Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YOR004W (UTP23)6.15ON2542106923e-91
YDR339C (FCF1)5.392ON1891421478e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR011C
         (253 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   458   e-165
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   325   e-112
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   318   e-110
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   317   e-109
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   305   e-104
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   300   e-102
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   297   e-101
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   296   e-101
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   288   6e-98
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   289   8e-98
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   284   3e-96
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   280   1e-94
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   279   2e-94
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   279   3e-94
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   276   4e-93
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   274   2e-92
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   271   3e-91
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   271   7e-91
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   267   5e-90
TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   232   5e-76
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    68   3e-13
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    67   7e-13
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    65   2e-12
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    65   5e-12
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    64   5e-12
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    64   9e-12
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    63   2e-11
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    63   2e-11
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    63   3e-11
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    62   4e-11
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    62   6e-11
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    62   6e-11
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    61   7e-11
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    61   8e-11
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    61   8e-11
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    61   8e-11
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    61   8e-11
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    60   2e-10
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    59   4e-10
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    57   2e-09
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    35   0.13 
KLLA0E08603g Chr5 complement(769789..770283) [495 bp, 164 aa] {O...    33   0.30 
SAKL0A02640g Chr1 (239111..239767) [657 bp, 218 aa] {ON} highly ...    33   0.48 
NDAI0A04920 Chr1 complement(1115990..1119475) [3486 bp, 1161 aa]...    33   0.58 

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  458 bits (1179), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/253 (89%), Positives = 226/253 (89%)




           NS            TLKRKGPKAPNPLSMKKRKVKEEQPTSDASEQ              

Query: 241 XTSAETPAESTSD 253
Sbjct: 241 ATSAETPAESTSD 253

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  325 bits (832), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/217 (70%), Positives = 177/217 (81%), Gaps = 1/217 (0%)




            +               KRKGPK PNPLSMKK+K  E

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  318 bits (816), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 163/227 (71%), Positives = 188/227 (82%), Gaps = 4/227 (1%)




           N+              LKR  KGPK PNPLS+KK +V + Q P+ D 

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  317 bits (813), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 179/227 (78%), Gaps = 5/227 (2%)




                            KRKGPK PNPLS+KK+K     K+E P SD

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  305 bits (781), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 180/227 (79%), Gaps = 2/227 (0%)




            + S            + K+ GPK PNPLS+K+++ + E+ T   +E

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  300 bits (768), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 174/223 (78%), Gaps = 7/223 (3%)




                A  +              KRKGPK PNPLS+KK+K  E

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  297 bits (761), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 175/214 (81%), Gaps = 2/214 (0%)




            +             T K+K GPK PNPLS++K+

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
          Length = 271

 Score =  296 bits (757), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 171/218 (78%), Gaps = 4/218 (1%)




            A +               KRK GPK PNPLSMKK+K 

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  288 bits (736), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 170/217 (78%), Gaps = 5/217 (2%)




            E              + K KGPK PNPLSMKKRK K

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  289 bits (739), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 140/217 (64%), Positives = 169/217 (77%), Gaps = 2/217 (0%)




              S              KRKGPK PNPLS++K++ K

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
          Length = 261

 Score =  284 bits (726), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 137/226 (60%), Positives = 179/226 (79%), Gaps = 2/226 (0%)




           + +               + GPK+PNPLSMKK+K + ++   D++E

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  280 bits (715), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 161/210 (76%), Gaps = 1/210 (0%)




                            ++ GPK PNPLSM

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
          Length = 251

 Score =  279 bits (713), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 169/215 (78%), Gaps = 6/215 (2%)



           SQDI +RR LR VPGVPL+++ R+VMVMEPLS+ S + S+  E++KL+KGLNDP    + 

           E S            T KRK GPKAPNPLS+KK+K

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
          Length = 259

 Score =  279 bits (713), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 135/215 (62%), Positives = 166/215 (77%), Gaps = 6/215 (2%)



           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + SR  E+QKL+KGLNDP      

           E +              KRK GPKAPNPLSMKK+K

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
          Length = 257

 Score =  276 bits (705), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 172/224 (76%), Gaps = 8/224 (3%)



           SQDI +RR LR VPGVPL+++ R+VM+MEPLS+ S + S++ E+QKLFKGLNDP      

           E +              KRK GPKAPNPLS+KK+K    QP+++

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  274 bits (701), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 132/218 (60%), Positives = 165/218 (75%), Gaps = 5/218 (2%)



            Q+I +RR LR+VPGVPL++++RAVM+MEPLS  S ++S+  E+QKLF GLND K  GI 

            AE                K++  GPK PNPLSMKK+K

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  271 bits (692), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 163/210 (77%), Gaps = 6/210 (2%)



           SQDI +RR LR VPGVPL+++ R+VMVMEPLS+ S + S+  E+QKL+KGLNDP    + 

           E+             T KRK GPKAPNPLS

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
          Length = 271

 Score =  271 bits (692), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 134/258 (51%), Positives = 187/258 (72%), Gaps = 9/258 (3%)



           A+Q++ +RR LR+VPGVP+++++R+VM+MEP+S +S +++R+ E+ KL+KGLNDPKY+  

                            T KRKG K PNPLS KK+KVK E P     T+DA+ +      

                       E P E+

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  267 bits (683), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 164/216 (75%), Gaps = 13/216 (6%)




            EN             T  +K  K PNPLS+KKRK 

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
          Length = 259

 Score =  232 bits (592), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 108/187 (57%), Positives = 144/187 (77%), Gaps = 5/187 (2%)



           VA+QD+ +RR LRK+PGVPL++  R+VMVMEPLS  S + + E E +KL  GLN  K + 

Query: 177 -GIAENS 182
            G  EN 
Sbjct: 181 EGGQENG 187

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 77/142 (54%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   DL++G+  TL A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D A+++ 

           +RKVPG+PL+ +     V+E L

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 67.0 bits (162), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+  TL A+  PMIT C M +L    

            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 

           +RKVPG+PL+ +     V+E L

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D++KG+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D+ +++ 

           +RKVPG+PL+ +     V+E L

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L + +    R PYQVL+D   +  + +   D++KG+   L A+  P+IT C M +L    

            K + A  +A+    +R  C H     +  +CL     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 76/142 (53%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D A+++ 

           +RKVPG+PL+ +     V+E L

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 

           +RKVPG+PL+ +     V+E L

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L +      R PYQVL+D   +  + +   D++KG+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 

           +RKVPG+PL+ +     V+E L

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
          Length = 189

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 62.0 bits (149), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   DL+KG+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +C+     VN   +H+ +IVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
          Length = 189

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L    

            K + A  +A+    +R  C+H     +  +CL     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
          Length = 189

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 73/142 (51%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   DL++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C H     +  +C+     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +      +E L

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
          Length = 189

 Score = 61.2 bits (147), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D++KG+   L A+  P+IT C + +L    

            K + A  +A+    +R  C H     +  +C+     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL     V+   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL   V      +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL   V      +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
          Length = 189

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C M +L    

            K + A  +A+    +R  C+H     +  +CL   V      +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
          Length = 189

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L    

            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
          Length = 189

 Score = 59.3 bits (142), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D+++G+   L A+  P+IT C + +L    

            K + A  +A+    +R  C+H     +  +C+     VN   +H+ YIVA+ D  +++ 

           +RK+PG+PL+ +     V+E L

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 12/142 (8%)

           L + +    + PYQVL+D   +  + +   D++KG+   L A+   +IT C M +L    

            K + A  +A+    +R  C+H     +  +C+     V+   +H+ YIVA+ D  +++ 

           +RKVPG+PL+ +     V+E L

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 35.4 bits (80), Expect = 0.13,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

           Q L Y+H  KF + ++  ++  I+LE   N S  DLLK  K   +AEVK M TQ C

>KLLA0E08603g Chr5 complement(769789..770283) [495 bp, 164 aa] {ON}
           similar to uniprot|P40502 Saccharomyces cerevisiae
           YIL087C Hypothetical ORF
          Length = 164

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

           L ++N A+++  P+ S + Q  VS  A+KQ +F     P+Y G

>SAKL0A02640g Chr1 (239111..239767) [657 bp, 218 aa] {ON} highly
           similar to uniprot|Q04338 Saccharomyces cerevisiae
           YMR197C VTI1 Involved in cis-Golgi membrane traffic
           Vti1p is a v-SNARE that interacts with two t- SNARES
           Sed5p and Pep12p
          Length = 218

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 38/66 (57%), Gaps = 6/66 (9%)

           +  F   +  ++ V+D +V    +++F   L+G K+ +QAE+K       +Q+L DT+++

Query: 76  DAIAQG 81
           D + QG
Sbjct: 101 DLLFQG 106

>NDAI0A04920 Chr1 complement(1115990..1119475) [3486 bp, 1161 aa]
           {ON} Anc_3.408 YPR097W
          Length = 1161

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 14/88 (15%)

           PY ++   QI+  TN  +  ++KG+     A+  P   Q  +QK++      D KNQ  I

            +    E +  N  K   E I+CL+SV+

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
Lambda     K      H
   0.313    0.128    0.353 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,163,427
Number of extensions: 799575
Number of successful extensions: 1736
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1705
Number of HSP's successfully gapped: 48
Length of query: 253
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 146
Effective length of database: 41,212,137
Effective search space: 6016972002
Effective search space used: 6016972002
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)