Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR011C6.15ON25325313420.0
KLLA0D01023g6.15ON2682188461e-114
Ecym_30196.15ON2662278381e-113
Kwal_56.223996.15ON2742718301e-112
KLTH0C11352g6.15ON2682278091e-109
SAKL0E01056g6.15ON2692277861e-105
KAFR0A050606.15ON2692147741e-103
NDAI0I022506.15ON2712187651e-102
ZYRO0C07920g6.15ON2932217581e-100
Kpol_1045.746.15ON2572327501e-100
TPHA0J002806.15ON2712617403e-98
CAGL0E02673g6.15ON2632517394e-98
Smik_15.1736.15ON2512337341e-97
NCAS0D026606.15ON2612267315e-97
Suva_15.1796.15ON2592147306e-97
TDEL0G045406.15ON2452467271e-96
Skud_15.1656.15ON2572247272e-96
KNAG0F028806.15ON2692387248e-96
YOR004W (UTP23)6.15ON2542107054e-93
TBLA0A072906.15ON2592726056e-78
Kwal_55.200895.392ON1891421653e-13
KLTH0E02860g5.392ON1891421627e-13
Kpol_1055.185.392ON1891421592e-12
ZYRO0A06754g5.392ON1891421564e-12
SAKL0G07766g5.392ON1891421565e-12
AEL102W5.392ON1891421548e-12
TPHA0D023105.392ON1891421512e-11
Ecym_74695.392ON1891421512e-11
NDAI0C045505.392ON1891421503e-11
NCAS0F030905.392ON1891421494e-11
KNAG0C052705.392ON1891421477e-11
TDEL0E023305.392ON1891421478e-11
CAGL0M01056g5.392ON1891421478e-11
Suva_2.5095.392ON1891421461e-10
YDR339C (FCF1)5.392ON1891421461e-10
Skud_4.6065.392ON1891421461e-10
Smik_4.5995.392ON1891421461e-10
KAFR0D042805.392ON1891421433e-10
TBLA0H017505.392ON1891421424e-10
KLLA0A07018g5.392ON1891421372e-09
TPHA0F024306.31ON79856810.086
KLLA0E08603g2.297ON16443740.35
SAKL0A02640g6.287ON21866740.45
ZYRO0E07392g6.239ON89756692.6
Kwal_56.230653.265ON90746683.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR011C
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   521   0.0  
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   330   e-114
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   327   e-113
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   324   e-112
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   316   e-109
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   307   e-105
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   302   e-103
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   299   e-102
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   296   e-100
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   293   e-100
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   289   3e-98
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   289   4e-98
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   287   1e-97
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   286   5e-97
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   285   6e-97
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   284   1e-96
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   284   2e-96
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   283   8e-96
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   276   4e-93
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   237   6e-78
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    68   3e-13
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    67   7e-13
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    66   2e-12
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    65   4e-12
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    65   5e-12
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    64   8e-12
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    63   2e-11
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    63   2e-11
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    62   3e-11
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    62   4e-11
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    61   7e-11
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    61   8e-11
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    61   8e-11
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    61   1e-10
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    61   1e-10
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    61   1e-10
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    61   1e-10
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    60   3e-10
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    59   4e-10
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    57   2e-09
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    36   0.086
KLLA0E08603g Chr5 complement(769789..770283) [495 bp, 164 aa] {O...    33   0.35 
SAKL0A02640g Chr1 (239111..239767) [657 bp, 218 aa] {ON} highly ...    33   0.45 
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    31   2.6  
Kwal_56.23065 s56 complement(383856..386579) [2724 bp, 907 aa] {...    31   3.8  

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/253 (100%), Positives = 253/253 (100%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHRYIVAS 120
           ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHRYIVAS
Sbjct: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHRYIVAS 120

Query: 121 QDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIAE 180
           QDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIAE
Sbjct: 121 QDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIAE 180

Query: 181 NSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADASKKRRRKHKK 240
           NSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADASKKRRRKHKK
Sbjct: 181 NSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADASKKRRRKHKK 240

Query: 241 ATSAETPAESTSD 253
           ATSAETPAESTSD
Sbjct: 241 ATSAETPAESTSD 253

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  330 bits (846), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 159/218 (72%), Positives = 184/218 (84%), Gaps = 3/218 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFR+PYQVLVDDQ+VLET  SSFD +KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY T NQ AI  GK +ERRRCNH  KEPK  +ECL SVV VNG+N+HRY+VA
Sbjct: 61  ITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           +QD+ IRR LRK+PGVPLVY+NR+VMVMEPLS+ SE+VSRE E+QKL+KGLNDPK+ GIA
Sbjct: 121 TQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAGIA 180

Query: 180 -ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKE 216
            + +  AGA+  E  P  KRKGPK PNPLSMKK+K  E
Sbjct: 181 RDENDEAGAENQENKPK-KRKGPKEPNPLSMKKKKTTE 217

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  327 bits (838), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 192/227 (84%), Gaps = 4/227 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAKAYKKQMLVYNHTFKFR+PYQVLVDDQ+VLETNKSSFDLLKGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHRYIVAS 120
           ITQCC+QKLY++KNQ AIAQ K+YERRRCNH KEPKEP EC++SVV +NG+N HRY+VA+
Sbjct: 61  ITQCCVQKLYESKNQGAIAQAKMYERRRCNHYKEPKEPSECIRSVVDINGRNLHRYVVAT 120

Query: 121 QDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIAE 180
           QDI IRR LR+VPGVPL+Y+NR+VMVMEPLSS S+QVS++ E +KL KGLNDPKY G   
Sbjct: 121 QDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYAGTPN 180

Query: 181 NSAPAGAQP-AEGAPTLKR--KGPKAPNPLSMKKRKVKEEQ-PTSDA 223
           N+  A   P +  A  LKR  KGPK PNPLS+KK +V + Q P+ D 
Sbjct: 181 NTEDASVDPKSPDANQLKRKIKGPKEPNPLSIKKPRVNKAQLPSEDV 227

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  324 bits (830), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 165/271 (60%), Positives = 205/271 (75%), Gaps = 19/271 (7%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFREPYQVLVDDQIV +T+K++FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCC+Q +Y+T +Q+AI   K +ERRRCNH  KE K P+ECLQSVV VNG N+HRY+VA
Sbjct: 61  ITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           +Q+  IR  LRKVPGVPLV++NR+VMVMEPLS  S+ VSR  E++KLFKGLNDPK+ G+ 
Sbjct: 121 TQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAGLP 180

Query: 180 ENSAPAGAQPAE------GAPTLKRKGPKAPNPLSMKKRKVKE--EQPTSDA-------- 223
               PA A  A       GAP  KRKGPK PNPLS+KK+K  E  ++P + A        
Sbjct: 181 LTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSIKKKKTSESRKEPVNPAENTSATLT 240

Query: 224 -SEQKADASKKRRRKHKKATSAETPAESTSD 253
            ++ K   S++R+R HKK T+ +T  E+TS+
Sbjct: 241 ENDNKEQPSRRRKRSHKK-TTPQTAEETTSE 270

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  316 bits (809), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 179/227 (78%), Gaps = 5/227 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNH FKFREPYQVLVDDQIV +T+++SFDL+KGL+RTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCC+Q +Y+TKNQDAI   K +ERRRCNH  KE K PIECLQSVV+VNG N+HRY+VA
Sbjct: 61  ITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQD +IR+ LR+VPGVPL+Y+NR+VMVMEPLS  S   SR  EK+KLFKGLNDPKY G+ 
Sbjct: 121 SQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAGLP 180

Query: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKV----KEEQPTSD 222
                            KRKGPK PNPLS+KK+K     K+E P SD
Sbjct: 181 AEEEGGKTDNGTEVSKNKRKGPKGPNPLSIKKKKTVPDSKDESPPSD 227

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  307 bits (786), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/227 (65%), Positives = 182/227 (80%), Gaps = 2/227 (0%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQMLVYNHTFKFREPYQVLVDDQIV+ T KSSFDL KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY TK+Q AI   K YERRRCNH  KE K  +EC++SVV  NG+N+HRY+VA
Sbjct: 61  ITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           +QDI IRR LR+VPGVPL+Y+NR+VMVMEPLS  SE++S+  E++KLFKGLNDPK+ G+A
Sbjct: 121 TQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPKHAGLA 180

Query: 180 EN-SAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASE 225
            + S        +  P+ K+ GPK PNPLS+K+++ + E+ T   +E
Sbjct: 181 HDESVDLVDSVKQKQPSKKKGGPKEPNPLSVKRKRDQREENTKAPAE 227

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  302 bits (774), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 177/214 (82%), Gaps = 2/214 (0%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD++IV  ++ S+FDL+KGLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY+T++Q+AI   K +ERRRCNH  KEPK PIEC+ SVV VNG+N+HRY+VA
Sbjct: 61  ITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQDI IRR LR+VPGVPLV+I+R+VM+MEPLS TS ++S   E++KL+KGLNDPKY G+ 
Sbjct: 121 SQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAGLK 180

Query: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLSMKKR 212
            +   A      G  T K+K GPK PNPLS++K+
Sbjct: 181 LDEEEATETQGSGEKTAKKKRGPKGPNPLSVRKK 214

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 141/218 (64%), Positives = 171/218 (78%), Gaps = 4/218 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTFKFR PYQVLVD+QIVL+ + S++DL KGLK TLQ+EVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSEVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY+  NQDAI   + +ERRRCNH  KEPK  IEC++SVV +NGQN+HRY+VA
Sbjct: 61  ITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQD+A RR LR+VPGVPL++I+RAVM+MEPLS  S QVSR  E +KL+KGLNDPK+TG+ 
Sbjct: 121 SQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPKFTGVK 180

Query: 180 ENSAPAGAQPAEGAPTLKRK---GPKAPNPLSMKKRKV 214
                   +  E     K+K   GPK PNPLSMKK+K 
Sbjct: 181 SAVDKETVKEKESTDQQKKKRKIGPKGPNPLSMKKKKT 218

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  296 bits (758), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 175/221 (79%), Gaps = 10/221 (4%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+YKKQMLVYN+ F+FREPYQVL+DDQ+V +  KS +DL+ GLKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY TKNQDAI  GK +ERRRCNH  KE K P EC+QSVV VNG N+HRY+VA
Sbjct: 61  ITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI- 178
           SQD+ +RR LRKVPGVPL++++R+VMVMEPLS  S +V+  +E++KL KGLNDPK  G+ 
Sbjct: 121 SQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPKLAGLK 180

Query: 179 ----AENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVK 215
                EN   + +QP    P  KRKGPK PNPLS++K++ K
Sbjct: 181 TTPSVENELESESQP----PAKKRKGPKGPNPLSVRKKQKK 217

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  293 bits (750), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 141/232 (60%), Positives = 181/232 (78%), Gaps = 8/232 (3%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQ+RAK+Y+KQMLVYNHTFKFREPYQ +VDDQ+VL+  +S FD+LKGLKRTLQAEVK M
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAEVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY T NQ+AI+  K +ERRRCNH  K+PK P+EC++S+V + G N+HRY+VA
Sbjct: 61  ITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYT-GI 178
           SQD+ IRR LRK+PGVP+V+++RAVM++EPLS  S ++S   EK KL+KGLND K+T G+
Sbjct: 121 SQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSKHTAGL 180

Query: 179 AENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADA 230
            E   P   +  + + + K KGPK PNPLSMKKRK K   P S+  E + ++
Sbjct: 181 DE---PKSEKSEKTSESKKNKGPKQPNPLSMKKRKSK---PASNEVEAETES 226

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  289 bits (740), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 146/261 (55%), Positives = 200/261 (76%), Gaps = 21/261 (8%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAE-VKP 59
           MRQKRAK+YKKQM+VYNHTFKFREPYQ+LVD+QIV ++ +S+++L + L++TLQAE +K 
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAENIKV 60

Query: 60  MITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIV 118
           MITQCCMQKLY T NQ+ I + K +ERRRCNH +K+PKEP+EC++S+V ++GQN+HRY+V
Sbjct: 61  MITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYVV 120

Query: 119 ASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI 178
           A+Q++ +RR LR+VPGVP+++++R+VM+MEP+S +S +++R+ E+ KL+KGLNDPKY+  
Sbjct: 121 ATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYS-- 178

Query: 179 AENSAPAGAQPAEGAP---------TLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKAD 229
               AP    P EG P         T KRKG K PNPLS KK+KVK E P   A+   A 
Sbjct: 179 ---MAPT---PKEGTPDTEGTQPAATKKRKGVKEPNPLS-KKKKVKVEIPKPAATTTDA- 230

Query: 230 ASKKRRRKHKKATSAETPAES 250
           A+KKRRRKH+   ++E   E 
Sbjct: 231 ANKKRRRKHRSNKNSENGNEG 251

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  289 bits (739), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 185/251 (73%), Gaps = 6/251 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTFKFREPYQVL+DDQIV+++  S +DL+K LKRTLQAEVKPM
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAEVKPM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY+TKN+ AI  GK +ERRRC H+  E   P EC+ +VV V G+N+HRY+VA
Sbjct: 61  ITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
            QD+ IRR LRKVPGVPL++I+R+VM+MEPLS  S +VSR  E+ KLF+GLNDPKY G+ 
Sbjct: 121 CQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAGL- 179

Query: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLSM---KKRKVKEEQPTSDASEQKADASKKRR 235
           +       Q  E     KRK GPK PNPLSM   KK   K+EQ T  +++Q     ++R 
Sbjct: 180 KGEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKKEQQTETSADQSQPTKRRRS 239

Query: 236 RKHKKATSAET 246
           RKHK  +   T
Sbjct: 240 RKHKHGSKNST 250

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  287 bits (734), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 141/233 (60%), Positives = 180/233 (77%), Gaps = 8/233 (3%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+VLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P +C++SVV +NG N+HRY+VA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQDI +RR LR VPGVPL+++ R+VMVMEPLS+ S + S+  E++KL+KGLNDP    + 
Sbjct: 121 SQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLNDPNVDKVQ 180

Query: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLSMKKRKVKEEQPTSDASEQKADAS 231
           E S  +G +      T KRK GPKAPNPLS+KK+  K+   TSD +  K D S
Sbjct: 181 EISEGSGKESV----TKKRKFGPKAPNPLSVKKK--KKAYSTSDEARGKEDTS 227

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  286 bits (731), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 139/226 (61%), Positives = 182/226 (80%), Gaps = 2/226 (0%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTF+FREPYQ+LVD+QIV + + S++DL KGL RTLQAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAEVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNHV-KEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY+  +Q+AI   + +ERRRCNH  K+PK PIEC++SVV +NGQN+HRY+VA
Sbjct: 61  ITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           +QD+AIRR LR+VPGVPLV+I+RAVM+MEPLS  S +VS+  E +KL+KGLNDPKYTG+ 
Sbjct: 121 AQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPKYTGV- 179

Query: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASE 225
           + +A       +  P   + GPK+PNPLSMKK+K + ++   D++E
Sbjct: 180 KTAAEDVKIDDKPKPKKSKYGPKSPNPLSMKKKKQEPKRNREDSTE 225

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  285 bits (730), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 169/214 (78%), Gaps = 4/214 (1%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+V E + S+FDL  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P EC++SVV VNG N+HRY+VA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + SR  E+QKL+KGLNDP    I 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDP---NIE 177

Query: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRK 213
           +  A +     E  P  ++ GPKAPNPLSMKK+K
Sbjct: 178 KAEAISKGSEKESTPKKRKAGPKAPNPLSMKKKK 211

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  284 bits (727), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 155/246 (63%), Positives = 181/246 (73%), Gaps = 13/246 (5%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAKAY+KQMLVYNHTFKFREPYQVLVD+QIVL+ + S+FDL+KGL+RTLQAEVK M
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAEVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY+T  Q AI   K +ERRRCNH  KEPK PIECL+S+V VNG N+HRY+VA
Sbjct: 61  ITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQDI  RR LR+ PGVPLV+  R+VMVMEPLS  S +VS  AE +KL KGLNDP+  GI 
Sbjct: 121 SQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLNDPRNAGIK 180

Query: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKV--KEEQPTSDASEQKADASKKRRRK 237
                      E   T  +K  K PNPLS+KKRK   K E   +  +E  A  +KKRRRK
Sbjct: 181 ----------TENPQTSIKKRTKQPNPLSVKKRKTESKGEPKAAQDTEPVASNTKKRRRK 230

Query: 238 HKKATS 243
           HK +T+
Sbjct: 231 HKSSTT 236

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  284 bits (727), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 136/224 (60%), Positives = 177/224 (79%), Gaps = 6/224 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+V E + S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCC+Q LY+T+N+ AI   K +ERRRCNH  K+PK P EC++SVV VNG N+HRY+VA
Sbjct: 61  ITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + S++ E+QKLFKGLNDP      
Sbjct: 121 SQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEKTE 180

Query: 180 ENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDA 223
           + S+ +G    E AP  ++ GPKAPNPLS+KK+K    QP+++ 
Sbjct: 181 KVSSESG---KESAPKKRKIGPKAPNPLSVKKKKT--SQPSNET 219

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  283 bits (724), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 139/238 (58%), Positives = 174/238 (73%), Gaps = 11/238 (4%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVYNHTF+FREPYQV++DD+IVL+  +S FDL K L+RT+QAEVK M
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAEVKLM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCCMQ LY T N+ AI   K YERRRCNH  K+PK P EC++SVV + G+N+HRYIVA
Sbjct: 61  ITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYIVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGI- 178
            Q+I +RR LR+VPGVPL++++RAVM+MEPLS  S ++S+  E+QKLF GLND K  GI 
Sbjct: 121 CQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAAGIK 180

Query: 179 ---AENSAPAGAQPAEGAPTLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQKADASKK 233
               E     G +  E  P  ++ GPK PNPLSMKK+K          SEQK   +KK
Sbjct: 181 AAETEKVEDKGKEAPEAKPKKRKLGPKQPNPLSMKKKK------KDGNSEQKNVGTKK 232

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  276 bits (705), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 132/210 (62%), Positives = 167/210 (79%), Gaps = 6/210 (2%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPM 60
           MRQKRAK+Y+KQ+LVY+HTFKFREPYQVLVD+Q+VLE N S+F+L  GLKRTLQA+VK M
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVM 60

Query: 61  ITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYIVA 119
           ITQCC+Q LY+T+N  AI   K +ERRRCNH  K+PK P EC++SVV ++G N+HRY+VA
Sbjct: 61  ITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVA 120

Query: 120 SQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTGIA 179
           SQDI +RR LR VPGVPL+++ R+VMVMEPLS+ S + S+  E+QKL+KGLNDP    + 
Sbjct: 121 SQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQ 180

Query: 180 ENSAPAGAQPAEGAPTLKRK-GPKAPNPLS 208
           E+   +G +    + T KRK GPKAPNPLS
Sbjct: 181 ESGDGSGKE----SITKKRKLGPKAPNPLS 206

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  237 bits (605), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 176/272 (64%), Gaps = 36/272 (13%)

Query: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAE--VK 58
           MRQKRAK+YKKQ++VYNHTFKFREPYQV++DD +V ET ++ ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 59  PMITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYI 117
           PMITQCC+  LY +++Q++I+ GK +ERRRCNH VKEP  P EC+ S+V VNG+N+HRYI
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 118 VASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTG 177
           VA+QD+ +RR LRK+PGVPL++  R+VMVMEPLS  S + + E E +KL  GLN  K   
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK--- 177

Query: 178 IAENSAPAGAQPAEGAPTLKRKGPKAPNPLSM--------------------KKRKVKEE 217
               ++  G Q   G    K KG    NPLSM                    K + +K E
Sbjct: 178 ----ASVEGGQ-ENGIKKKKVKG---VNPLSMKKKSNSNSNSNSNSNSNSKPKPKPIKHE 229

Query: 218 QPTSDASEQKADASKKRRRKHKKATSAETPAE 249
           +   +A++Q   A K+R+RKH    +A+   E
Sbjct: 230 RDNENATDQ--PAKKRRKRKHTSNANAKKSEE 259

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   DL++G+  TL A+  P+IT C M +L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCIPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D A+++ 
Sbjct: 111 PKYRIALKLARDPRIQRLSCSHKGTYAD--DCL-----VNRVLQHKCYIVATNDAALKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHAYVIEKL 185

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+  TL A+  PMIT C M +L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIQRLTCSHKGTYAD--DCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHAYVIEKL 185

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D++KG+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D+ +++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD--DCI-----VNRVLQHKCYIVATNDVGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHSYVIEKL 185

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 64.7 bits (156), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    R PYQVL+D   +  + +   D++KG+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C H     +  +CL     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCTHKGTYAD--DCL-----VNRVMQHKCYIVATNDAPLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D A+++ 
Sbjct: 111 PKYRIALRLARDPRIKRLNCSHKGTYAD--DCL-----VNRVLQHKCYIVATNDAALKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHSYVIEKL 185

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 63.9 bits (154), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLNCSHKGTYAD--DCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLMSVGGHSYVIEKL 185

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L +      R PYQVL+D   +  + +   D++KG+   L A+  P+IT C M +L    
Sbjct: 51  LFFQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD--DCI-----VNRVLQHKCYIVATNDQGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHAYVIEKL 185

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCVPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLTCSHRGTYAD--DCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 IRKVPGIPLLSVGGHSYVIEKL 185

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   DL+KG+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     VN   +H+ +IVA+ D  +++ 
Sbjct: 111 PKYRIALRLARDPRIKRLSCSHKGTYAD--DCI-----VNRVLQHKCFIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 61.2 bits (147), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCL-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHAYVIEKL 185

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C H     +  +C+     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKFRIALKLARDPRIKRLSCTHKGTYAD--DCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +      +E L
Sbjct: 164 VRKIPGIPLMSVGGHAYAIEKL 185

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D++KG+   L A+  P+IT C + +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C H     +  +C+     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLTCTHKGTYAD--DCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHAYVIEKL 185

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     V+   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCL-----VHRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKL 185

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL   V      +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCLVHRVL-----QHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKL 185

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL     V+   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCL-----VHRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKL 185

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +CL   V      +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCLVHRVL-----QHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 IRKIPGIPLMSVGGHAYVIEKL 185

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 59.7 bits (143), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVIAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVIEKL 185

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCNPLITDCVVAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 
Sbjct: 111 PKFRIALKLARDPRIKRLSCSHRGTYAD--DCI-----VNRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RK+PG+PL+ +     V+E L
Sbjct: 164 VRKIPGIPLMSVGGHSYVVEKL 185

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

Query: 14  LVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAEVKPMITQCCMQKL--YD 71
           L + +    + PYQVL+D   +  + +   D++KG+   L A+   +IT C M +L    
Sbjct: 51  LFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCVMAELEKLG 110

Query: 72  TKNQDA--IAQGKLYERRRCNHVKEPKEPIECLQSVVAVNGQNRHR-YIVASQDIAIRRA 128
            K + A  +A+    +R  C+H     +  +C+     V+   +H+ YIVA+ D  +++ 
Sbjct: 111 PKYRIALKLARDPRIKRLSCSHKGTYAD--DCI-----VHRVLQHKCYIVATNDAGLKQR 163

Query: 129 LRKVPGVPLVYINRAVMVMEPL 150
           +RKVPG+PL+ +     V+E L
Sbjct: 164 VRKVPGIPLMSVGGHSYVIEKL 185

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 35.8 bits (81), Expect = 0.086,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 12  QMLVYNHTFKFREPYQVLVDDQIVLE--TNKSSFDLLKGLKRTLQAEVKPMITQCC 65
           Q L Y+H  KF + ++  ++  I+LE   N S  DLLK  K   +AEVK M TQ C
Sbjct: 145 QNLRYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVC 200

>KLLA0E08603g Chr5 complement(769789..770283) [495 bp, 164 aa] {ON}
           similar to uniprot|P40502 Saccharomyces cerevisiae
           YIL087C Hypothetical ORF
          Length = 164

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 137 LVYINRAVMVMEPLSSTSEQ--VSREAEKQKLFKGLNDPKYTG 177
           L ++N A+++  P+ S + Q  VS  A+KQ +F     P+Y G
Sbjct: 18  LAWLNGAMLITTPVVSPATQTPVSVMAQKQSMFSAFTRPRYFG 60

>SAKL0A02640g Chr1 (239111..239767) [657 bp, 218 aa] {ON} highly
           similar to uniprot|Q04338 Saccharomyces cerevisiae
           YMR197C VTI1 Involved in cis-Golgi membrane traffic
           Vti1p is a v-SNARE that interacts with two t- SNARES
           Sed5p and Pep12p
          Length = 218

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 6/66 (9%)

Query: 17  NHTFKFREPYQVLVDDQIVLETNKSSF-DLLKGLKRTLQAEVKPMITQCCMQKLYDTKNQ 75
           +  F   +  ++ V+D +V    +++F   L+G K+ +QAE+K       +Q+L DT+++
Sbjct: 46  DELFDLIDQMEIEVNDSVVEANTRANFKSKLRGYKKQVQAEIK-----LPLQQLVDTRDR 100

Query: 76  DAIAQG 81
           D + QG
Sbjct: 101 DLLFQG 106

>ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [2694
           bp, 897 aa] {ON} highly similar to uniprot|P41811
           Saccharomyces cerevisiae YGL137W SEC27 Involved in
           beta'-subunit of yeast coatomer
          Length = 897

 Score = 31.2 bits (69), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 179 AENSAPAGAQPAEGAPTLKRKGPKAPNPLS-MKKRKVKEEQPTSDASEQKADASKK 233
           AE       QP E   T + + P A  P + ++K + + E PT +ASE K ++ K+
Sbjct: 842 AEEVVNEDTQPKESQTTEEPQEPTAAKPEAPVEKEESQTEVPTQEASETKEESKKE 897

>Kwal_56.23065 s56 complement(383856..386579) [2724 bp, 907 aa] {ON}
           YBR055C (PRP6) - RNA splicing factor [contig 183] FULL
          Length = 907

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 205 NPLSMKKRKVKEEQPTSDASEQKADASKKRRRKHKKATSAETPAES 250
           N LS+   +++EE   +D    + DA   RR+ HKKA   + P+ S
Sbjct: 76  NGLSLAPHRLEEEDKEADRIYNEIDAQLARRKGHKKANVEQAPSTS 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,170,246
Number of extensions: 1032226
Number of successful extensions: 6773
Number of sequences better than 10.0: 223
Number of HSP's gapped: 6677
Number of HSP's successfully gapped: 240
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)