%), Gaps = 23/499 (4%)

Query: 50  RKAQGAEQQSPL-----FRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVA 104
            KA+  E+ +PL     F    + + IP++YI+VF++GV  E   FH E V  A  +SV 
Sbjct: 126 EKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVE 185

Query: 105 RLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPH 164
            L  + AFF STR  +      +T   GGI+  F +     GY+GYFT++++ L+R NP 
Sbjct: 186 NLSAEDAFFISTRDSS-----LSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPL 240

Query: 165 VHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTG 224
           V FVE DS+V A+DF TQN APWGLAR+SHRE+LN GSFNKYLYDD++G GVTSYVIDTG
Sbjct: 241 VDFVERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 300

Query: 225 INIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSN 284
           +N++H DFE RA+WGKTIP ND D DGNGHGTHCAGTIASK YG            LRSN
Sbjct: 301 VNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 360

Query: 285 GTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIH 344
           G+G+MSDV++GVEYA +AH+K A++  KGFKGSTANMSLGGG+S             GIH
Sbjct: 361 GSGTMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIH 420

Query: 345 FAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIG 404
           FAVAAGNENQDACNTSPA++ KAITVGASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIG
Sbjct: 421 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIG 480

Query: 405 SDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKD 462
           SD A ATLSGTSMASPHVAGLLTYFLSLQP  DSEF    + +++P+ LK K+I + TKD
Sbjct: 481 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKD 540

Query: 463 ALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELES 522
            L  +P  T N LIYNGGG DLS FW N  KK    +F           ++D  I    S
Sbjct: 541 ILFDVPEDTPNALIYNGGGQDLSAFW-NDTKKSHSSRFKQE-------LNMDEFI---GS 589

Query: 523 STDAMFSGFRTILDRMNII 541
            TD +F   R +LD++NII
Sbjct: 590 KTDLIFEQVRDVLDKLNII 608

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/474 (59%), Positives = 335/474 (70%), Gaps = 21/474 (4%)

Query: 70  AIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATR 129
           A PH+YIVV +   S EE A HME +  +  +SV  L +   FF S +G          R
Sbjct: 110 AFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFF-SAQG---------VR 158

Query: 130 AEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGL 189
             GGI+  F +   L GYVGYFT+ +V L+R +P V FVE DS V AS+F TQNGAPWGL
Sbjct: 159 TTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGL 218

Query: 190 ARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADY 249
           +R+SHRE+LN GSFNKYL+DD +G+GVTSYVIDTGIN+ H DFE RA WGKTIP ND D 
Sbjct: 219 SRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDL 278

Query: 250 DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEK 309
           DGNGHGTHCAGTIASK YG            LRSNG+GSMSDV++GVE+A ++H+KA + 
Sbjct: 279 DGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKD 338

Query: 310 ADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAIT 369
             KGFKGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSPAA+++A+T
Sbjct: 339 KKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVT 398

Query: 370 VGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYF 429
           VGASTL+DDRAYFSN+G+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPHVAGLLTYF
Sbjct: 399 VGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYF 458

Query: 430 LSLQPDGDSEFRN--KQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487
           LSLQPD DS+F +   Q ++PE LKKK+I + TKD L  LP  T N LIYNGGG  L  F
Sbjct: 459 LSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGF 518

Query: 488 WGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541
           W    K+ +  +F          +DL  L   L + TDA+F   R +LDR+NII
Sbjct: 519 WDGHDKQEANTRF--------QDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/563 (49%), Positives = 367/563 (65%), Gaps = 37/563 (6%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQA-----------------EDELVVAEA-----HRGQ 38
           MK Q++V P   L    + LI+P+                    E VVA +      + +
Sbjct: 1   MKFQKSVIPVATLAGLGSALIIPELTGSNEYEKRPERTDDVNNGESVVATSFEKGPSKDE 60

Query: 39  LVQWMARENQERKAQGAEQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAA 98
           L  + ++  QE +    ++ +PL   +D    + ++YI++F++GV+ +E  FH EL+E  
Sbjct: 61  LAVFASKLTQEVQ----DRFAPLVVPEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQV 116

Query: 99  HAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGL 158
           H + V++L E+H+FF   R +            GGI+  F +   L GY GYF   ++ +
Sbjct: 117 HLQEVSQLPEEHSFFEGIRLDG-----VYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDV 171

Query: 159 LRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTS 218
           +R +P +  VE+DS+V+     T+NGAPWGLAR+SHRE+LN GS+NKYLYD+  G GVTS
Sbjct: 172 IRMSPLIEMVEQDSVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTS 231

Query: 219 YVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXX 278
           YVIDTG+N+ H  F  RA WGKTIP  D D DGNGHGTHCAGTI S TYG          
Sbjct: 232 YVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAV 291

Query: 279 XXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXX 338
             LRSNG+GSMSDVL+GVE+A + H+ A ++   GFKGSTANMSLGGG+S          
Sbjct: 292 KVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAA 351

Query: 339 XXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNI 398
              G++FAVAAGNE+QDACNTSPA++   ITVGASTL+DDRAYFSN+G+CVD+FAPG+NI
Sbjct: 352 VAAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNI 411

Query: 399 LSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDF 458
           LSTYIGSD++ ATLSGTSMASPHVAGLL YFLSLQP  DSEF    +ISP+ LKKK++ F
Sbjct: 412 LSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSSISPDQLKKKLLAF 471

Query: 459 GTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIH 518
            TKD LS +P+ T N+LIYNGGG DLS FWG+K +     +F      E +  +L  L+ 
Sbjct: 472 STKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSK-EVAQELEFN-----EKVDLELHDLVD 525

Query: 519 ELESSTDAMFSGFRTILDRMNII 541
           EL S TDA+F   R ++DR++II
Sbjct: 526 ELGSKTDAVFGQIRGLMDRLDII 548

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/473 (56%), Positives = 328/473 (69%), Gaps = 26/473 (5%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           IPH+YI+ F++ V+ EE  FH + +     +S+A+L   H +F S  G +          
Sbjct: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLD---------L 175

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190
           +  I   F +   L+GY+GYFT+D++  +R NP V FVE+DS V  ++F TQNGAPWGLA
Sbjct: 176 QQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLA 235

Query: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
           R+SHRE+LN GSFNKYL+DD +GEGVT+YVIDTG+N++H DFE RA WGKTIPNND D D
Sbjct: 236 RISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
           GNGHGTHCAGTIASK YG            LRSNG+GSMSDVL+GVEYA  +H    +  
Sbjct: 296 GNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNK 355

Query: 311 DKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITV 370
             GFKGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSPA+++ AITV
Sbjct: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415

Query: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPHVAGLL+YFL
Sbjct: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475

Query: 431 SLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFW 488
           SLQP+ DSEF    K  I+P  LKK++I +GTKD L  +P  T NVL++NG G DLSDFW
Sbjct: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535

Query: 489 GNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541
                 +S P    AD E       + +   L+   D ++  F  I  +MN++
Sbjct: 536 -----NISKP----ADLES------NEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/486 (55%), Positives = 338/486 (69%), Gaps = 34/486 (6%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           +PHKYIVV ++GVS E  A  +  V AAHA ++  L ++H FF     E           
Sbjct: 2   VPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEG--------LP 53

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190
            GGI+  F + +  +G +GYF E +V LL  +  V FVE DS+V AS+F TQN APWGLA
Sbjct: 54  RGGIKDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLA 113

Query: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
           R+SHR++LN G+FNKYLYD+  GEGVT+YVIDTGIN+ HV+F+ RA WGKTIP ND D D
Sbjct: 114 RISHRDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDID 173

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
           GNGHGTHCAGTIASK YG            L+S+G+G+MSDV++GVEYA +AH K + K 
Sbjct: 174 GNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKES-KN 232

Query: 311 DKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITV 370
           +K FKGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSPA+++KAITV
Sbjct: 233 NKKFKGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITV 292

Query: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIG-SDTAVATLSGTSMASPHVAGLLTYF 429
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIG ++   A+LSGTSMASPHVAGLLTYF
Sbjct: 293 GASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYF 352

Query: 430 LSLQPDGDSEFRN--KQTISPEVLKKKVIDFGTKDALSSLP-ARTANVLIYNGGGADLSD 486
           LSLQPD DSEF +  K  ++P  LKKK+I + TK+ L+ LP   + N+LIYNG G DL  
Sbjct: 353 LSLQPDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGV 412

Query: 487 FWGNKPKKVSGPKFTYADDEEA----------MGSD-LDRLIHELESSTDAMFSGFRTIL 535
           FW +          T AD++ A          +G D L +++ +  ++TD++F   R +L
Sbjct: 413 FWNS----------TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLL 462

Query: 536 DRMNII 541
           D+MNII
Sbjct: 463 DKMNII 468

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 311/421 (73%), Gaps = 6/421 (1%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           IP++YIVVF++ +  EE  FH EL+     ES A+L +   FF ++  E+          
Sbjct: 99  IPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESIN------ 152

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190
           +GGI   F +   L GYVGYFT++++ L+R NP V +VE+DS+V A++F  QN APWGLA
Sbjct: 153 QGGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLA 212

Query: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
           R+SHRE+LN GSFNKYLYDD++G+GVT YVIDTGIN +H DF  RA+WGKTIP ND D D
Sbjct: 213 RISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDID 272

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
           GNGHGTHCAGTIAS  YG            LRSNG+GSMSDV++GVE+A ++H KAA++ 
Sbjct: 273 GNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEK 332

Query: 311 DKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITV 370
            KGFKGSTANMSLGGG+S             GIHFAVAAGNENQDACNTSPA++++AITV
Sbjct: 333 KKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITV 392

Query: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIG D A ATLSGTSMASPHVAGLLTYFL
Sbjct: 393 GASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFL 452

Query: 431 SLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGN 490
           SLQP  DSEF +   ++P  +KKK+I++ +KD L  LP  T N LI+NG G +L D W  
Sbjct: 453 SLQPGSDSEFFDPTELTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWNK 512

Query: 491 K 491
           K
Sbjct: 513 K 513

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  516 bits (1328), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 281/564 (49%), Positives = 351/564 (62%), Gaps = 56/564 (9%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAH-------------RGQLVQWMAREN 47
           MK+ + V  AVAL      L+LP+  DE  V++               RG+       E 
Sbjct: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGRPHHGPKHEK 60

Query: 48  QE-------RKAQGAEQQSPLF---RVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEA 97
            E       ++A   E+ +PL+        + +  +KYI++F+EGV+ E+ + H +L++ 
Sbjct: 61  DEHRPCKHGKEAHDEEELAPLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQLLQQ 120

Query: 98  AHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVG 157
              E+                + +  GI A      +   F L   L GYV   +  ++ 
Sbjct: 121 VLLET---------------SDVSAQGIVAD-----VLDSFDLEGVLSGYVAELSPMVLE 160

Query: 158 LLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVT 217
           L+R +P V  VE+DS V  ++F TQN APWGLAR+SHR+ L+ GSFNKYLYDD +GEGV 
Sbjct: 161 LVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLYDDAAGEGVD 220

Query: 218 SYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXX 277
           SY+IDTGIN+ H +FE RA WGKTIP+ND D DGNGHGTHCAGTIASK YG         
Sbjct: 221 SYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTHCAGTIASKHYGVAKRANVIA 280

Query: 278 XXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXX 337
              LRSNG+GSMSDV+ GVE+A K H   A+  DK FKGSTANMSLGGG+S         
Sbjct: 281 VKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDA 340

Query: 338 XXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMN 397
               G+HF+VAAGNENQDACNTSPAAS++AITVGASTL+DDRAYFSNWG CVD+FAPG+N
Sbjct: 341 AVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLN 400

Query: 398 ILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVID 457
           ILSTY GSD A ATLSGTSMASPHVAGLLTYFLSLQP+  S+F     I+PE LKKK++D
Sbjct: 401 ILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQITPEQLKKKLLD 460

Query: 458 FGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLI 517
           + TK  L  LP  T N LIYNGGGADLSDFWG+K KK   P F +  D            
Sbjct: 461 YSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKSHKPLFAHEYD------------ 508

Query: 518 HELESSTDAMFSGFRTILDRMNII 541
             + +S+DAMF   R +  ++NI 
Sbjct: 509 -NVWASSDAMFEQVRAMFGKLNIF 531

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  519 bits (1337), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 262/480 (54%), Positives = 330/480 (68%), Gaps = 19/480 (3%)

Query: 69  RAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAAT 128
           R +P+KYI+VF++ ++ +E ++H EL+     +S +RL   H FF ST  E        +
Sbjct: 237 RILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSEEE-----EES 291

Query: 129 RAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWG 188
              GGI   F +   L GY GYFT++++ L+R NP V +VE DS+V  ++F TQN APWG
Sbjct: 292 FRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSIVQTTEFNTQNNAPWG 351

Query: 189 LARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDAD 248
           L+R+SHRE+LN GSFNKYLYDD++G+GVT +VIDTGIN++HVDF  RA+WGKTIP+ND D
Sbjct: 352 LSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFGKRAIWGKTIPSNDQD 411

Query: 249 YDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAE 308
            DGNGHGTHCAGTIAS  YG            LRSNG+GSMSDV++GVE+A + H    E
Sbjct: 412 IDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAETHLN-NE 470

Query: 309 KADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAI 368
           K  K +KGSTANMSLGGG+S             GIHF+VAAGNENQDACN+SPA+++ AI
Sbjct: 471 KNKKDYKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNENQDACNSSPASAENAI 530

Query: 369 TVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGS-DTAVATLSGTSMASPHVAGLLT 427
           TVGASTL+DDRAYFSNWGRCVD+FAPG+NILSTY+G  +   ATLSGTSMASPHVAGLLT
Sbjct: 531 TVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATLSGTSMASPHVAGLLT 590

Query: 428 YFLSLQPDGDSEFRNKQT---ISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484
           YFLSLQPD  S F N ++   I+PE LKKK+I + T D L  LP  T N LIYNG G D+
Sbjct: 591 YFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPDGTPNKLIYNGAGGDI 650

Query: 485 SDFWGNKPKKVSGPKFTYADD---EEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541
           SD W  K ++ +  +  + D    E  + SD       +   TD  F   R + ++MNII
Sbjct: 651 SDLWNGKVQEQAHEEPAHEDKINFENLVDSD------SMSGKTDLFFDQIRNVFEKMNII 704

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  514 bits (1323), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 257/472 (54%), Positives = 325/472 (68%), Gaps = 26/472 (5%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           IP+KYI+VF++ VS ++   H +L+  A  +  +  DE                  ++  
Sbjct: 232 IPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDE-----------------TSSSI 274

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190
            GGIE  F +     GY+G+F E +V  +R +P V FVE+DS+V A++  TQN APWGLA
Sbjct: 275 LGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEVDTQNNAPWGLA 334

Query: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
           R+SHR+ LN GS+NKYLYDD +GEGVT+YVIDTGINI H +F  RA+WGKTIP ND D D
Sbjct: 335 RISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWGKTIPENDQDVD 394

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
           GNGHGTHCAGTIASK YG            LRS+G+G+MSDVL+GVEYA  +H+KA  + 
Sbjct: 395 GNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYAAFSHQKALREK 454

Query: 311 DKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITV 370
            KGFKGSTANMSLGGG+S+            GIHFAVAAGNENQDACN+SPAAS+ AITV
Sbjct: 455 KKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNSSPAASENAITV 514

Query: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPHVAGLL+YFL
Sbjct: 515 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMASPHVAGLLSYFL 574

Query: 431 SLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFW 488
           S+QPD DSEF      +ISP  LKKK+I + TK+    LP +T N+L+YN  G ++SDFW
Sbjct: 575 SMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVYN-AGHNISDFW 633

Query: 489 GNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNI 540
             K +  + P      +E A   +L+ L+   +   D   +G + + +RM++
Sbjct: 634 KPKSESSAEP------NERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDL 679

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  493 bits (1270), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 237/436 (54%), Positives = 304/436 (69%), Gaps = 6/436 (1%)

Query: 66  DVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGI 125
           D    IPH+YI+VF++GVS E+  FH EL+   H +  +        +  T     E   
Sbjct: 53  DAENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDINVPE--- 109

Query: 126 AATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGA 185
           +  ++ GGI  +F +   L GY+ Y +++++  +R NP + F+E D+MV  +DF TQN A
Sbjct: 110 SMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVHTTDFNTQNNA 169

Query: 186 PWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNN 245
           PWGLAR+SHRE LN  +FNKYLYDD++G+ V +YVIDTG++++HV+F  RA WGKTIP N
Sbjct: 170 PWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSRAHWGKTIPLN 229

Query: 246 DADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRK 305
           D D DGNGHGTH AGTI S+ YG            LRSNG+GSMSDV++GVE+AV +H +
Sbjct: 230 DQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKGVEFAVSSHLE 289

Query: 306 AAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQ 365
              K +K  KGS ANMSLGGG+S             GIHFAVAAGNENQ+ACN+SPA+++
Sbjct: 290 RM-KNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQNACNSSPASAE 348

Query: 366 KAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGS-DTAVATLSGTSMASPHVAG 424
           +A+TVGAST++D+RAYFSNWG CVD+FAPG+NILSTYIG+ D   ATLSGTSMASPHVAG
Sbjct: 349 QAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSGTSMASPHVAG 408

Query: 425 LLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484
           LL Y+LSLQP+  SEF  +  IS   LKKK+I++ TKD L  LP  T NVLIYNGGG DL
Sbjct: 409 LLAYYLSLQPEKSSEFSTR-AISTSQLKKKLIEYATKDVLEDLPEGTPNVLIYNGGGQDL 467

Query: 485 SDFWGNKPKKVSGPKF 500
           SDFW  +  K+ G  +
Sbjct: 468 SDFWNLQNSKIPGSNY 483

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  492 bits (1266), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 248/437 (56%), Positives = 300/437 (68%), Gaps = 11/437 (2%)

Query: 56  EQQSPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFR- 114
           E+  P   +   +  IP+ YIVVF EGV+  E + H+E +     +SV  L   H FF  
Sbjct: 20  EEVRPASLITPNSEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTI 79

Query: 115 STRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMV 174
           ST  + N  G+      GG+   F +G  L GY G FT+++V  LR +P V F+E DSMV
Sbjct: 80  STSSDVNSNGLL-----GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMV 134

Query: 175 FASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFED 234
             ++ TTQ  APWGLAR+SHR +LN  +FNKYLYDD  G+GV +YVIDTGINI +VDF  
Sbjct: 135 HTTEATTQYNAPWGLARISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGG 194

Query: 235 RALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLR 294
           RA WGKTIP  +A+ DGNGHGTH AGTIAS  YG            LRSNG GSMSDVL+
Sbjct: 195 RAYWGKTIPAGEANVDGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLK 254

Query: 295 GVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQ 354
           GVEY V AH++    A  GFKGS ANMSLGGG+S+            G+HFAVAAGNENQ
Sbjct: 255 GVEYVVGAHQRDVGTA--GFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQ 312

Query: 355 DACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSG 414
           DACNTSPAA+++AITVGASTL+D RAYFSNWG+CV +FAPG+NILSTYIGS  A ATLSG
Sbjct: 313 DACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSG 372

Query: 415 TSMASPHVAGLLTYFLSLQPDGDSEFRNK---QTISPEVLKKKVIDFGTKDALSSLPART 471
           TSMASPH+AGL+ YFLSLQP   S+F ++     I+P+ LKKK++ FGTK+AL  LPA T
Sbjct: 373 TSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANT 432

Query: 472 ANVLIYNGGGADLSDFW 488
            NV+ YNG G  L DFW
Sbjct: 433 PNVIAYNGAGKSLEDFW 449

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  436 bits (1121), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/421 (50%), Positives = 279/421 (66%), Gaps = 6/421 (1%)

Query: 68  TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAA 127
           T  IP++YIVVF E +S +    H ++V+ AH+ SV++L E   F            IA 
Sbjct: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSS-----IAP 118

Query: 128 TRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPW 187
               GGI+  F +    RGY GYFT++++ L+  +P + F+E++S V  S+ + Q  APW
Sbjct: 119 DLQLGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPW 178

Query: 188 GLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA 247
           GL R+SHREK   G   +YLY+D +G GVTSYV+DTGI+ +H DFE RA+WG  IP ND 
Sbjct: 179 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDE 238

Query: 248 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAA 307
             D NGHGTHCAG I SK YG            LRSNG G++SDV++G+EY  + H +++
Sbjct: 239 ASDLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESS 298

Query: 308 EKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKA 367
            K  K FKGSTAN+SLG  +S             G+HFA+AAGNEN+DAC +SPA +QK+
Sbjct: 299 RKKSKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKS 358

Query: 368 ITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLT 427
           ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG+L+
Sbjct: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLS 418

Query: 428 YFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487
           YFLSLQP  DSE+ +   +SP+ LK+KV+ F T   L  +   T N LIYNGGG  L D 
Sbjct: 419 YFLSLQPAPDSEYFD-NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDL 477

Query: 488 W 488
           W
Sbjct: 478 W 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  431 bits (1107), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 212/421 (50%), Positives = 284/421 (67%), Gaps = 6/421 (1%)

Query: 68  TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAA 127
           T  +P++Y++VF E +S ++   HM++V+  H+ SV +L E  AF+R           ++
Sbjct: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSV-----SS 118

Query: 128 TRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPW 187
               GGI+  F +    RGY GYFT++++ ++  +P + FVE+++ V  S+ + Q  APW
Sbjct: 119 KSQFGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPW 178

Query: 188 GLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA 247
           GL RVSHREK   G   +YLY+D +G+GVTSYV+DTGI+ +H DFE RA WG  IP ND 
Sbjct: 179 GLHRVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDE 238

Query: 248 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAA 307
             D NGHGTHCAG I SK +G            LRSNG G++SDV++G+EY  K H +++
Sbjct: 239 ASDLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESS 298

Query: 308 EKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKA 367
           +K +K FKGSTAN+SLG  +S             G+HFA+AAGNE++DAC +SPA ++K+
Sbjct: 299 KKKNKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKS 358

Query: 368 ITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLT 427
           ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMASPHVAG+L+
Sbjct: 359 ITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILS 418

Query: 428 YFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487
           YFLSLQP  DSEF N    SP+ LK+KV+ F T+  L  +   T N LIYNGGG  L  F
Sbjct: 419 YFLSLQPAPDSEFFNDAP-SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGF 477

Query: 488 W 488
           W
Sbjct: 478 W 478

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  428 bits (1101), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 210/421 (49%), Positives = 284/421 (67%), Gaps = 10/421 (2%)

Query: 69  RAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENN-EFGIAA 127
            ++P++YI+ F E  S      H  +++    ESV++L +  AFF ST   ++ +FG   
Sbjct: 65  ESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFG--- 121

Query: 128 TRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPW 187
                GI+  F +    RGY GYFTE+++  +  +P + F+E++S V  ++ T Q  APW
Sbjct: 122 -----GIDSFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPW 176

Query: 188 GLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA 247
           GL R+SHREK   G   +YLY+D +G GVTSYV+DTGI+I+H DFE RA+WG  IP+ND 
Sbjct: 177 GLHRISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDE 236

Query: 248 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAA 307
             D NGHGTHCAG I S+ +G            LRSNG G++SDV++G+EY VK H  ++
Sbjct: 237 ASDLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSS 296

Query: 308 EKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKA 367
           +K    FKGSTAN+SLG  +S             G+HFA+AAGNE++DAC +SPA ++K+
Sbjct: 297 KKGGPKFKGSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKS 356

Query: 368 ITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLT 427
           ITVGAST +DDRA+FS+WG CVD+FAPG+NILSTYIGS  A  +LSGTSMA+PHVAG+L+
Sbjct: 357 ITVGASTFSDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILS 416

Query: 428 YFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDF 487
           YFLSLQP  DSEF +  T+SP+ LK+K+I+F T+  L  +   T N LIYNGGG  L +F
Sbjct: 417 YFLSLQPSSDSEFFD-STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNF 475

Query: 488 W 488
           W
Sbjct: 476 W 476

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  431 bits (1108), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 241/476 (50%), Positives = 312/476 (65%), Gaps = 33/476 (6%)

Query: 74  KYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATR-AEG 132
           +YI+VF++GV  E+   H++++ A       RL E+    R         G +A R    
Sbjct: 135 RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQ---RPAAAP----GASALRDGFD 183

Query: 133 GIEGEFALGEQLRGYVGYF-TEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLAR 191
            +   F +     GY+    +  +V  +R NP V +VE+DS+V + D  TQN APWGLAR
Sbjct: 184 RVMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLAR 242

Query: 192 VSHREKLNSGSFNKYLYDDNS-GEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
           +SHRE LN G+FNKYLY  NS G+GVT+YV+DTGI++ H++F +RA WGKTIP ND D D
Sbjct: 243 ISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDID 302

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
           GNGHGTHCAGTI S+ YG            LRS+G+G+MSDVL+GVE+    H K  E++
Sbjct: 303 GNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEES 362

Query: 311 DK----GFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQK 366
            K     +KG+TANMSLGGG+S             G+HFAVAAGNENQDACN+SPAA++ 
Sbjct: 363 RKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAEN 422

Query: 367 AITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLL 426
           AITVGASTL+DDRAYFSN+G+CVD+FAPG+NILSTYIG++ A ATLSGTSMASPHVAGLL
Sbjct: 423 AITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLL 482

Query: 427 TYFLSLQPDGDSEFRNKQT-ISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLS 485
           TY LSLQPD  SEF    + ++P  +KKK+ID+ TK+AL+ LPA T N LIYN GG + +
Sbjct: 483 TYLLSLQPDKGSEFYVPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYN-GGFNST 541

Query: 486 DFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541
           DFW +     S    T   +  ++GS LD     ++ S +  F+      D MNI 
Sbjct: 542 DFWASAAAPQSHKVKT---NRYSLGSFLD----SIQDSNNHWFN-----FDNMNIF 585

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  422 bits (1086), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/420 (50%), Positives = 281/420 (66%), Gaps = 10/420 (2%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           IP++YIV+F++ V+D+E   H+  +E  ++ S+   D       S  G+  ++   +TR 
Sbjct: 74  IPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQD-------SDFGKATQYNDISTRG 126

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190
            G ++ EF++G  + GY+GYFTE     + ++P V  VE DS+V  +++  Q   PWGL 
Sbjct: 127 IG-LQHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLG 185

Query: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
           R+S REKL       Y YDD  G+   ++VIDTGI +DH DFE RA WGKTI  ND DYD
Sbjct: 186 RISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYD 245

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
            NGHGTHCAGTIASK YG            LRS+G+GSMSDV+RGVEY V+A+    +K 
Sbjct: 246 LNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVEAYND-LKKT 304

Query: 311 DKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITV 370
               KG+  NMSLG  +S             GI FAVAAGNE+ DACN+SPA++   ITV
Sbjct: 305 KSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITV 364

Query: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430
           G STL+DD A+FSN+GRCVD+FAPG+NI+STYIGS  A  +LSGTSM+SPHVAG+L Y+L
Sbjct: 365 GGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYL 424

Query: 431 SLQPDGDSEFRNKQT-ISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWG 489
           SLQPD  S+F ++ + ISP++LKKKV+++ T   LS LPA T N+L+YNGGG +LS FWG
Sbjct: 425 SLQPDHKSQFYHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFWG 484

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  420 bits (1079), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 202/424 (47%), Positives = 281/424 (66%), Gaps = 12/424 (2%)

Query: 68  TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGE---NNEFG 124
           ++++P++YI+VF E +++     H ++++ A   SV+++ E  +F R+       N +FG
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125

Query: 125 IAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNG 184
                   GI+  F +    RGY GYFT++++ ++  +P V F+E +S V  S+ + Q  
Sbjct: 126 --------GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQED 177

Query: 185 APWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPN 244
           APWGL R+SHRE+   G   +YLY+D +G GVTSYV+DTGI+ +H DFE RA WG  IP 
Sbjct: 178 APWGLHRISHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPE 237

Query: 245 NDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHR 304
           ND   D NGHGTHCAG I S+ +G            LRSNG G++SDV++G+EY  K H 
Sbjct: 238 NDEASDLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHI 297

Query: 305 KAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAAS 364
            +++K    FKGSTAN+SLG  +S             G+HFA+AAGNE++DAC +SPA +
Sbjct: 298 ASSKKRGSKFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGA 357

Query: 365 QKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAG 424
           +K+ITVGAST +DDRA+FSNWG CVD+FAPG+NI+STYIGS  A  +LSGTSMA+PHVAG
Sbjct: 358 EKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAG 417

Query: 425 LLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADL 484
           +L+Y LSLQP  DSEF    T+SP+ LK+K++ F T+  L  +   T N L+YNGGG  L
Sbjct: 418 ILSYLLSLQPAQDSEFF-YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKL 476

Query: 485 SDFW 488
            +FW
Sbjct: 477 DEFW 480

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 222/351 (63%), Gaps = 5/351 (1%)

Query: 138 FALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREK 197
           F +G  L GY+     + + LLR +P V  +E DS V A     Q   PWGL+R+S R +
Sbjct: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPR 167

Query: 198 LNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTH 257
           +  G    Y YDD +   VT+YV+DTGI I H  F  RA WGKTI  ND D D +GHGTH
Sbjct: 168 VRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTH 227

Query: 258 CAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGS 317
            AG IAS  +G            LRSNG G MSDVL+G+E+ V  H K    +    KGS
Sbjct: 228 VAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS----KGS 283

Query: 318 TANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLAD 377
             N+SLG  +S              IHFAVAAGNEN DAC TSPA +++AITVGAS  +D
Sbjct: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343

Query: 378 DRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGD 437
           +RA+FSNWG CVD+FAPGMN++STYIGSD A  +LSGTS A+P+ AGL+ Y+LSLQPD D
Sbjct: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKD 403

Query: 438 SEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFW 488
           S +   + ++P  LK+K++ FG+KD L  LP  T N++IYNG G +LS FW
Sbjct: 404 SGYFTGE-MTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/437 (41%), Positives = 241/437 (55%), Gaps = 31/437 (7%)

Query: 59  SPLFRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRG 118
           SP   +      IP++YIV+F+   +D +   H+  + +     +   D Q+    S   
Sbjct: 41  SPSNIIHHAASPIPNQYIVLFKSDTTDIQRETHLATLNSW----LLNTDPQYTILHS--- 93

Query: 119 ENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASD 178
                              F L   L+GY     E ++  L ++P +  +E+DS V A  
Sbjct: 94  -------------------FQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALG 134

Query: 179 FTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVT-SYVIDTGINIDHVDFEDRAL 237
              Q  +PWGLAR+S RE+L       Y YDD+     T  Y++DTGIN +H +F+ RA 
Sbjct: 135 RQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAK 194

Query: 238 WGKTI-PNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGV 296
           WG    P      D NGHGTHCAG I S  YG            L + G G MS V+RG+
Sbjct: 195 WGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGI 254

Query: 297 EYAVKAHRKAAEKADK-GFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQD 355
           EY  + H +  +K D+ GFKGS  N+SLG G+S             G+HFAVAAGNE+ D
Sbjct: 255 EYVTQQHEQDMKKQDQTGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDD 314

Query: 356 ACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGS-DTAVATLSG 414
           AC+TSPA S  A+TVGAS+ +DDR +FSNWG CVD+FAPG+NI+STYIG  +    +LSG
Sbjct: 315 ACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSG 374

Query: 415 TSMASPHVAGLLTYFLSLQPDGDSEFRNKQT-ISPEVLKKKVIDFGTKDALSSLPARTAN 473
           TSM++P V GL+ YFLSLQPD  S+F    T  +P  LK K+I F T+  L  +P  T N
Sbjct: 375 TSMSAPFVTGLIAYFLSLQPDTKSQFYTGITSPTPYQLKYKIISFSTEGVLHEIPEGTPN 434

Query: 474 VLIYNGGGADLSDFWGN 490
            ++YNGGG  L DFW N
Sbjct: 435 RIVYNGGGHSLKDFWNN 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  308 bits (788), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 179/428 (41%), Positives = 242/428 (56%), Gaps = 25/428 (5%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           IP +YIV+F    +D + +   + + +   E   + +            N+ +    +R 
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNV-----------NDNYSKVLSRF 111

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVG-LLRSNPHVHFVEEDSMVFASDFTTQNGAPWGL 189
           +   + +   G  +R  +  F ED+   +      +  +E DS V  + FTTQ  + WGL
Sbjct: 112 QISNDTK---GMIIRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGL 168

Query: 190 ARVSHREKLNSGSFNKYLYDDN-SGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDAD 248
           +R+S R  L       Y YDDN SG+GV  Y++DTGIN +H++FE RA WG ++P  +  
Sbjct: 169 SRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPS 228

Query: 249 Y-DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAA 307
             D NGHGTHCAG I SKTYG            L   G GSMSDV+ G+E+   +H    
Sbjct: 229 LEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKT 288

Query: 308 EK------ADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSP 361
                       FKGS  N+SLG  +S             GIH  VAAGNE++DAC TSP
Sbjct: 289 NNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSP 348

Query: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIG-SDTAVATLSGTSMASP 420
           A S   ITVGAS+ +DDRA+FSNWG CVD+FAPG+NI STYIG ++    +LSG+SM+SP
Sbjct: 349 ADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSP 408

Query: 421 HVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGG 480
            V+GL  Y+LSLQPD  S+F +   ++P+ LK+K+IDF T   L  LP  TAN L+YNGG
Sbjct: 409 FVSGLTAYYLSLQPDVSSQFHD-SLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGG 467

Query: 481 GADLSDFW 488
           G DLS FW
Sbjct: 468 GKDLSGFW 475

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  297 bits (760), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 208/346 (60%), Gaps = 7/346 (2%)

Query: 137 EFALGEQLRGY-VGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHR 195
           +F + ++L G+ V  F    V  L   P V  VE +S V+A + T Q   PWGL R+S R
Sbjct: 76  QFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQR 135

Query: 196 EKLNSGSFNKYLYDDN-SGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGH 254
           +++  G    Y YD   S + V  Y++DTGI +DH +FE RA WGKTI  ND D D NGH
Sbjct: 136 DRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGH 195

Query: 255 GTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGF 314
           GTHCAG +   TYG            L + G G MSDV+RG+E+AV  H     +     
Sbjct: 196 GTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLT---RNQDEV 252

Query: 315 KGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGAST 374
           +GS  N+SLG G S             G+HFAVAAGNE+ +AC +SPA     +TVG ST
Sbjct: 253 RGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGST 312

Query: 375 LADDRAYFSNWGRCVDLFAPGMNILSTYIG-SDTAVATLSGTSMASPHVAGLLTYFLSLQ 433
            +DDRA+FSNWG C+D+FAPG+N+ S+Y+G +     +LSGTS ++PHVAGL+ Y LSL+
Sbjct: 313 FSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLE 372

Query: 434 PDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNG 479
           PD  S+F    + +P  LK+K++   T+  L  +P  TAN++I+NG
Sbjct: 373 PDTKSQFHTAWS-NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNG 417

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  262 bits (670), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 154/493 (31%), Positives = 251/493 (50%), Gaps = 17/493 (3%)

Query: 1   MKLQRAVWPAVALTTAQALLILPQAEDELVVAEAHRGQLVQWMARENQERKAQGAEQQSP 60
           M+L   +   + + +    ++LP   D   + +    Q      ++++      A   +P
Sbjct: 1   MRLSNIITLVIGIISLSNAIVLP---DINTLEQTSESQEYDNFFKQSKRPGNVKAPLVAP 57

Query: 61  LFRVDDVTRAI-PHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGE 119
           L   D++   I P++YIV+F+      E   H++ V          L     FF  TR  
Sbjct: 58  LGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPNDPFFHHTR-- 115

Query: 120 NNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDF 179
           + EF   +T   GG+   F +G    GYVGYFT+++V  +R    V +VE DS++   D 
Sbjct: 116 DKEF---STEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILTIDDK 172

Query: 180 TTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWG 239
            T + + W LAR+SHR KL   +FN+Y +D N G+ + +Y++DTG+   H  + +R + G
Sbjct: 173 ETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIERTIRG 232

Query: 240 KTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYA 299
             I  N+ + D NGHGT  AG +  +  G            L   G G++S++++G+ + 
Sbjct: 233 IVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKGLSFV 292

Query: 300 VKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNT 359
              H +  EK   G  G+    S+ G +S+            GIH  V AG +  +ACN+
Sbjct: 293 NHHHPQRIEK--NGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGINACNS 350

Query: 360 SPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSD----TAVATLSGT 415
           SPA+S K ITV   ++ D+     NWG CVD++ PG  + +TY   +    T   +++G+
Sbjct: 351 SPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEISVTGS 410

Query: 416 SMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVL 475
           S A+  VAGLL YF SLQP   +   +   ++PE LK+++IDFGTK  L++L   + N++
Sbjct: 411 SAAAAQVAGLLAYFASLQPGLGTP--DVIPLTPEELKERLIDFGTKGKLTNLERMSPNII 468

Query: 476 IYNGGGADLSDFW 488
            +NG G +L  F+
Sbjct: 469 AFNGAGGNLDSFF 481

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  182 bits (463), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 159/320 (49%), Gaps = 38/320 (11%)

Query: 177 SDFTTQNGAPWGLARVSHREKL-----NSGSFNK---YLYDDN-SGEGVTSYVIDTGINI 227
           S F  Q GAP  LAR+S R+KL     N+  F +   Y YDDN  GEGV +YVIDTGI  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 228 DHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTG 287
           +H DFEDR  +G  +    A  D NGHGTH AG I SKTYG            +   G+ 
Sbjct: 342 EHKDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGST 400

Query: 288 SMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAV 347
            +S ++  +EY V       +K     K    NMSLG    +            G+ F V
Sbjct: 401 QLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAEGVVFVV 455

Query: 348 AAGNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYI 403
           AAGN N DAC +SP +S+ AITVGA    DDR    A FSNWG CVD+FA G+ + S   
Sbjct: 456 AAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSS 512

Query: 404 GSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDA 463
                    SGTSMASP V G ++  LS            Q + P  ++++++   TK  
Sbjct: 513 QVPYKYIKYSGTSMASPIVCGFVSILLS------------QGVKPNDVQEEMVKLSTKGD 560

Query: 464 LSS----LPARTANVLIYNG 479
            +         T+N +++NG
Sbjct: 561 FTRRSLIFKPFTSNRILFNG 580

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  175 bits (443), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 163/327 (49%), Gaps = 42/327 (12%)

Query: 181 TQNGAPWGLARVSHREKL-----NSGSFNK---YLYDDN-SGEGVTSYVIDTGINIDHVD 231
            Q GAP  L R+S R +L     N   F +   Y Y+D   G  + +Y++DTGI  +H D
Sbjct: 153 VQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHPD 212

Query: 232 FEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSD 291
           FE+R + G  +   +   D NGHGTH AG + SKT+G            L   G+G+++ 
Sbjct: 213 FENRVIVGADM-TGEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLTT 271

Query: 292 VLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGN 351
           VL G+++AV   R   E      K   ANMSLG  R+             G+   VAAGN
Sbjct: 272 VLSGIQFAVDHCRLMRETQG---KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAGN 328

Query: 352 ENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNI--LSTYIGS 405
            N  AC TSPA+++ AITVGA    DDR    AYFSNWG CVD+FAPG+ I  LS    S
Sbjct: 329 SNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPES 385

Query: 406 DTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALS 465
                T SGTSMASP VAGL    L             + + P  +K K++   TKD  +
Sbjct: 386 HHKHVTHSGTSMASPVVAGLAAILLD------------KGVEPFDVKDKLLHLSTKDVFN 433

Query: 466 SLPAR----TANVLIYNGGGADLSDFW 488
            L       T N + YNG    + DF+
Sbjct: 434 KLTLFFKYGTPNKIAYNG----IEDFF 456

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  174 bits (440), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 191/419 (45%), Gaps = 67/419 (15%)

Query: 94  LVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTE 153
           L++   +ES+       +F +ST+ ++ +        +  I   F  G   R  V     
Sbjct: 23  LIKLKKSESI------QSFLKSTKSQSLQI---KDDIKNHIRERFTFG-AFRALVIDLPN 72

Query: 154 DMVGLLRSNPHVHFV--------------EEDSMVFASDFTTQNGAPWGLARVSHREKLN 199
           DM+  L+ NP +  +                + + ++     Q  AP  L+R+S R +L 
Sbjct: 73  DMIEKLKKNPTISEIIPNLKVNAFANSSTYSELLTYSDKIIIQREAPRHLSRLSRRGQLP 132

Query: 200 ---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250
                      +F+ Y      G  V +Y+IDTGI  +H +FE R  +   +   +   D
Sbjct: 133 YDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEFEGRVKFAIDL-TQEGPGD 191

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310
            NGHGTH AG + SKT+G            L   G G +S +L+ +E+ +   R   E  
Sbjct: 192 ENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTILKALEFTI---RHCKESV 248

Query: 311 DKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITV 370
           DK      AN+S G  R+             GI   VAAGN N DAC  SPA+S+  ITV
Sbjct: 249 DKK---CVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNSNIDACWNSPASSKDVITV 305

Query: 371 GASTLADDR----AYFSNWGRCVDLFAPGMNI--LSTYIGSDTAVATLSGTSMASPHVAG 424
           GA    DDR    A FSNWG CVD+FAPG+ +  LS   GSD  V  LSGTSMASP V+G
Sbjct: 306 GA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD--VLLLSGTSMASPSVSG 360

Query: 425 LLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSS----LPARTANVLIYNG 479
           +    L             + ++P+ +K K+I+  TK+        +   T N++++NG
Sbjct: 361 IAAILLD------------KGLNPKFVKSKIIESSTKNIFHQGTIMIKPNTPNLIVFNG 407

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  173 bits (439), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 132/383 (34%), Positives = 185/383 (48%), Gaps = 63/383 (16%)

Query: 138 FALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFA--------------------- 176
           F++G   +G+    T+D++  ++ NP V  V  +  V A                     
Sbjct: 62  FSIG-SFKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFDNKMQ 120

Query: 177 ---SDFTTQNGAPWGLARVSHREKLNSGSFNK--------YLYDDNS-GEGVTSYVIDTG 224
                   Q GAP  LAR+S R++L     +K        Y YD  S G  V +Y+ID+G
Sbjct: 121 KGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSLKYFYDKRSQGASVNAYIIDSG 180

Query: 225 INIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSN 284
           I ++H +F  RA+ G  +   +   D NGHGTH AG + SK+YG            L   
Sbjct: 181 IYLEHEEFNGRAIPGIDL-TGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEIKVLNRL 239

Query: 285 GTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIH 344
           G GS++ VL G+E+AVK  ++ ++K         AN+SLG  R+             G+ 
Sbjct: 240 GQGSLAMVLGGIEFAVKHCQETSKKGR-----CVANLSLGSMRTAILNKAIKAAIDAGLV 294

Query: 345 FAVAAGNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILS 400
             VAAGN N +AC  SPA++ +AITVGA    DDR    A FSNWG+C+D+FAPG+ I S
Sbjct: 295 VVVAAGNNNLNACWYSPASAPEAITVGA---FDDRIDAIAKFSNWGQCLDIFAPGVVIKS 351

Query: 401 TYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGT 460
             I  D    T SGTSMASP VAGL    L             Q +S E +K  +++ GT
Sbjct: 352 LSIFKDKEDVTYSGTSMASPTVAGLAALTLD------------QGVSAEEVKDYILEMGT 399

Query: 461 KDAL--SSLPAR--TANVLIYNG 479
            +     SL  +  T N + +NG
Sbjct: 400 DNVFHRRSLLFKPGTPNKICFNG 422

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  171 bits (433), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 137/416 (32%), Positives = 193/416 (46%), Gaps = 59/416 (14%)

Query: 132 GGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMV--FASD----------F 179
           G I   F +GE L+G     + D++  ++ +P V  V  + MV  F  D           
Sbjct: 50  GKINKRFQIGE-LKGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKAFEGDAVEDESWLPKM 108

Query: 180 TTQNGAPWGLARVSHREKLNSGSFNKYLYDDN---------SGEGVTSYVIDTGINIDHV 230
             Q GAP  LAR+S R +L     NK  Y D+          G    +Y++DTG+  DH 
Sbjct: 109 KRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYYDRWAQGATTRAYILDTGVMRDHK 168

Query: 231 DFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMS 290
           +FEDR  +G T    + + D NGHGTH AG + SKT+G            L + G G++ 
Sbjct: 169 EFEDRVEFG-TDCTGEGEGDLNGHGTHVAGLVGSKTFGVAKHVQLVDVKCLDALGAGTLV 227

Query: 291 DVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAG 350
            +L  +E+AV+  ++  +           NMSLG  +S             GI   VAAG
Sbjct: 228 SILSALEFAVQDCQEHEDSQ------CVLNMSLGSVKSNILNQAINEVEKKGIVVVVAAG 281

Query: 351 NENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYIGSD 406
           N N +AC TSP+++  AITVGA    DDR    A FSNWG CVD+FAPG+N+ S      
Sbjct: 282 NFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCVDIFAPGVNVASLVNRDW 338

Query: 407 TAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSS 466
            +    SGTSMASP V G++   L    DG         + PE ++  + +  T      
Sbjct: 339 PSFVKYSGTSMASPIVCGMVALLLD---DG---------VPPEDIRDYLQELATDGVFKK 386

Query: 467 LPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELES 522
              RT   L++  G  +   + GNK          Y DD +    +LD L+ ELE+
Sbjct: 387 ---RT---LVFKPGTPNSVLYNGNKKHDDE-----YEDDLQYPQVELDDLVQELEN 431

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  170 bits (430), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 150/288 (52%), Gaps = 30/288 (10%)

Query: 163 PHVHFVEEDSMVFAS-DFTT-----QNGAPWGLARVSHREKLN----------SGSFNKY 206
           P++ FV  D   F   +F +     Q GAP  L+R+S R +L            GSFN Y
Sbjct: 89  PNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEEDDNYEGSFNYY 148

Query: 207 LYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKT 266
             + + G+G+ +Y+IDTGI  +H +F  RA++G+ +   +   DGNGHGTH AG + S  
Sbjct: 149 YDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDL-TGEGPGDGNGHGTHVAGIVGSSK 207

Query: 267 YGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGG 326
           YG            L + G G+++ V+  +E+AV  H +++E      KG   N+SLG  
Sbjct: 208 YGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVN-HCRSSEG-----KGCVINLSLGAI 261

Query: 327 RSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDR----AYF 382
           R+             GI   VAAGN N +AC  SPA++ +AITVGA    DDR    A F
Sbjct: 262 RNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITVGA---FDDRTDSIAKF 318

Query: 383 SNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430
           SNWG CVD+FAPG+ + S            SGTSMASP + GL    L
Sbjct: 319 SNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAILL 366

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  169 bits (427), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 146/463 (31%), Positives = 208/463 (44%), Gaps = 77/463 (16%)

Query: 92  MELVEAAHAES-VARLDEQHA---FFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGY 147
           + LVE  +AE  + RL    +   F  S  G+ +     +TR    I   F+ G +  G+
Sbjct: 10  LLLVEIINAEEYLVRLKSPKSLTKFMESKIGDMSLKSFVSTR----ISKTFSFG-KFEGF 64

Query: 148 VGYFTEDMVGLLRSNPHVHFVEEDSMV------------FASDFTTQNGAPWGLARVSHR 195
              F +D V  L+ NP V  V  +S+             ++  +  Q  AP  LAR+S R
Sbjct: 65  TADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLARLSRR 124

Query: 196 EKLNSGS-------FNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWG-KTIPNNDA 247
             L           FN Y    + G+ V +Y+IDTGI   H D   RA +G   +     
Sbjct: 125 GPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMVGEGPG 184

Query: 248 DYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAA 307
           DY  NGHGTH AG + S+T+G            L + G G+++ V+  +E++V   +K+ 
Sbjct: 185 DY--NGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEFSVNHCKKSG 242

Query: 308 EKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKA 367
                      AN+SLG  R+             G+   VAAGN N +AC  SPA++  A
Sbjct: 243 MLC-------VANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASAISA 295

Query: 368 ITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVA 423
           ITVGA    DDR    A FSNWG CVD+FA G+ ++S            SGTSMASP VA
Sbjct: 296 ITVGA---FDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVA 352

Query: 424 GLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGAD 483
           GL    L               I P  +K+K+ID  T++       RT   L++  G  +
Sbjct: 353 GLAAVLLD------------SGIDPPDIKQKIIDLATENVFQK---RT---LVFKPGTPN 394

Query: 484 LSDFWGNKPKKVSGPKFTYADD--EEAMGS--DLDRLIHELES 522
              F G + +          DD  EEA+    D++ L+ ELE+
Sbjct: 395 RIAFNGVRKE----------DDIFEEAVYPVVDINELVKELEN 427

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  169 bits (429), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/385 (32%), Positives = 181/385 (47%), Gaps = 56/385 (14%)

Query: 134 IEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFV------------EEDSMVF------ 175
           IE +F++G   RG     ++++V  L+ +P +  +             E S +F      
Sbjct: 89  IEKKFSIG-SFRGVTMNLSKNLVNKLKKSPLIADIVPNFKFEAFDTDAELSYMFNTTAKY 147

Query: 176 -------ASDFTTQNGAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSY 219
                  A + T Q  AP  LAR+S   +L             FN Y  D+  G+GV +Y
Sbjct: 148 AYQDIDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAY 207

Query: 220 VIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXX 279
           ++DTGI+ +H +FEDR + G  +   +   D NGHGTH AG + S+T+G           
Sbjct: 208 IMDTGIHAEHPEFEDRVIQGVDL-TKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVK 266

Query: 280 XLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXX 339
            L  +G+G  S+VL G+E+ V+   K +    K      AN+SLG  RS           
Sbjct: 267 VLGKDGSGEASNVLSGLEFIVEHCTKVSRPQGKK---CVANLSLGSFRSPIINMAVEGAI 323

Query: 340 XXGIHFAVAAGNENQDACNTSPAASQKAITVGA-STLADDRAYFSNWGRCVDLFAPGMNI 398
             GI F  AAGN N DA   SPA+++  ITVGA     D  A FSNWG CV++FAPG+ I
Sbjct: 324 EEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEI 383

Query: 399 LSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDF 458
            S    +D     LSGTSM++P V G+    LS            + I PE++ +++   
Sbjct: 384 ESLSHLNDNESLVLSGTSMSTPIVTGVAAVLLS------------KGIEPELIAQEIEYL 431

Query: 459 GTKDALSS----LPARTANVLIYNG 479
            T++            T N ++YNG
Sbjct: 432 STRNVFHRRTLFFKPSTPNQILYNG 456

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  167 bits (424), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 119/346 (34%), Positives = 167/346 (48%), Gaps = 41/346 (11%)

Query: 153 EDMVGL--LRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLN---------SG 201
           +D++G+  L+ N H   ++++          Q  AP  LAR+S R  L            
Sbjct: 95  DDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEE 154

Query: 202 SFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGT 261
           SFN Y Y  + G  + +Y+IDTGI  +H DF  RA++G+     +   D NGHGTH AG 
Sbjct: 155 SFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGI 213

Query: 262 IASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANM 321
           + S  +G            L + G G+++ V+  VE+AV  H K++ K     KG  AN+
Sbjct: 214 VGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISAVEFAVN-HCKSSGK-----KGCVANL 267

Query: 322 SLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDR-- 379
           SLG  R+             G+   VAAGN N +AC  SPA++ +AITVGA    DDR  
Sbjct: 268 SLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNINACWNSPASAPEAITVGA---FDDRTD 324

Query: 380 --AYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGD 437
             A FSNWG CVD+FA G+ + S            SGTSMASP V GL+   L       
Sbjct: 325 TIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIAFSGTSMASPSVTGLVAILLD------ 378

Query: 438 SEFRNKQTISPEVLKKKVIDFGTKDALSS----LPARTANVLIYNG 479
                 + + PE +K K+++  T D L          T N + +NG
Sbjct: 379 ------KGVEPENIKAKLVELATHDLLQRRTLFFKPGTPNRIAFNG 418

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  166 bits (420), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 138/432 (31%), Positives = 195/432 (45%), Gaps = 68/432 (15%)

Query: 94  LVEAAHAES-VARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFT 152
           LV  A+AE  + R     AF + T   N  +       +  IE +F++G   RG     +
Sbjct: 11  LVNLAYAEEYLVRFKNPTAFQQFTSNSNRSW---RQFIDNKIEKKFSIG-SFRGVTMNLS 66

Query: 153 EDMVGLLRSNPHVHFV----------------EEDSMVFAS-------------DFTTQN 183
           +++V  L+ +P V  +                 E S  F +             + T Q 
Sbjct: 67  KNLVNKLKKSPLVADIVPNFRFEAFEGDSVNSAESSYTFNATAKYSYEDVEEEQNITYQP 126

Query: 184 GAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFED 234
            AP  LAR+S   +L             FN Y   D  G+ V +Y++DTGI  DH +FED
Sbjct: 127 DAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEFED 186

Query: 235 RALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLR 294
           R + G  +   +   D NGHGTH AG + SKTYG            L  +G+G  S+VL 
Sbjct: 187 RVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNVLS 245

Query: 295 GVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQ 354
           G+E+ V+   K +       K   AN+SLG  RS             GI F  AAGN N 
Sbjct: 246 GLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNL 302

Query: 355 DACNTSPAASQKAITVGA-STLADDRAYFSNWGRCVDLFAPGMNI--LSTYIGSDTAVAT 411
           DA   SPA+++  ITVGA     D  A FSNWG CV++FAPG+ I  LS    +DT +  
Sbjct: 303 DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLI-- 360

Query: 412 LSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSS----L 467
           LSGTSM++P V G+    LS            + I PE++ +++    T++         
Sbjct: 361 LSGTSMSTPIVTGVAAILLS------------KGIEPEMIAQEIEYLSTRNVFHRRTLFF 408

Query: 468 PARTANVLIYNG 479
              T N ++YNG
Sbjct: 409 KPSTPNQILYNG 420

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  165 bits (418), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 139/432 (32%), Positives = 197/432 (45%), Gaps = 68/432 (15%)

Query: 94  LVEAAHAES-VARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFT 152
           LV   +AE  + R     AF + T   N  +       +  IE +F++G   RG     +
Sbjct: 11  LVNLVYAEEYLVRFKNPTAFQQFTSNSNRSW---RQFIDNKIEKKFSIG-SFRGVTMNLS 66

Query: 153 EDMVGLLRSNPHVHFV---------EEDS-------MVFAS-------------DFTTQN 183
           +++V  L+ +P V  +         E DS         F +             + T Q+
Sbjct: 67  KNLVNKLKKSPLVADIVPNFRFEAFENDSARDVEYNYTFNATAKYSYENLDEEQNITYQS 126

Query: 184 GAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFED 234
            AP  LAR+S   +L             FN Y  DD  G+ V +Y++DTGI  DH +FED
Sbjct: 127 DAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEFED 186

Query: 235 RALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLR 294
           R + G  +   +   D NGHGTH AG + SKTYG            L  +G+G  S+VL 
Sbjct: 187 RVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNVLS 245

Query: 295 GVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQ 354
           G+E+ V+   + +    K      AN+SLG  RS             GI F  AAGN N 
Sbjct: 246 GLEFIVEHCTRVSRPQGKK---CVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNL 302

Query: 355 DACNTSPAASQKAITVGA-STLADDRAYFSNWGRCVDLFAPGMNI--LSTYIGSDTAVAT 411
           DA   SPA+++  ITVGA     D  A FSNWG CV++FAPG+ I  LS    +DT V  
Sbjct: 303 DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTLV-- 360

Query: 412 LSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSS----L 467
           LSGTSM++P V G+    LS            + I PE++ +++    T++         
Sbjct: 361 LSGTSMSTPIVTGVAAVLLS------------KGIEPEMIAQELEYLSTRNVFHRRTLFF 408

Query: 468 PARTANVLIYNG 479
              T N ++YNG
Sbjct: 409 KPSTPNQILYNG 420

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  166 bits (420), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 138/433 (31%), Positives = 197/433 (45%), Gaps = 70/433 (16%)

Query: 94  LVEAAHAES-VARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFT 152
           LV  A+AE  + R     AF + T   N  +       +  IE +F++G   RG     +
Sbjct: 60  LVNLAYAEEYLVRFKNPTAFQQFTSNSNRSW---RQFIDNKIEKKFSIG-SFRGVTMNLS 115

Query: 153 EDMVGLLRSNPHV------------------------------HFVEEDSMVFASDFTTQ 182
           +++V  L+ +P V                               ++ ED +  A + T Q
Sbjct: 116 KNLVNKLKKSPLVADIVPNFRFEAFENDGTNDAELNYTFNATAKYLYED-IDEAQNITYQ 174

Query: 183 NGAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFE 233
           + AP  LAR+S   +L             FN Y  DD  G+ V +Y++DTGI  DH +FE
Sbjct: 175 SDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEFE 234

Query: 234 DRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVL 293
           DR + G  +   +   D NGHGTH AG + SKTYG            L  +G+G  S+VL
Sbjct: 235 DRVIQGIDL-TKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASNVL 293

Query: 294 RGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNEN 353
            G+E+ V+   + +       K   AN+SLG  RS             GI F  AAGN N
Sbjct: 294 SGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFN 350

Query: 354 QDACNTSPAASQKAITVGA-STLADDRAYFSNWGRCVDLFAPGMNI--LSTYIGSDTAVA 410
            DA   SPA+++  ITVGA     D  A FSNWG CV++FAPG+ I  LS     DT + 
Sbjct: 351 LDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYEDTLI- 409

Query: 411 TLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSS---- 466
            LSGTSM++P V G+    LS            + I P ++ +++    T++        
Sbjct: 410 -LSGTSMSTPIVTGVAAVLLS------------KGIEPALIAQEIEYLSTRNVFHRRTLF 456

Query: 467 LPARTANVLIYNG 479
               TAN ++YNG
Sbjct: 457 FKPSTANQILYNG 469

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  163 bits (412), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 125/361 (34%), Positives = 170/361 (47%), Gaps = 56/361 (15%)

Query: 179 FTTQNGAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDH 229
              Q  AP  LAR+S R  L          + +F+ Y  D+ SG  V +YVIDTGI  +H
Sbjct: 132 IVAQKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEH 191

Query: 230 VDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSM 289
              E RA +G  +   +   D NGHGTH AG I S+ +G            L + G G++
Sbjct: 192 PQLEGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNL 250

Query: 290 SDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAA 349
           + V+  +E+ V   RK+        +G  AN+SLG  R+             G+   VAA
Sbjct: 251 TSVISAIEFTVNHCRKSR-------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAA 303

Query: 350 GNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYIGS 405
           GN N +AC +SPA+S  AITVGA    DDR    A FSNWG CVD+FAPG+ I S     
Sbjct: 304 GNSNANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVP 360

Query: 406 DTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALS 465
                  SGTSMASP V+G++   L               I P  +K ++ID  T    S
Sbjct: 361 PFKPVAFSGTSMASPIVSGMVANLLD------------SGIHPFDIKTELIDLATD---S 405

Query: 466 SLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADD--EEAM--GSDLDRLIHELE 521
               RT   L++  G           P +V+       DD  E+A+    D+DRL+ +L+
Sbjct: 406 VFHKRT---LLFKPG----------TPNRVAFTGIDKTDDVYEDAVYPSVDIDRLVKDLQ 452

Query: 522 S 522
           S
Sbjct: 453 S 453

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  163 bits (413), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 163/315 (51%), Gaps = 41/315 (13%)

Query: 182 QNGAPWGLARVSHREKL---NSGS----FNKYLYDDNSGEGVTSYVIDTGINIDHVDFED 234
           Q+GAP  LAR   R  L    SGS    FN Y   ++ GE V  Y++D+GI+  H +FE 
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 235 RALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLR 294
           RA++G     N+   D NGHGTH AG + SKTYG            +  +G GS S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 295 GVEYAVKAHRKAAEKADKGFKGSTANMSLGG---GRSQXXXXXXXXXXXXGIHFAVAAGN 351
           GVE+AVK  +++ +K         ANMSLGG   G S             G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSGKKC-------VANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 352 ENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYIGSDT 407
             + AC  SPA  + AITVGA    DDR    A FSN+G+CVD+FAPG+ + S       
Sbjct: 441 SKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYN 497

Query: 408 AVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALSS- 466
            V  L+GTSM++P  AG++   L             Q +  E +K+++ID  TK      
Sbjct: 498 TVRVLNGTSMSAPITAGVVAVLLD------------QGVKHEDVKERLIDLSTKGVFHRR 545

Query: 467 --LPARTANVLIYNG 479
             + +RT +  ++NG
Sbjct: 546 RLVSSRTPDRTLFNG 560

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  158 bits (400), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 120/346 (34%), Positives = 155/346 (44%), Gaps = 58/346 (16%)

Query: 181 TQNGAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDHVD 231
           TQ+ AP  LAR+S R +L             FN Y Y  + G  V +YV+D+G+ IDH D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 232 FEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSD 291
           FE RA +G     +    D NGHGTH AG I SKTYG            L S G+G++  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 292 VLRGVEYAVKAH-------------------RKAAEKADKGFKGSTANMSLGGGRSQXXX 332
           V+ G+E+ V  H                    + +   D   K    N+SLG  RS    
Sbjct: 279 VMSGLEF-VSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIIN 337

Query: 333 XXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRC 388
                    GI   VAAGN N +AC TSPA+    ITVGA    DDR    A FSNWG C
Sbjct: 338 EAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNC 394

Query: 389 VDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISP 448
           VD+FAPG+ + S            +GTSMA+P V GL+   L               I P
Sbjct: 395 VDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD------------SGIKP 442

Query: 449 EVLKKKVIDFGTKDALSSLPAR-------TANVLIYNGGGADLSDF 487
             +KK++ +  T +     P R       T N + +NG   D  D+
Sbjct: 443 TQIKKRLNELATDNI---FPRRTLLFKPGTPNRIAFNGVKRDDDDY 485

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  156 bits (394), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 145/460 (31%), Positives = 196/460 (42%), Gaps = 78/460 (16%)

Query: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130
           I H  I VF+     E  A H  LV   +++S+       +F  ST        +     
Sbjct: 5   ILHSVIFVFQLI---EFTAAHEYLVSLKNSDSI------QSFMDSTYAHGQ---LMKDYL 52

Query: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDF----------- 179
            G I   F+ G   RG     T+D+V  ++ NP V  V  +  + A D+           
Sbjct: 53  HGKISKTFSFG-SFRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDD 111

Query: 180 ---------------TTQNGAPWGLARVSHREKLNSGSFNKYLYDD---------NSGEG 215
                            QNGAP  LAR+S R  L     +K  Y+D         + G  
Sbjct: 112 IKQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTD 171

Query: 216 VTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXX 275
           V +Y+ID+GI+I+  +FE RA  G  +   +   D NGHGTH AG + SKTYG       
Sbjct: 172 VNAYIIDSGIDINQEEFEGRATHGLDL-TGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTL 230

Query: 276 XXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXX 335
                L   G+GS+  V+  +E+ V    K+  K         AN+SLG           
Sbjct: 231 VEVKALDRQGSGSLITVISALEFVVNHCGKSKSKK------CVANLSLGAFMMPLLNEAI 284

Query: 336 XXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDL 391
                 G+   VAAGN N DAC  SPA+ + AITVGA    DDR    A FSNWG CVD+
Sbjct: 285 KATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGA---FDDRIDTIAKFSNWGSCVDI 341

Query: 392 FAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVL 451
           FAPG+ I S  I  +      SGTSMASP VAG+++  L             Q +  E +
Sbjct: 342 FAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILLD------------QGVENEDI 389

Query: 452 KKKVIDFGTKDALSS----LPARTANVLIYNGGGADLSDF 487
           +  + +  T D           RT N + +NG      DF
Sbjct: 390 RDYLFELATDDVFQKRTLLFKPRTPNRITFNGISKKDEDF 429

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  156 bits (394), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 140/443 (31%), Positives = 193/443 (43%), Gaps = 90/443 (20%)

Query: 130 AEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFV-----------EEDSMVFA-- 176
           ++G I   F+ G +  G+   F   ++  LR+NP V  +           EED   +   
Sbjct: 49  SQGKILKTFSFG-KFEGFTVDFPLSLISKLRNNPLVAEIVPNVEFNVFDGEEDPSYWDDD 107

Query: 177 --------------------SDFTTQNGAPWGLARVSHREKLNSGSFN--------KYLY 208
                                DF  Q  AP  LAR+S R  L     N         Y Y
Sbjct: 108 NGDDEYDEDEDEDDEDNSEFPDFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYY 167

Query: 209 DDN-SGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTY 267
           DD+  G  V +YVIDTGI  +H  F+ RA +G  +   +   D NGHGTH AG I S+ Y
Sbjct: 168 DDSFPGTCVNAYVIDTGIFKEHRQFQGRAKFGADLVG-EGPGDLNGHGTHVAGLIGSQKY 226

Query: 268 GXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGR 327
           G            L + G G+++ V+  +E+ V   RK+        +G  AN+SLG  R
Sbjct: 227 GVAKDVSLIEVKALNAKGQGNLTSVISAIEFTVNHCRKSK-------RGCVANLSLGSFR 279

Query: 328 SQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDR----AYFS 383
           +             G+   VAAGN N +AC +SPA+S  AI+VGA    DDR    A FS
Sbjct: 280 NSVLNQAVEAALEAGVVVVVAAGNSNANACWSSPASSLSAISVGA---FDDRTDTIARFS 336

Query: 384 NWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNK 443
           NWG CVDLFAPG+ I S            SGTSMASP V G++   L             
Sbjct: 337 NWGNCVDLFAPGVKIASLSNIPPFKSVAYSGTSMASPLVTGMVAVLLD------------ 384

Query: 444 QTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYA 503
             I P  +K+++I+  T              L++  G           P +V+       
Sbjct: 385 SGIHPFDIKEELINTATDSVFHK------RALLFKPG----------TPNRVAFTGVEKE 428

Query: 504 DD--EEAM--GSDLDRLIHELES 522
           DD  E+A+  G D+D+L+ +LES
Sbjct: 429 DDIFEDAVYPGVDIDQLVKDLES 451

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  153 bits (386), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 109/314 (34%), Positives = 155/314 (49%), Gaps = 33/314 (10%)

Query: 180 TTQNGAPWGLARVSHREKLN---------SGSFNKYLYDDNSGEGVTSYVIDTGINIDHV 230
             Q+ AP  LAR+S R+KL            SFN Y   ++ G  V +Y++D+G++ +  
Sbjct: 117 VVQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLT 176

Query: 231 DFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMS 290
           DFE R  +G      D + D NGHGTH AG + SKTYG            L   G G++ 
Sbjct: 177 DFEGRVEFGFDF-TGDGEGDSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLI 235

Query: 291 DVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAG 350
            VL  +E+AV    +  EK         AN+SLG  ++             G+   VAAG
Sbjct: 236 TVLSAIEFAVNDCHEHPEKR------CVANLSLGSFKNAIINKAIQAATEDGVVMVVAAG 289

Query: 351 NENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYIGSD 406
           N N +AC TSPA++++AITVGA    DDR    A FSNWG CVD++APG+ + S      
Sbjct: 290 NFNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPM 346

Query: 407 TAVATLSGTSMASPHVAGLLTYFLSL-QPDGDSEFRNKQTISPEVLKKKVIDFGTKDALS 465
               + SGTSMASP V G +   L    P+ D +    +  + +V +K+ + F       
Sbjct: 347 VKNISYSGTSMASPIVCGQVAILLDKGIPNDDIKSTLIKMATDDVFQKRTLLF------- 399

Query: 466 SLPARTANVLIYNG 479
                T N +++NG
Sbjct: 400 --KPNTPNRVLFNG 411

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  152 bits (384), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 166/328 (50%), Gaps = 38/328 (11%)

Query: 175 FASDFTTQNGAPWGLARVSHR------EKLNSGSFNKYLY-DDNSGEGVTSYVIDTGINI 227
           F+ DF +Q+ AP  LAR+S R      EK ++ S  KY Y +++ GEGV  YV+D+G+N 
Sbjct: 147 FSDDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNH 206

Query: 228 DHVDFEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTG 287
           DH DFE RA+ G      +   D  GHGTH AG I SKTYG            L S G G
Sbjct: 207 DHPDFEGRAMKGIDT-TGEGSGDLVGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKG 265

Query: 288 SMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGG-GRSQXXXXXXXXXXXXGIHFA 346
           ++++++ G+EY V        K          NMSLG  G               G+   
Sbjct: 266 TVTNIIEGLEYVVNQCIGKKRKC-------VINMSLGAPGTHSILDKAVSAVIEEGVVVV 318

Query: 347 VAAGNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILS-T 401
           VA GN   +AC  SPA  +KAITV A    DDR    A FSNWG C+D++APG+N+ S +
Sbjct: 319 VAGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS 375

Query: 402 YIGSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRN--KQTISPEVLKKKVIDFG 459
             G  T V  LSGTSMASP VAG    +L    D  +E R    +T +  V KK+ I   
Sbjct: 376 NKGRGTFV--LSGTSMASPIVAGAAAIYLDQGAD-PAEVRKILSKTATRGVFKKRAI--- 429

Query: 460 TKDALSSLPARTANVLIYNGGGADLSDF 487
                 ++  RT N ++Y G   +  +F
Sbjct: 430 ------AVRPRTPNKVLYTGNNQEDDEF 451

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  153 bits (387), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/318 (37%), Positives = 159/318 (50%), Gaps = 42/318 (13%)

Query: 182 QNGAPWGLARVSHREKL-----NSGSFNKYL--YDDNSGEGVTS--YVIDTGINIDHVDF 232
           Q GAP  L ++S R +L     +   F +++  Y D   +G  S  Y+IDTG+  +H +F
Sbjct: 150 QFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHKEF 209

Query: 233 EDRALWG-KTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSD 291
            +R  +G   I     DY  NGHGTH AG I SKT+G            L   G G+++ 
Sbjct: 210 GNRVHFGGDFIGEGKGDY--NGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLTS 267

Query: 292 VLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGN 351
           VL G+E+AV   +   +      K    NMSLG  R+             GI   VAAGN
Sbjct: 268 VLEGIEFAVNNCKLKQQPMG---KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAGN 324

Query: 352 ENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNI--LSTYIGS 405
            N  AC TSPA+S  AITVGA    DDR    A FSNWG+CVD+FAPG+ I  LS  +  
Sbjct: 325 NNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLE 381

Query: 406 DTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDALS 465
           +  +   SGTSMASP VAGL+   +            ++    + +K+K+ID  +K   S
Sbjct: 382 NGVIH--SGTSMASPIVAGLVAILM------------EKGYKCDEIKQKLIDDSSKSIFS 427

Query: 466 SLPAR----TANVLIYNG 479
            L       T N +IYNG
Sbjct: 428 KLTLFFKYGTPNRVIYNG 445

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  150 bits (380), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/358 (32%), Positives = 173/358 (48%), Gaps = 52/358 (14%)

Query: 179 FTTQNGAPWGLARVSHREKLN---SG----SFNKYLYDDNSGEGVTSYVIDTGINIDHVD 231
           +  Q  AP  LAR   R  L    SG    +FN Y  +++ GEGV  YV+D+GI   H +
Sbjct: 425 YAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHPE 484

Query: 232 FEDRALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSD 291
           F+ RA +G      +   D NGHGTH AG + S+T+G            +  +G GS S+
Sbjct: 485 FDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTSN 543

Query: 292 VLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGG---GRSQXXXXXXXXXXXXGIHFAVA 348
           ++ GVE+AVK  +++ ++         ANMSLGG   G S             G+ F VA
Sbjct: 544 IIAGVEFAVKHCQQSGKRC-------VANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVA 595

Query: 349 AGNENQDACNTSPAASQKAITVGASTLADDR----AYFSNWGRCVDLFAPGMNILSTYIG 404
           AGN  + AC  SPA  + AITVGA    DDR    A FSN+G+CVD+FAPG+ + S    
Sbjct: 596 AGNSKERACWYSPAKVKTAITVGA---FDDRSDIIASFSNYGKCVDIFAPGVAVASLSNS 652

Query: 405 SDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDAL 464
               +  L+GTSM++P  AG++   L             Q I P  +K  ++   TK   
Sbjct: 653 PSNTMRVLNGTSMSAPITAGVVAVLLD------------QGIEPHEVKDHLLSISTKGLF 700

Query: 465 SS---LPARTANVLIYNGGGADLSDFWGNKPKKVSGPKFTYADDE---EAMGSDLDRL 516
                + +RT +  ++ G   +   F        S  KF + ++E   + +G DL ++
Sbjct: 701 HKRRLVSSRTPDRALFTGVKREDDSF--------STEKFPFVNEEAYLKFIGDDLKKV 750

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  135 bits (340), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 143/307 (46%), Gaps = 29/307 (9%)

Query: 179 FTTQNGAPWGLARVSHREKLNSGS---FNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDR 235
           ++TQ  AP  L+R S   KL + S   +N Y   D  G  VT YV+D+GI +DH +FE R
Sbjct: 142 YSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEGR 201

Query: 236 ALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRG 295
            L      ++    D  GHGT  AG I SKTYG            L + G G++  +L+G
Sbjct: 202 ILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQG 260

Query: 296 VEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQD 355
           +++  K      E+   G      N SLG    Q            GI    AAGN   +
Sbjct: 261 LQFITKH----CEENTNG--NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAVN 314

Query: 356 ACNTSPAASQKAITVGASTLADDR-AYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSG 414
           AC  +PA S+   TVG+    DD  A FSNWGRCVD+ APG+ + +    +       SG
Sbjct: 315 ACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESSG 374

Query: 415 TSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEVLKKKVIDFGTKDAL-----SSLPA 469
           TS+++P V GL    LS            + +  E L  ++   G++D L     S LP 
Sbjct: 375 TSVSTPIVTGLAAILLS------------KGVPKENLYDEIRKMGSRDLLRNKEFSRLPG 422

Query: 470 RTANVLI 476
            T N+++
Sbjct: 423 -TPNLIV 428

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  125 bits (315), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 148/310 (47%), Gaps = 12/310 (3%)

Query: 127 ATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAP 186
           A  ++ G  G  +LG   R   G F + ++  L  +  +  +  D ++  +++  Q  AP
Sbjct: 38  AQMSDNGGVGAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAP 97

Query: 187 WGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNND 246
             LAR+S +  L  GS   Y+Y  N G GV  Y++DTGI+  H + E R      + +N 
Sbjct: 98  AHLARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNP 156

Query: 247 ADY-DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRK 305
             + D +GHGT  AG I S T+G              S G  ++  V+R +E+A K    
Sbjct: 157 VSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASV 216

Query: 306 AAEKADKGFKGST-ANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAAS 364
               +      +   N+ L                   +   VA GN NQ+AC++SPA++
Sbjct: 217 TQRPSVVVIPFTMRKNVILN-------SAIEAVIRDQSLPVVVAGGNFNQNACDSSPASA 269

Query: 365 QKAITVGA--STLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHV 422
             A+T+G+   T  D  A F+N+G C+D FA G+NI S   G   +    SGTS+++   
Sbjct: 270 YGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIA 329

Query: 423 AGLLTYFLSL 432
           +G++ Y++SL
Sbjct: 330 SGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  125 bits (314), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 154/315 (48%), Gaps = 18/315 (5%)

Query: 126 AATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGA 185
           AAT A GG+ G   LG   R   G F + ++     +  +  +  D  +  +++  Q  A
Sbjct: 38  AATVAGGGV-GAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHA 96

Query: 186 PWGLARVSHREKLNSGSFN---KYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTI 242
           P  LAR+S +  L  G+ +    Y+Y  N+G GV  Y++DTGI+  H  FE R       
Sbjct: 97  PNHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADF 156

Query: 243 PNND-ADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVK 301
            ++  A  D +GHGT  AG I S  +G              S G  S+  VLR +E+A K
Sbjct: 157 SSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASK 216

Query: 302 AHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXX-XGIHFAVAAGNENQDACNTS 360
               A  K     + S   + L   R+               I   VAAGNEN+ AC+ S
Sbjct: 217 --LAAVTK-----RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVS 269

Query: 361 PAASQKAITVGASTLA--DDRAYFSNWGRCVDLFAPGMNILSTYIGSD-TAVATLSGTSM 417
           PA +  A+T+G+  +A  D  A F+N+  CVDLF  G+++ +  +G D ++   LSGTS+
Sbjct: 270 PAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSI 327

Query: 418 ASPHVAGLLTYFLSL 432
           ++   +GL+ Y++S+
Sbjct: 328 SAGVASGLVAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  115 bits (289), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 88/311 (28%), Positives = 153/311 (49%), Gaps = 24/311 (7%)

Query: 137 EFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSH-- 194
           +  +G    G+ G F ++++  L  +P V  +  D M++  ++  QN AP  LAR+S+  
Sbjct: 54  KIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNGV 113

Query: 195 -REKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADY---D 250
              ++++ + N +++  ++G GV  Y++D+GI+  H  F +R +  K I   D      D
Sbjct: 114 SNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVGD 172

Query: 251 GNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTG-SMSDVLRGVEYAVKAHRKAAEK 309
            +GHGT  AG + S T+G            + +   G  +S +L+ +E+ ++ H +A   
Sbjct: 173 PHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEF-IENHSRAT-- 229

Query: 310 ADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAA---SQK 366
                + S A +     +               I   V AGN++  ACN SPA+   SQ 
Sbjct: 230 ----MRPSVAVLPFSMSK-NAILNSAIESMPNSIAIVVPAGNQHHMACNFSPASARNSQS 284

Query: 367 AITVGASTL--ADDRAYFSNWGRCVDLFAPG--MNILSTYIGSD-TAVATLSGTSMASPH 421
            ++VG+     + + A FSN+G CVD+F  G  M+ L     SD   ++ +SGTSM+   
Sbjct: 285 ILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCAI 344

Query: 422 VAGLLTYFLSL 432
            AG + Y++SL
Sbjct: 345 AAGTVGYYMSL 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 99.0 bits (245), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 145/321 (45%), Gaps = 36/321 (11%)

Query: 138 FALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREK 197
             +G+Q +   G F+ + +  L  +  V  +  D  +   ++  Q G+P  L+++S    
Sbjct: 47  ITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLS---- 102

Query: 198 LNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADY-------- 249
            + GSF    +D  SG  V  YV DTGI+  H   ++        P+  AD+        
Sbjct: 103 -SGGSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQN------VNPHKLADFTSSPVPRG 152

Query: 250 -DGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAE 308
            D +GHGT  AG IAS+T+G               +G   +S +++G+  +V AH +  +
Sbjct: 153 ADPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGISASV-AHARFTK 211

Query: 309 KADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPAASQKAI 368
           +       S   + +  G+               I   + AGN+  DAC+ SP      +
Sbjct: 212 RP------SVFVLPMTIGKKNHILDNFLQAIPKDIAIVLPAGNQQTDACDLSPPNDHNIL 265

Query: 369 TVGASTLADDRAYFSNWGRCVDLFAPGMNIL---STYIGSDTAVATLSGTSMASPHVAGL 425
            +G+    +  A FSN+G CVD++  G +IL   ST  G++  + + +GTS +    AG+
Sbjct: 266 VIGSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGI 325

Query: 426 LTYFLSLQPDGDSEFRNKQTI 446
           + Y +S+   G +  +  QTI
Sbjct: 326 VGYHMSM---GLTSMQAIQTI 343

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score = 96.3 bits (238), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 151/356 (42%), Gaps = 34/356 (9%)

Query: 94  LVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRAEGGIEGEFALGEQLRGYVGYFTE 153
           L  A  A+ V +L ++ A         N + +++ +    I   F LG   R + G F+ 
Sbjct: 9   LSTALAAQFVVQLQDKTAL----NAVLNSYALSSDQQGPEITDIFELGS-FRAFTGDFSG 63

Query: 154 DMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLYDDNSG 213
            ++  L ++P+V  +  D  +   +   QN AP  L  +S    L   S   ++Y  N G
Sbjct: 64  PILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL---SHQPFIYRSNGG 120

Query: 214 EGVTSYVIDTGINIDHVDFEDRA------LWGKTIPNNDADYDGNGHGTHCAGTIASKTY 267
            GV  Y++DTGI+I H +           L    +P      D  GHGT  AG IAS+T+
Sbjct: 121 NGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSPVPQGT---DPQGHGTAMAGIIASETF 177

Query: 268 GXXXXXXXXXXXXLRSNGTGSMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGR 327
           G              SNG   +S +L+ +    + H +  ++           + +  G 
Sbjct: 178 GVLKKCNLVDVRVADSNGDVKLSTILQALTLT-QRHIEGTKRPSV----VVIPLEVEDGN 232

Query: 328 SQXXXXXXXXXXXXGIHFAVAAGNENQDACNTSPA----ASQKAITVGASTLADDRAYFS 383
           +              +   + AGN  QDA N SPA      +  I VG+  + ++   F+
Sbjct: 233 NP-ILTEAIASFDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFT 291

Query: 384 NWGRCVDLFAPGMNI-------LSTYIGSDTAVATLSGTSMASPHVAGLLTYFLSL 432
           N+G  VD+F  G  I       L +   S++    +SGTS +S   AG++ Y++SL
Sbjct: 292 NYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 123/275 (44%), Gaps = 35/275 (12%)

Query: 179 FTTQNGAPWGLARVSHREKLNSGSF----NKYLYDDNSGEGVTSYVIDTGINIDHVDFED 234
           +  Q  AP  L R++ ++ + S  +    N+Y++ D SG GV  Y++DTGI+I H  +  
Sbjct: 94  YLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQ 152

Query: 235 RA------LWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGT-G 287
                   L    IP+ D     NGHGT  AG I S  +G            + +N    
Sbjct: 153 NNIHKLIDLTTSPIPSGDF----NGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHA 208

Query: 288 SMSDVLRGVEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAV 347
           +MS VL  +    K  +K    +       T   ++                   I   +
Sbjct: 209 TMSRVLSALSLIEKHEQKTMRPSIIVLPFQTEKNTI--------LESAIENISKKIPVII 260

Query: 348 AAGNENQDACNTSPAASQK---AITVGASTLADDRAY-----FSNWGRCVDLFAPGMNIL 399
            AGN++Q+AC  SP   +K    + VG+   ++++ Y     FSN+G CVD++  G++I 
Sbjct: 261 PAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDIS 320

Query: 400 STYIGSD---TAVATLSGTSMASPHVAGLLTYFLS 431
           +    S+     +  ++GTS +   VAG++ Y++S
Sbjct: 321 TLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 87/347 (25%), Positives = 145/347 (41%), Gaps = 37/347 (10%)

Query: 122 EFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTT 181
           EFGI +  A+  +   +++G+  + +     +D +  L ++ ++  +  D  +   +   
Sbjct: 40  EFGINSDEAQVEL---YSVGKNFQAFSAILEQDHLRSLYNDLNIAAISIDRQLEPQEMIV 96

Query: 182 QNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGI-----NIDHVDFEDR- 235
           Q  AP  L ++   E  +    N+++YD  +G GV  Y+ DTGI      +      D  
Sbjct: 97  QKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIARNSPGLSASRIHDMP 152

Query: 236 ALWGKTIPNNDADYDGNGHGTHCAGTIASKTYGXXXXXXXXXXXXLRSNGTGSMSDVLRG 295
            + G  I     D +   HGT  +G I S  +G               NG   MS VL+G
Sbjct: 153 GMPGPPI----RDQEILEHGTAMSGLIGSPAFGVLKKCNLIDVNVGDENGKVFMSKVLKG 208

Query: 296 VEYAVKAHRKAAEKADKGFKGSTANMSLGGGRSQXXXXXXXXXXXXGIHFAVAAGNENQD 355
           +   V+ H K   +       S  N S    ++              +  AVAAGN  Q 
Sbjct: 209 LNL-VQQHVKHTNRP------SVINFSYCTLKN-AILNSAFDNFPRDVPIAVAAGNYKQP 260

Query: 356 ACNTSPAASQ--KAITVGASTLADDRAY----FSNWGRCVDLFAPGMNILSTYI------ 403
            C+ SP   Q  K++    S L +D       FSN+G CV  +APG  +L+  I      
Sbjct: 261 GCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGEGLLTFGIPDTSRP 320

Query: 404 GSDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQTISPEV 450
            S   V  +SGTS +S   AG++ Y+++    G+    + + + P +
Sbjct: 321 NSRDTVIIISGTSGSSALGAGVIGYYMAQGIPGEEVVDSLRIVQPNL 367

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 14/71 (19%)

Query: 205 KYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA----------DYDGNGH 254
           K  Y++ +G GV + ++D G++ ++ D +D      +   ND           DY    H
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----H 213

Query: 255 GTHCAGTIASK 265
           GT CAG IA+K
Sbjct: 214 GTRCAGEIAAK 224

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 208 YDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNND------ADYDGNGHGTHCAGT 261
           Y++ +G GV + ++D G++ +  D +D      +   ND         D + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 262 IAS 264
           IA+
Sbjct: 214 IAA 216

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 16/68 (23%)

Query: 208 YDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYDGNG-----------HGT 256
           Y++ +G GV + ++D G+     D+E+R L          D++ N            HGT
Sbjct: 185 YENITGHGVVAAIVDDGL-----DYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGT 239

Query: 257 HCAGTIAS 264
            CAG IA+
Sbjct: 240 RCAGEIAA 247

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 14/76 (18%)

Query: 199 NSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA----------D 248
           N  +  K  Y++ +GEG+   ++D G++ ++ D +D      +   ND           D
Sbjct: 166 NDVNVKKLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPKPRLADD 225

Query: 249 YDGNGHGTHCAGTIAS 264
           Y    HGT CAG IA+
Sbjct: 226 Y----HGTRCAGEIAA 237

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 14/68 (20%)

Query: 208 YDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA----------DYDGNGHGTH 257
           Y++ +G GV + ++D G++ ++ D +D      +   ND           DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDY----HGTR 216

Query: 258 CAGTIASK 265
           CAG IA+K
Sbjct: 217 CAGEIAAK 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 14/68 (20%)

Query: 208 YDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDA----------DYDGNGHGTH 257
           Y++ +G GV + ++D G++ ++ D +D      +   ND           DY    HGT 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDY----HGTR 216

Query: 258 CAGTIASK 265
           CAG IA+K
Sbjct: 217 CAGEIAAK 224

>TDEL0B01730 Chr2 (309698..312610) [2913 bp, 970 aa] {ON} Anc_8.462
           YDR238C
          Length = 970

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 14/91 (15%)

Query: 162 NPHVHFVEEDSMVFASDFTTQNGAPWGLARVSHREKLNSGS----FNKYLYDDNSGEGVT 217
           N HV F     +    + T+ N  P G  R++   K++S      F   +YD   GE   
Sbjct: 769 NLHVQFATLGDLKIIDNPTSTNVVPHGFHRLTVTVKVSSADTGVIFGNIIYDGAHGED-A 827

Query: 218 SYVIDTGINIDHVDF------ED---RALWG 239
            YVI   +++D +D+      ED   R +W 
Sbjct: 828 HYVILNDVHVDIMDYIKPAKTEDENFRTMWN 858

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,155,815
Number of extensions: 2348455
Number of successful extensions: 5751
Number of sequences better than 10.0: 76
Number of HSP's gapped: 5646
Number of HSP's successfully gapped: 79
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)