Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR010C6.16ON94594548980.0
Ecym_30206.16ON94493935400.0
SAKL0E01078g6.16ON94893325710.0
KLLA0D01045g6.16ON96594424640.0
KLTH0C11330g6.16ON94192624590.0
Kwal_56.224036.16ON94393124350.0
TDEL0G045306.16ON95893621520.0
ZYRO0C07898g6.16ON97492321050.0
NCAS0H008806.16ON100492520500.0
CAGL0B03641g6.16ON98886419450.0
TPHA0M002406.16ON93983318720.0
KAFR0L003706.16ON96395518590.0
KNAG0M011306.16ON95087015690.0
Kpol_1032.66.16ON100461013771e-174
NDAI0D008706.16ON106968713821e-174
Skud_5.286.16ON99860013651e-172
Smik_5.266.16ON100261913571e-171
YEL061C (CIN8)6.16ON100059613501e-170
Suva_5.66.16ON99961312941e-162
Kpol_1045.736.16ON96291612081e-150
TBLA0A072306.16ON109755811871e-145
ACR228C7.387ON11295699561e-112
TDEL0C016007.387ON11055019501e-111
TPHA0J003006.16ON9829719351e-110
SAKL0F12298g7.387ON11125439421e-110
Ecym_46887.387ON11344899401e-109
ZYRO0B03234g7.387ON11384559301e-108
Suva_2.547.387ON11104609171e-106
YBL063W (KIP1)7.387ON11116249141e-106
NDAI0E043007.387ON11866149151e-106
KAFR0L017107.387ON11514549121e-105
Skud_2.417.387ON11106179091e-105
NCAS0E026407.387ON11025309081e-105
Smik_2.537.387ON11138059051e-105
TPHA0E008907.387ON12326438467e-96
TBLA0D006407.387ON11425077432e-82
SAKL0G05016g5.531ON5045544964e-53
Ecym_34152.633ON6624124879e-51
ADR145C2.633ON6354144752e-49
SAKL0G18920g2.633ON6493524743e-49
Kwal_47.186085.531ON4794134611e-48
Ecym_40665.531ON4784084265e-44
Kpol_1004.255.531ON5063634214e-43
KAFR0F042103.528ON6723514276e-43
Suva_7.443.528ON8053484253e-42
Smik_7.483.528ON8053484244e-42
TBLA0C049603.528ON8014494244e-42
ZYRO0D12650g5.531ON4783694106e-42
YGL216W (KIP3)3.528ON8053484228e-42
Kpol_1013.78.678ON6203504159e-42
NCAS0E005503.528ON7843504172e-41
Skud_7.533.528ON8053484139e-41
Kwal_47.190933.528ON8193494112e-40
SAKL0F01760g3.528ON8093494093e-40
NDAI0I029603.528ON8683604076e-40
KLLA0B10956g3.479ON6904144011e-39
ZYRO0E08668g3.528ON7783494031e-39
KAFR0H024108.678ON6583784001e-39
TPHA0D032003.479ON7243494021e-39
CAGL0D04994g3.479ON6924173992e-39
TBLA0C039403.479ON7393593993e-39
KLLA0A01606g3.528ON7693563961e-38
NCAS0F034703.479ON6984153913e-38
Kpol_423.83.528ON8063513915e-38
AER441C3.528ON8183723906e-38
KNAG0B005203.528ON7233503887e-38
TDEL0D059603.528ON7333503888e-38
AGR253W3.479ON7094123878e-38
KLLA0D05951g8.678ON6683473859e-38
TPHA0D034803.528ON8473513881e-37
TBLA0C053103.479ON6763443832e-37
TPHA0D012708.678ON6963933814e-37
ZYRO0F07414g8.678ON6543583761e-36
SAKL0H06490g8.678ON6574913733e-36
Skud_16.1278.678ON7063713743e-36
KLTH0D11286g8.678ON6783613725e-36
Kpol_1050.1033.479ON6973423725e-36
KLTH0F14498g3.479ON7024173718e-36
NDAI0B057703.479ON7634163719e-36
TDEL0A062408.678ON6373953672e-35
Ecym_23958.678ON6873843663e-35
CAGL0M02189g8.678ON6723683645e-35
Kpol_505.393.479ON6923453602e-34
YPL155C (KIP2)8.678ON7063723566e-34
SAKL0F03168g3.479ON7064113549e-34
NDAI0E02090singletonON6854243521e-33
Smik_6.3528.678ON7153793522e-33
NCAS0C013508.678ON6553543467e-33
Suva_16.1558.678ON7043713442e-32
Ecym_44073.479ON7113473423e-32
KLTH0G03850g5.531ON4731733334e-32
ACR145W8.678ON6853783405e-32
KNAG0J017208.678ON6253513305e-31
KLLA0B00759g5.531ON4562613229e-31
TPHA0D041903.479ON6723382985e-27
KLTH0G01606g3.528ON8191743006e-27
TBLA0C018808.678ON4683282865e-26
Kpol_1019.112.633ON6475382889e-26
CAGL0I07029g3.528ON7051752791e-24
KNAG0A078803.479ON7641532792e-24
Ecym_12003.528ON8331562764e-24
KAFR0B065903.479ON7061482755e-24
TDEL0B072702.633ON6444452631e-22
YPR141C (KAR3)3.479ON7291442622e-22
Skud_16.4353.479ON7291442593e-22
Smik_16.3883.479ON7291442585e-22
Suva_16.4693.479ON7311442585e-22
ZYRO0B04290g3.479ON7311632532e-21
TDEL0F036403.479ON7041522532e-21
Kwal_26.88068.678ON7152052407e-20
TPHA0N016502.633ON6825132335e-19
Suva_11.1452.633ON6573592254e-18
Kwal_55.21164singletonOFF5883031951e-14
Kwal_YGOB_55.211643.479ON6573031952e-14
YKL079W (SMY1)2.633ON6561291763e-12
CAGL0L05104g2.633ON6753901621e-10
KAFR0C040202.633ON6673751568e-10
Skud_11.1482.633ON6561091551e-09
Smik_11.1602.633ON6561091522e-09
KNAG0M025402.633ON5221091522e-09
NCAS0H031802.633ON6602461471e-08
NDAI0C004802.633ON5984581442e-08
TBLA0A008202.633ON8033031353e-07
TBLA0C008002.633ON6931331343e-07
KNAG0H003602.633ON6811341228e-06
ZYRO0E01078g2.633ON6681081201e-05
NCAS0C052002.633ON572152980.005
NCAS0C028308.401ON874131810.59
KAFR0B043205.88ON986159781.6
KLTH0C03014g1.493ON674124762.4
TDEL0E032605.302ON60370734.7
ZYRO0C08030g1.162ON711105734.9
KLTH0D11902g8.704ON819138735.0
Kwal_33.148407.364aON20594715.3
TPHA0A032007.300ON113478736.4
TBLA0E046604.322ON85474719.0
KLTH0H02750g6.277ON101961719.5
YHR023W (MYO1)5.267ON1928160719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR010C
         (945 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...  1891   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...  1368   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   994   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   953   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   951   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   942   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   833   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   815   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   794   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   753   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   725   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   720   0.0  
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   608   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   535   e-174
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   536   e-174
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   530   e-172
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   527   e-171
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   524   e-170
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   503   e-162
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   469   e-150
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   461   e-145
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   372   e-112
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   370   e-111
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   364   e-110
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   367   e-110
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   366   e-109
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   362   e-108
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   357   e-106
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   356   e-106
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   357   e-106
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   355   e-105
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   354   e-105
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   354   e-105
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   353   e-105
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   330   7e-96
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   290   2e-82
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   195   4e-53
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   192   9e-51
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   187   2e-49
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   187   3e-49
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   182   1e-48
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   168   5e-44
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   166   4e-43
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   169   6e-43
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   168   3e-42
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   167   4e-42
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   167   4e-42
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   162   6e-42
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   167   8e-42
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   164   9e-42
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   165   2e-41
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   163   9e-41
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   162   2e-40
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   162   3e-40
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   161   6e-40
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   159   1e-39
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   159   1e-39
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   158   1e-39
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   159   1e-39
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   158   2e-39
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   158   3e-39
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   157   1e-38
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   155   3e-38
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   155   5e-38
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   154   6e-38
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   154   7e-38
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   154   8e-38
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   153   8e-38
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   152   9e-38
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   154   1e-37
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   152   2e-37
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   151   4e-37
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   149   1e-36
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   148   3e-36
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...   148   3e-36
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   147   5e-36
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   147   5e-36
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   147   8e-36
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   147   9e-36
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   145   2e-35
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...   145   3e-35
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...   144   5e-35
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   143   2e-34
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...   141   6e-34
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   140   9e-34
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   140   1e-33
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   140   2e-33
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   137   7e-33
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...   137   2e-32
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   136   3e-32
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   132   4e-32
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   135   5e-32
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....   131   5e-31
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   128   9e-31
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...   119   5e-27
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   120   6e-27
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...   114   5e-26
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...   115   9e-26
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   112   1e-24
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   112   2e-24
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   110   4e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   110   5e-24
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...   105   1e-22
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   105   2e-22
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   104   3e-22
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   103   5e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   103   5e-22
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   102   2e-21
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   102   2e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...    97   7e-20
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    94   5e-19
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    91   4e-18
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    80   1e-14
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    80   2e-14
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    72   3e-12
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    67   1e-10
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    65   8e-10
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    64   1e-09
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    63   2e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    63   2e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     61   1e-08
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    60   2e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    57   3e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    56   3e-07
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    52   8e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    51   1e-05
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    42   0.005
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     36   0.59 
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    35   1.6  
KLTH0C03014g Chr3 (266161..268185) [2025 bp, 674 aa] {ON} simila...    34   2.4  
TDEL0E03260 Chr5 (614135..615946) [1812 bp, 603 aa] {ON} Anc_5.3...    33   4.7  
ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} simila...    33   4.9  
KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {...    33   5.0  
Kwal_33.14840 s33 complement(836195..836812) [618 bp, 205 aa] {O...    32   5.3  
TPHA0A03200 Chr1 (700189..703593) [3405 bp, 1134 aa] {ON} Anc_7....    33   6.4  
TBLA0E04660 Chr5 (1188116..1190680) [2565 bp, 854 aa] {ON} Anc_4...    32   9.0  
KLTH0H02750g Chr8 complement(245136..248195) [3060 bp, 1019 aa] ...    32   9.5  
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    32   9.8  

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score = 1891 bits (4898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 918/945 (97%), Positives = 918/945 (97%)

Query: 1   MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINT 60
           MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINT
Sbjct: 1   MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINT 60

Query: 61  TDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGK 120
           TDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGK
Sbjct: 61  TDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGK 120

Query: 121 TYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDE 180
           TYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDE
Sbjct: 121 TYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDE 180

Query: 181 SHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQ 240
           SHDSSKRLRIFD                PREPEVAHNGFSRRRQRPPPVKANRMSATKQQ
Sbjct: 181 SHDSSKRLRIFDSSSMNHSSRASSQSNSPREPEVAHNGFSRRRQRPPPVKANRMSATKQQ 240

Query: 241 LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 300
           LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN
Sbjct: 241 LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 300

Query: 301 CDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIP 360
           CDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIP
Sbjct: 301 CDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIP 360

Query: 361 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMM 420
           FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMM
Sbjct: 361 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMM 420

Query: 421 KDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLT 480
           KDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLT
Sbjct: 421 KDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLT 480

Query: 481 SQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALH 540
           SQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALH
Sbjct: 481 SQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALH 540

Query: 541 TMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNI 600
           TMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNI
Sbjct: 541 TMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNI 600

Query: 601 TTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLT 660
           TTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETV           NALTNKLT
Sbjct: 601 TTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVSSLKSELSSYSNALTNKLT 660

Query: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720
           EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR
Sbjct: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720

Query: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780
           TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL
Sbjct: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780

Query: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYF 840
           SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYF
Sbjct: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYF 840

Query: 841 KESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKN 900
           KESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKN
Sbjct: 841 KESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKN 900

Query: 901 AITSKASSRSMSPIKTLDTNVRIISPVKRGTIEFGAEGPPTKKVR 945
           AITSKASSRSMSPIKTLDTNVRIISPVKRGTIEFGAEGPPTKKVR
Sbjct: 901 AITSKASSRSMSPIKTLDTNVRIISPVKRGTIEFGAEGPPTKKVR 945

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score = 1368 bits (3540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/939 (70%), Positives = 779/939 (82%), Gaps = 3/939 (0%)

Query: 8   TRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIA 67
           T+K  MLDD  EELNITVAVRCRGRNEREIKAKS+VVVTVPDVTGSNEVSINTT ++GIA
Sbjct: 8   TKKRTMLDDGNEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIA 67

Query: 68  AKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD 127
            KMNSRTYTVD+VFGPSADQ LIFK IAEPLFDDF+KGYNCTVLVYGMTSTGKTYTMTGD
Sbjct: 68  GKMNSRTYTVDQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD 127

Query: 128 EKLYDGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKR 187
           EKLYDG+LSDSAGIIPR++F+LFD LEAT+SD LVKCSYIELYNEELKDLLD++ D SKR
Sbjct: 128 EKLYDGELSDSAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYSKR 187

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
           LRIFD                P+E +   +  ++RR    P K  R S  KQ L E  S 
Sbjct: 188 LRIFDSNTITNSRAGSQNNS-PKEQDGTSSSMAKRRYTHIPTKPKRPSLNKQLLYEQSSA 246

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR 307
           IY+QN+QEFHI NAREGI+VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK+ +GELFR
Sbjct: 247 IYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYEGELFR 306

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 367
           +SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT
Sbjct: 307 ISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 366

Query: 368 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKN 427
           RLLQDSLGGNTKTALIATISPAKINADETSSTLEYA KAKNIKNRPQLG+ MMKDILVK+
Sbjct: 367 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKDILVKS 426

Query: 428 ISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLL 487
           ISSEL+K+KSDFLSTK+K+GIYMSHEHYQE+VNDLEN QTEIQESKRQ+ES +SQN+LLL
Sbjct: 427 ISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQNSLLL 486

Query: 488 KDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLK 547
           KDKKASQ++ ELQ+ KI +LQ+TIEYL DKIERQH NE +L +TIHKLKEALHTM+GSL+
Sbjct: 487 KDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTMKGSLQ 546

Query: 548 SYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDT 607
           +YETHELRLQNDIKEVLYQGITSYRESM+QHLE VK  MLDKNLSI  N++ I TIF +T
Sbjct: 547 NYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRTIFHET 606

Query: 608 LKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENN 667
           L SV + GSDMC  +VK++K+ PS   ++F E +             LTNKLTE++EENN
Sbjct: 607 LDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEMTEENN 666

Query: 668 HLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSM 727
           +++EYLD+H  KN+ QE+LDLRME  Y K K  SD L+S +VSM+ +H+EESR LM++SM
Sbjct: 667 NMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNLMLSSM 726

Query: 728 KDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKS 787
           KD V+E+ID E  +FQP+++RW+ S +NIN+CDA+HQ FE KST  L  LKEL+D S+ +
Sbjct: 727 KDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELADNSVVA 786

Query: 788 SEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGF 847
           ++D   + +    +F   V++    +S+ KQM+DI+DKH+MLEDHF++N+KYFKESSKGF
Sbjct: 787 ADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDINDKHKMLEDHFENNIKYFKESSKGF 846

Query: 848 EDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKAS 907
           E+MDCSIKKII EMSPEVGDIK +E L+ER+N+R+F P+  TGKTP R  LKN I  K  
Sbjct: 847 EEMDCSIKKIIREMSPEVGDIKQIEALLERVNSRSFGPIASTGKTPMRPELKNPI-PKTR 905

Query: 908 SRSMSPIKTLDTNVRIISP-VKRGTIEFGAEGPPTKKVR 945
           SRSMSPIK+LDTNV  + P +KRGT++   +GP  KK++
Sbjct: 906 SRSMSPIKSLDTNVVHVVPLIKRGTMDIEVDGPAMKKIK 944

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  994 bits (2571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/933 (55%), Positives = 667/933 (71%), Gaps = 37/933 (3%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           +ELNITV+VRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDE+GI A+MNS+TYTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGPSADQSLIFK+IAEPLFDDF+KGYNCTVLVYGMTSTGKTYTMTGDE+LYDG+LSD+
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDXXXX 196
           AGIIPRI+FKLFD LE  D D+LVKCS+IELYNEELKDLL+E  +S   K+LRIFD    
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFDSNTT 194

Query: 197 XXXXXXXXXXXXPREPEVAHNG-FSRRRQRPPPVKAN---------------RMSATKQQ 240
                       P    V  +G F R  + P P K                 R+   KQQ
Sbjct: 195 SSNSRNNSRNNSPN--LVGTSGTFKRIFKTPVPYKQQQQHQQHLQQQQQQQPRLINNKQQ 252

Query: 241 -LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK 299
            LSE  S IY+QN+QEFHI NA++GIN+LQ+GLKHRQVASTKMNDFSSRSHTIFTIMLYK
Sbjct: 253 SLSEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYK 312

Query: 300 NCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI 359
           N +GE+FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HI
Sbjct: 313 NHNGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHI 372

Query: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALM 419
           PFRESKLTRLLQDSLGGNTKTALIATISPAKINA+ETSSTLEYA KAKNIKN+PQLG L+
Sbjct: 373 PFRESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLV 432

Query: 420 MKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESL 479
           MKDILVKNI+ ELAKIKSDFLSTKSKDGIYM+ +HY+E+ +DLEN +TE+QE KR+IE +
Sbjct: 433 MKDILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKM 492

Query: 480 TSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEAL 539
            SQN LLLKDK+AS EV+ELQ  KIK L   I +LYDK+++QH NE +L  TIH LK+A+
Sbjct: 493 NSQNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAI 552

Query: 540 HTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINN 599
           +T+Q SLK+ E ++L+ ++++++VLY  +TS+++S+++ L  +K S   ++L I  NI+ 
Sbjct: 553 YTVQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDI 612

Query: 600 ITTIFDDTLKSVEANGSDMCDTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKL 659
           I       L+S+ +   D+C + V+ I E+   + +     +           N L   L
Sbjct: 613 IQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNL 672

Query: 660 TEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEES 719
            +ISEE N+ REYL++HLFKN+ +E L + ++  Y  +K  + +L SK   M+ +H+EE+
Sbjct: 673 GDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEEN 732

Query: 720 RTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKE 779
           ++LM+ S+K   +E++  E  LF P++ +W +S +NIN+CD+ +  F++     L +L+ 
Sbjct: 733 KSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEG 792

Query: 780 LSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKY 839
             + SL+ S++     K     F    + L  +  +   ++++ +KH  L D  +    Y
Sbjct: 793 NIEGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSY 852

Query: 840 FKESSKGFEDMDCSIKKIIHEMSPE--VGDIKSVETLMERINARTFSPVRPTGKTPSRQV 897
            + +++ FE +D  I++II +  P   VG+ + V  ++E++      P+    +TP    
Sbjct: 853 IEAANEKFEGIDQFIRQIIDKKLPTHLVGNGELVNVMLEQLGKTHLKPIGSASRTP---- 908

Query: 898 LKNAITSKASSRSMSPIKTLDTNV-RIISPVKR 929
                    SSRS+SP+KTLD N+   ISP KR
Sbjct: 909 ---------SSRSVSPMKTLDNNIFNGISPSKR 932

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/944 (52%), Positives = 668/944 (70%), Gaps = 38/944 (4%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           +ELNITVAVRCRGRNE+EIKAKSSVVV  PDV G+NEVSINT+ ++GI A+MNS+TYTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGPSADQSL+FKEIA+P+F DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYDG+LS++
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDS----SKRLRIFDXX 194
           AGIIPR++FKLFD LE  +SD++VKCS+IELYNEELKDLLD+  DS    S++LRI+D  
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDSL 190

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQR------PPP-------------------V 229
                          R      N  ++RR R      P P                    
Sbjct: 191 NSSNNVTNVNSRSSSRSNSPTVNLEAKRRIRAGALYKPKPKLPTQSQSNGQQQQQQQQQQ 250

Query: 230 KANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRS 289
           +  +   T+ Q++E  S IY+Q++QEFHI +A+EG+ +LQKGL HRQVASTKMND SSRS
Sbjct: 251 QQQQQQQTQGQVNEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRS 310

Query: 290 HTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 349
           HTIFT+ LYKN +GE FRVSK+NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI
Sbjct: 311 HTIFTLTLYKNFNGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI 370

Query: 350 NSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
           NSLADK+ HIPFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ETSSTLEYA KAKNI
Sbjct: 371 NSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNI 430

Query: 410 KNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEI 469
           KN+PQLG+ MMKDILVKNIS ELAK+KSDFLSTKSK+GIYMSH HY E++ND+EN +TEI
Sbjct: 431 KNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEI 490

Query: 470 QESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELA 529
           QES+R+IE L+SQN LL KDKK+SQ+  E Q  +I+ LQS+++YLY+KI+ +H NE EL 
Sbjct: 491 QESRREIEKLSSQNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELT 550

Query: 530 TTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDK 589
             I KLK+A+  MQG+LK++E HE RLQ+DI+++LY  I  YR  +   L+ +K   L++
Sbjct: 551 NMIMKLKDAVRNMQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQ 610

Query: 590 NLSIKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKETPSMY---LKEFNETVXXXX 645
           + +I ++INN+    +  L++V+ +   MC+ L  K++ + P  +   L E N+      
Sbjct: 611 SFTIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMF---- 666

Query: 646 XXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLL 705
                  + L   L++I+ ENN+L+ YLD H F+N+ QE+L++  +  Y ++   S  L+
Sbjct: 667 SKVDEHTDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLM 726

Query: 706 SKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQN 765
           SK+ +++  HVE++RTL+++++K    E+I  E S F+P+R  W  S ++IN CD+    
Sbjct: 727 SKITNIISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNK 786

Query: 766 FEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDK 825
           F+  +T  L+ LK   +++++ S    +K K     F D         ++   + DI +K
Sbjct: 787 FKDDTTESLNSLKSHMESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNK 846

Query: 826 HRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSVETLMERINARTFSP 885
           H +L D  + NV +   SS+GF+ +D S+K+I++   PE       + L++ I++ + +P
Sbjct: 847 HSVLRDELEKNVSFIHASSEGFKAIDSSLKRIMNFRMPEGKTETLADDLIKHIDSSSVAP 906

Query: 886 VRPTGKTPSRQVLKNAITSKASSRSMSPIKTLDTNVRIISPVKR 929
           V  +GKTP R +LK+    ++ S+S+SP K+    + I SP+KR
Sbjct: 907 VASSGKTPLRPLLKSETKQRSLSKSVSPAKSSHATI-INSPLKR 949

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  951 bits (2459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/926 (53%), Positives = 653/926 (70%), Gaps = 19/926 (2%)

Query: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77
           +EELNITVAVRCRGRNE+E+KAKSSVVV VPDVTG+NEVSINTT + GI A++NS+TYTV
Sbjct: 4   EEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137
           D+VFGPSADQ LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LYDG+LS+
Sbjct: 64  DRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 138 SAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDXXX 195
            AGIIPR++FKLFDAL+A + D+++KCS+IELYNEELKDLLDE+ DSS  ++LRIFD   
Sbjct: 124 GAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSVT 183

Query: 196 XXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPV-KANRMSATKQQLS-ESGSGIYVQNV 253
                        P+ PE + +G ++RR RP  + K +R    K  LS E  S I++QN+
Sbjct: 184 NPNSSRSSSRNSSPKPPEGSTSG-TKRRIRPNTMYKPSRSPTVKPTLSSELNSAIHIQNL 242

Query: 254 QEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNL 313
           QEFHI++A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLY+ C+GE FRVSKMNL
Sbjct: 243 QEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGESFRVSKMNL 302

Query: 314 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDS 373
           VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLTRLLQDS
Sbjct: 303 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLTRLLQDS 362

Query: 374 LGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELA 433
           LGGNTKTALIATISPAKIN++ETSSTLEYA KAKNIKN+PQ+G+ +MKD+LVKN+++EL 
Sbjct: 363 LGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLVKNVTAELV 422

Query: 434 KIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKAS 493
           KI+SD L+TKSKDGIYMS E+Y+E+ N+LEN +TE+QE KR IE L++QN LL K+K+ +
Sbjct: 423 KIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGLLTKEKRIT 482

Query: 494 QEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHE 553
            EV E Q  KIKKL + I++LYDKI+RQH NE EL+  + +L  AL TMQ SLK YE   
Sbjct: 483 NEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNSLKVYEDQG 542

Query: 554 LRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEA 613
            R Q +++ VLY+ I S++ S+   +EK+K +  D    +  NI+ +T   +     +  
Sbjct: 543 HRFQTEMERVLYENIGSFKHSLLNEIEKLKGTEED-GFDVDANIDTLTKELNRIYDFINT 601

Query: 614 NGSDMCDTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYL 673
           +  ++C   +  I E    YL++    V           + L   L+ ISEE NHL++YL
Sbjct: 602 STIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSISEEYNHLKDYL 661

Query: 674 DQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNE 733
           ++H FKN+ Q+ LD+ ++  Y ++K  ++ +  KL  M+   +E ++ +M+ S+K+  +E
Sbjct: 662 NEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIMMQSLKNAASE 721

Query: 734 IIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVN 793
           ++  E  L  P++  W +S +NIN+CD  +  FE    S +  + E  +  L+ SE AV 
Sbjct: 722 VVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINEGLQFSESAVG 781

Query: 794 KAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCS 853
            A      F D  + L  D  +   + +I  KH ML+    D+  Y + +++ F ++D S
Sbjct: 782 DANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAATQKFGEIDDS 841

Query: 854 IKKIIHEMSPEVGDIKS---VETLMERINARTFSPVRPTGKTPSRQVLKNAITS------ 904
           I+ +++  S  V    S   +E L+E++N +   P+ P+GKTP R + +  I S      
Sbjct: 842 IQGLLN--SQAVSQPHSENRIEGLLEQLNGKPLKPLGPSGKTPMR-ITQGCIASSDQLSL 898

Query: 905 -KASSRSMSPIKTLDTNVRIISPVKR 929
            +  S S+SPI+ +D N +  SP KR
Sbjct: 899 PRKRSYSISPIREIDGNRKASSPFKR 924

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/931 (51%), Positives = 653/931 (70%), Gaps = 13/931 (1%)

Query: 13  MLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNS 72
           M DD  EELNITVAVRCRGRNE+E+KA+SSVVV VPDVTG+NEVSINTT + GI A++NS
Sbjct: 1   MSDD--EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINS 58

Query: 73  RTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132
           +TYTVDKVFGPSADQ LIFK IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDE+LYD
Sbjct: 59  KTYTVDKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYD 118

Query: 133 GQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRI 190
           G+LS+ AGIIPR++FKLFDAL A   D+++KCS+IELYNEELKDLLDE+ DSS  K+LRI
Sbjct: 119 GELSEGAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRI 178

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLS--ESGSGI 248
           FD                  +P    +  +RR+ R P +     S   + +S  E  S I
Sbjct: 179 FDSVSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKPVSPCEPSSAI 238

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRV 308
           ++QN+QEFHI++A+EGI +LQ+GL+HRQVASTKMND SSRSHTIFTIMLYK C+GE FRV
Sbjct: 239 HIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFRV 298

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTR 368
           SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS+HIPFRESKLTR
Sbjct: 299 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLTR 358

Query: 369 LLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNI 428
           LLQDSLGGNTKTALIATISPAKIN++ETSSTLEYA KAKNIKN+PQ+G+ +MKD+L+K++
Sbjct: 359 LLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKSV 418

Query: 429 SSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLK 488
           ++EL KIKSD LSTKSKDGIYMS E+Y+E+ N+LEN +TE++E KR +E +++QN+LL+K
Sbjct: 419 TAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLIK 478

Query: 489 DKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKS 548
           +K+ S EV E Q  K++KL + IE+LYDKI+RQH NE EL+  + +L  ALHTMQ SL+ 
Sbjct: 479 EKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLRI 538

Query: 549 YETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTL 608
           YE    R   +++ VLY  I S+++S+   +EK+K+++ +    ++ N++ +TT      
Sbjct: 539 YEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVDAVTTELTRIF 598

Query: 609 KSVEANGSDMCDTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNH 668
             + ++  ++    +K + +    Y K+    V           + L   L+ ISEE N+
Sbjct: 599 DFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIHLSSISEEYNN 658

Query: 669 LREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMK 728
           L++YL++H FKN+ QE LD+ ++  Y ++K  ++ +  KL  M+   ++ ++  M+ S++
Sbjct: 659 LKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDTNKEFMMQSLR 718

Query: 729 DTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSS 788
              +E++  E  L  P++  W  S +NIN+CD  +  FE K    ++++ +  D   K+S
Sbjct: 719 HAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIFKTIDQGQKTS 778

Query: 789 EDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFE 848
           +     AK            L  +  + + +  I  KH +L+    D+  Y + +++ F 
Sbjct: 779 QVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSANYMQAATQKFG 838

Query: 849 DMDCSIKKIIHEMS-PEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNA------ 901
           ++D SI+ +++  + P+      ++ L+E++N ++  P+ P+GKTP R V ++       
Sbjct: 839 EIDNSIQDLLNAQTIPQPQSENPIDGLLEQLNDKSLKPLGPSGKTPMRTVQRSVTNTDQL 898

Query: 902 ITSKASSRSMSPIKTLDTNVRIISPVKRGTI 932
           +  + SS ++SPIK +D N R+ SP KRG +
Sbjct: 899 LPPQKSSYTISPIKEIDGNRRLTSPHKRGVV 929

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/936 (49%), Positives = 625/936 (66%), Gaps = 47/936 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVRCRGRNEREIKAKSSVVV+VPDVTGSNEVSINTT +VGI A++NS+TYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           +VFGPSA+QSL+F++IAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYDG+LS+S
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHD--SSKRLRIFDXXXX 196
           AGIIPRI+FKLF+ LE    D++VKCS++ELYNEELKDLL +S +  SS++LRIFD    
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDSNTM 192

Query: 197 XXXXXXXXXXXXPREP---------EVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
                        +           E+    F R+R +  P     ++ + Q   +  +G
Sbjct: 193 SAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAP----SVTQSHQNSQDQNAG 248

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR 307
           IY+QN+Q+FHI NA+EGI +LQKGLKHRQVA+TKMNDFSSRSHTIFTI LYK  +GE+FR
Sbjct: 249 IYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFR 308

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 367
           VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQSLLTLGRVINSL DKS+H+PFRESKLT
Sbjct: 309 VSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLT 368

Query: 368 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKN 427
           RLLQDSLGGNTKTALIATISPAKIN++ET STL+YAAKAKNIKN+PQLG+++MKDILVKN
Sbjct: 369 RLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKN 428

Query: 428 ISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLL 487
           I+ ELAKIK+D LSTKSK+GIYMS ++Y+E+ NDLE+ +TE++E KR IE+LTSQN LLL
Sbjct: 429 ITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLL 488

Query: 488 KDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLK 547
           KDKKAS EV +LQ  K++ ++  +  LY K E+Q+  E  L  T   LK  + TMQ  +K
Sbjct: 489 KDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIK 548

Query: 548 SYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDT 607
            +E  E  +++ + ++        ++++  ++  ++  +  +N+ ++ NI++I       
Sbjct: 549 EHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKL 608

Query: 608 LKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEEN 666
           L+  +    DM  D + K++ ETP  + +   E V             LT  L+++SEE 
Sbjct: 609 LERAQQQTDDMYKDCVEKILDETPG-HFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEF 667

Query: 667 NHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNS 726
           N+LR+YL+ H FKN+ +E+L   ++  Y  ++  +D L  +   M+  H+E+++ LM+ S
Sbjct: 668 NNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLES 727

Query: 727 MKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLK 786
           +K    ++I  E  LF+P + +W  S   IN+CD+ +  F+    S L  +K    ++L 
Sbjct: 728 LKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIK----STLG 783

Query: 787 SSEDAVN----KAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKE 842
           SS++A+N    K K + D        L   +   +Q   I +K  +L +    +V    +
Sbjct: 784 SSQEAINKTITKVKEQMDEHESPASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSD 843

Query: 843 SSKGFEDMDCSIKKIIHEM--SPEVGDIKSVETLMERINARTF-----SPVRPTG----- 890
            +   + +  +I  ++ E   S E   ++ V+ ++ R++ +       SP+RP       
Sbjct: 844 HADAVDKLKEAIDHVVSERGSSMEGERVEHVDGILRRMDEQNLLYLDRSPLRPANFKMNK 903

Query: 891 ---KTPSRQVLKNAITSKASSRSMSPIKTLDTNVRI 923
               +P+R       +S   S S SP K    + RI
Sbjct: 904 SERNSPNR-------SSPCKSVSHSPCKQPVCHPRI 932

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/923 (48%), Positives = 608/923 (65%), Gaps = 51/923 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVR RGRNEREI+AKSSVVV+VPDV GS+EV+INTTD+VGI A+MNS+TY VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGPSA+Q LIFKEIAEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+ +LSDS
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS--KRLRIFDXXXX 196
           AGIIPRI+FKLF+ L+  D D++VKCS++ELYNEELKDLLD+S ++S  ++LRI+D    
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYDSGSG 192

Query: 197 XXXXXXXXXXXXPREPEVAHNGF-SRRRQRPPPVKANRMSATKQQ--------------- 240
                          P++  +   +RRR R  P+ +   S  KQQ               
Sbjct: 193 SNSNSGSRKNSRNNSPKLVTDPMINRRRMRTVPLSS---SLAKQQHQWQQRREQQHQLRE 249

Query: 241 --------------------LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVAST 280
                                 +S SG+Y+QN+Q+FHI +AR+G+ +LQKGL++RQVA+T
Sbjct: 250 QQQREQQAQQQQKEQQQREQQQDSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATT 309

Query: 281 KMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQ 340
           KMNDFSSRSHTIFTI LY+   GE+F+VSKMNLVDLAGSENISRSGAQ+QRAKEAGSINQ
Sbjct: 310 KMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQ 369

Query: 341 SLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTL 400
           SLLTLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAKIN++ET STL
Sbjct: 370 SLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTL 429

Query: 401 EYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVN 460
           +YA+KAKNIKNRPQL + +MKDILVKNI++ELAK+KSD LSTK ++G+YMS ++Y+EI N
Sbjct: 430 QYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITN 489

Query: 461 DLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIER 520
           DLE+ +TEIQESKR IE L+SQN+LLLKDKKAS EV ELQ  K++ ++  +  L +K+E 
Sbjct: 490 DLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLES 549

Query: 521 QHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLE 580
           QH  E EL      LK  L   Q  +K Y   E ++   ++ +L Q    +R+ +  ++E
Sbjct: 550 QHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIE 609

Query: 581 KVKVSMLDKNL-------SIKENINNITTIFDDTLKSVEANGSDMC-DTLVKLIKETPSM 632
            ++ +    ++        I++N+N +     + L   +     M  D + K+++E P++
Sbjct: 610 DIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTV 669

Query: 633 YLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMES 692
           + +  +  V             LT  L++ISE  N+L++Y + H FKN+ +EVL+  ++ 
Sbjct: 670 F-QAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDK 728

Query: 693 VYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIAS 752
            YQ+++  +D LL K   M+  H+++++TLM+ S++    E ID E  LF+P R +W  S
Sbjct: 729 TYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEES 788

Query: 753 CDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCD 812
            D IN CD+    F     S L  +K    +S      +V+K K     + D    L  +
Sbjct: 789 FDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVKDEVKGYEDASTILDGN 848

Query: 813 QSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEMSPEVGDIKSVE 872
           + +K+Q+ DI +K   L +    ++K  +     F+++   I+  I   +  +   K   
Sbjct: 849 EVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRNTIASENSTLHQNKIAT 908

Query: 873 TLMERINARTFSPVRPTGKTPSR 895
           T     N+   SP++PT   P++
Sbjct: 909 TPPLGQNSER-SPLKPTVLQPNQ 930

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/925 (47%), Positives = 612/925 (66%), Gaps = 67/925 (7%)

Query: 20  ELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDK 79
           ELNITVAVRCRGRNEREI +KS VVVTVPD+TG+ E+SINTT E GI A+MNS+TYTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 80  VFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG--QLSD 137
           VFGP+ADQ LIF+E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY     LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 138 SAGIIPRIMFKLFDALE--------ATDSDFLVKCSYIELYNEELKDLLD-ESHD----- 183
           +AGIIPRI+FKLFD L+         + +DF+VKCS++ELYNE+LKDLL+ +S+D     
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 184 ---SSKRLRIFDXXXXXXXXXXXXXXXX-------PREPEVAHNG-FSRRRQRPPPVKAN 232
               S++LRIFD                       PR   +  N   +    R   ++ N
Sbjct: 208 QQLGSRKLRIFDSTNNNNNNSNSNASSRASSRNNSPRTSSILPNANATNLAMRKKSIRYN 267

Query: 233 RMSATKQQLS------------------ESGSGIYVQNVQEFHIINAREGINVLQKGLKH 274
             S  K + S                  E+ +GIY+QN+QEFHI NA+EG+++LQKGLKH
Sbjct: 268 YNSNNKAKSSNNTRPNTNDEPSSIAGPDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKH 327

Query: 275 RQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKE 334
           RQVASTKMNDFSSRSHTIFTI LYK     LFR+SKMNLVDLAGSENI+RSGA NQRAKE
Sbjct: 328 RQVASTKMNDFSSRSHTIFTITLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKE 387

Query: 335 AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAD 394
            GSINQSLLTLGRVINSLADKS H+PFRESKLTRLLQDSLGGNTKTALIATISPAK+ ++
Sbjct: 388 TGSINQSLLTLGRVINSLADKSPHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSE 447

Query: 395 ETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEH 454
           ET STLEYA+KAKNIKN+PQLG++++KDIL+KNI+SELAK+KSD +STKSKDGIYMSHEH
Sbjct: 448 ETCSTLEYASKAKNIKNKPQLGSVILKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEH 507

Query: 455 YQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYL 514
           YQE++ +LE+ +TE+QESKR IE L+SQN++LLKDK+++ EV ELQ  K+  L+ ++  L
Sbjct: 508 YQELIMELESSKTEVQESKRMIEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNL 567

Query: 515 YDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRES 574
            +K+E Q+  ET+L   I +L+++   +   +K+Y+T + +L+  I  +L + +   ++ 
Sbjct: 568 NEKLEIQNGKETKLMEQIGQLEKSREKLNSLVKNYQTKQSQLKTQISNILNENLFELKKI 627

Query: 575 MNQHLEKVKVS--MLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVKLIKETPSM 632
           +N H + ++ S    D  +++K   + IT++ + T    E    +  +   + +++TP +
Sbjct: 628 LNSHKDAIRQSEGNFDVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIE---EFLEQTP-I 683

Query: 633 YLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMES 692
            L++  E V           N +T  L++ISEE N+L++YLD   F+N+ +++L++ + +
Sbjct: 684 NLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINA 743

Query: 693 VYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIAS 752
               +   S +L +K   M+ AH+ E++ LM+++ +   N++I  E  LF+P R++W  S
Sbjct: 744 TSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEES 803

Query: 753 CDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHR-----TDSFHDFVQ 807
            + IN+CD+ +  F    T  + K+K    +S  S  +A+   K +     ++   D   
Sbjct: 804 IELINRCDSINNGFHHNMTGQVSKIKTNLASSSSSIHNAIASIKSQVLEQLSNDDSDVKT 863

Query: 808 KLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIK----KIIHEMSP 863
            L  D    K  ++I +K+ +L+ +  + + Y  +S    +++  ++K     I+ +++ 
Sbjct: 864 ALENDPMFNKHFNEIIEKNMILQKNRKNAINYTDKSLLNIDELSETVKIALNNIVDDVAI 923

Query: 864 EVGDIKSVETLMERINARTFSPVRP 888
             GD  S  T       +T S +RP
Sbjct: 924 TDGDDNSPGT-------KTKSKLRP 941

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/864 (47%), Positives = 567/864 (65%), Gaps = 52/864 (6%)

Query: 17  AQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYT 76
           A EELNI VAVRCRGRNEREIKAKSSVVV VPD   +NEVSINTTD+VGIAAKMNS+TYT
Sbjct: 28  ATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYT 87

Query: 77  VDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLS 136
           VDKVFGPSA Q L+++EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKL++G+L 
Sbjct: 88  VDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELG 147

Query: 137 DSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----KRLRIF- 191
           D+AGIIPR++F+LFD LEA   D+LVKCS++ELYNEELKDLLD ++ ++    K+LRIF 
Sbjct: 148 DAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFD 207

Query: 192 --------------------------DXXXXXXXXXXXXXXXXPREPEVA---HNGFSRR 222
                                     D                    +++   HN FSR 
Sbjct: 208 SNVNGTSASGSSSRSSSRNNSPRSAPDNSRAQMLRRKLGRHNTTGNSKISNNNHNKFSRF 267

Query: 223 RQRPPPVKANRMSATKQQLS----------------ESGSGIYVQNVQEFHIINAREGIN 266
           +Q          S   Q +                 +  + IY+QN++EFHI +A EG+ 
Sbjct: 268 KQTSQESTRAHASNNHQNVHIPNNNSNNTNQQQSPIDQSASIYIQNLEEFHITSAMEGLQ 327

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSG 326
           +LQKGLK RQVASTKMNDFSSRSH+IFTI LYK  +GELFRVSKMNLVDLAGSENISRSG
Sbjct: 328 LLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQNGELFRVSKMNLVDLAGSENISRSG 387

Query: 327 AQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATI 386
           A NQRAKEAGSINQSLLTLGRVINSLADKS HIPFRESKLTRLLQDSLGGNTKTALIATI
Sbjct: 388 AMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFRESKLTRLLQDSLGGNTKTALIATI 447

Query: 387 SPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKD 446
           SPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MKDILV++I+SELAKIKSD LSTKSK+
Sbjct: 448 SPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKDILVRSITSELAKIKSDLLSTKSKE 507

Query: 447 GIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKK 506
           G+YMSHEHY+++  D+E  +TE++ESKR IESLT+QN +L +++ + ++      + I  
Sbjct: 508 GVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQNAMLQQERLSLKDDNACYKANIAS 567

Query: 507 LQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQ 566
           L+  +  L   ++ Q   ET + + +  ++ A   M+ ++  +E  +  LQ  I   +  
Sbjct: 568 LKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEMKKTIHLFEFKQQELQQSISTFISD 627

Query: 567 GITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVK-L 625
            I++ R+++ +H+E ++ +   K+  I  N+  +       +K+ E   S      VK +
Sbjct: 628 EISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMM 687

Query: 626 IKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEV 685
           +KETP ++ +  +  +           + +   L+++SEE N+L++YL  + FKN+ +E+
Sbjct: 688 LKETPRLF-ESVSGRLDNISKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEEL 746

Query: 686 LDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPI 745
           L   +++ Y +++ +S QL+     M+  H++E++  M+ ++    +E+I+NE  +F   
Sbjct: 747 LSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQ 806

Query: 746 RDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDF 805
           R +W  S   INQCD+ + +F     S L +++++  +S  +    ++  + RT +    
Sbjct: 807 RAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDVVSSSRDNIGATISSIQSRTRNRQSI 866

Query: 806 VQKLCCDQSLKKQMHDISDKHRML 829
            + +  +  +++Q+  I  K++ L
Sbjct: 867 EEMIQGNDVIRQQITRIKQKNKSL 890

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/833 (47%), Positives = 551/833 (66%), Gaps = 30/833 (3%)

Query: 14  LDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEV--GIAAKMN 71
           ++D  +E+NI VAVRCRGRN+REIK+KSSV+V+VPDV GSNE+SINT+D++  G+ A++N
Sbjct: 8   IEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLN 67

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S+TYTVDKVFGPSA+Q LIF+EIAEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY
Sbjct: 68  SKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLY 127

Query: 132 DGQLSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS-KRLRI 190
            G LSDSAGIIPR++FKLF+ +E    ++++KCS+IELYNEELKDLL +S+++  K+LRI
Sbjct: 128 KGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKLRI 187

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
           FD                        +  S    R  P+     S     +    + IY+
Sbjct: 188 FDSNLSKSSNN-------NNISRQNSHFISGMDLRKNPINPINNSNDNTAIQNGNASIYI 240

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSK 310
           QN++EFHI NAREGI +LQKGLK+RQVASTKMND SSRSHTIFTI LYK   GE+F++SK
Sbjct: 241 QNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIFKISK 300

Query: 311 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLL 370
           MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS+ADK+IHIPFRESKLTRLL
Sbjct: 301 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKLTRLL 360

Query: 371 QDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISS 430
           QDSLGGNTKTALIATISPAK+NA+ET STLEYA KAK+IKN+PQLG+++MKD+ +K++++
Sbjct: 361 QDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLKDLNN 420

Query: 431 ELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDK 490
           ELAKIK D  STK KDG+YM+  HY+++ NDLE+ +TEIQE  R ++SL  QN LLLKDK
Sbjct: 421 ELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALLLKDK 480

Query: 491 KASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYE 550
           KAS EV +LQ   + ++ +T+  +   +E QH  E  L   +   +E    M+  +K Y 
Sbjct: 481 KASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKTVIKEYS 540

Query: 551 THELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENI-NNITTIFDDTLK 609
             E R+Q+++K +    +   +E + ++L  +      +NL ++ N+ +NI  I DD + 
Sbjct: 541 EKEERIQSNMKSIFNDELIKLKELLIENLNGIA----KENLIVQTNVKDNIKLIKDDVI- 595

Query: 610 SVEANGSDMCDTLV-----KLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISE 664
           S+     ++   L      ++IKETP + L+ F+  V             L   L  I +
Sbjct: 596 SIVTESQELSKKLFLEFSQQIIKETP-LILEMFSSDVKKNQELNETYFANLFENLESIKQ 654

Query: 665 ENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMV 724
           + + L EY     FK++   +++  + +    ++     +  +    + A  E++  L++
Sbjct: 655 QYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLIL 714

Query: 725 NSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDAS 784
            ++K   +++I NE + F+  +  W  S   IN CD  + ++  +  + L  +K      
Sbjct: 715 ENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMK----GK 770

Query: 785 LKSSEDAV----NKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHF 833
           L+SS++ +    N+ K   DS +   + L  D+++    + I  K   L DH 
Sbjct: 771 LQSSDEIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHL 823

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/955 (43%), Positives = 589/955 (61%), Gaps = 67/955 (7%)

Query: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77
           +EELNITVAVRCRGRN+REI AKSSVVVTVPD+ GS EV+INT++++G  A+MNS+TYTV
Sbjct: 14  EEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTV 73

Query: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137
           DKVFGPSA QSLIF EIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY+ +LSD
Sbjct: 74  DKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSD 133

Query: 138 SAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLL--DESHDSS--KRLRIFDX 193
           SAGIIPRI+FKLF+ LE  + D +VKCS++ELYNEELKDLL  D ++D+   K+LRIFD 
Sbjct: 134 SAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDS 193

Query: 194 XXXXXXXXXXXXXXXPREPEVAHNG--FSRRRQRPPPVKANRMSATKQQLS--------- 242
                             P++++N   F +++ R   +  +R  A+ ++ S         
Sbjct: 194 LGRDSRSNSRN-----NSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSSMQTIRNTTT 248

Query: 243 -------------ESG---------------SGIYVQNVQEFHIINARE-GINVLQKGLK 273
                         SG               S I        +I N +E  I   ++G+K
Sbjct: 249 TKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFHITTAKEGIK 308

Query: 274 -------HRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSG 326
                  +RQVASTKMNDFSSRSHTIFTI L+K   GE+FR+SKMNLVDLAGSENI+RSG
Sbjct: 309 LLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLAGSENINRSG 368

Query: 327 AQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATI 386
           A NQRAKEAGSINQSLLTLGRVINSLADK++H+PFRESKLTRLLQDSLGGNTKTALIATI
Sbjct: 369 ALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGNTKTALIATI 428

Query: 387 SPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKD 446
           SPAK+  +ET STLEYA+KAKNIKN+PQLG+ +MKDIL+KNI++EL KIKSD LSTKSKD
Sbjct: 429 SPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKSDLLSTKSKD 488

Query: 447 GIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKK 506
           GIYM  +HY+E+  DL+N +TEIQE KR IESLTSQN LLLKDK+   E  ELQ  KI+ 
Sbjct: 489 GIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENNELQRIKIQT 548

Query: 507 LQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQ 566
           +  +++ LY KIERQ   E EL   I    +    +   +   +  E  + +  K +L  
Sbjct: 549 MNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVNSKFKTLLDH 608

Query: 567 GITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMC-DTLVKL 625
            ++   + +N  +E  K   +++N ++ EN+  I +   + L +   N      + + K 
Sbjct: 609 SLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKF 668

Query: 626 IKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLF---KNST 682
           + +TP ++  E N+ V           + +   L+++SEE N+ ++++    +   K   
Sbjct: 669 LSDTPLLF-DEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQ 727

Query: 683 QEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLF 742
            E+L+  + +    +++ S+ ++S + +++  H+  ++ L++NS+ +   E++ NE    
Sbjct: 728 HELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRL 787

Query: 743 QPIRDRWIASCDNINQCDASHQNF----EAKSTSGLDKLKELSDASLKSSEDAVNKAKHR 798
           +P   +W  S + IN+ DA +  F    E+  T+  DK+K+ +D S+ ++   +N+    
Sbjct: 788 KPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTND-SINNNIKKINEHFKT 846

Query: 799 TDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKII 858
            D  H     +  +  +K     I +K+  L +   +      ES K   ++D SI+ ++
Sbjct: 847 NDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVTNESMKKLNELDTSIRTVL 906

Query: 859 HEMSPEVGDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSP 913
            ++  E  DIK   + ++  +   ++   P      R  L NA  ++  ++S  P
Sbjct: 907 KDIDYE-KDIKETNSPLKPSHKHDYNHTIPLDNDKKRSFLNNANDNEMQNQSKIP 960

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/870 (41%), Positives = 552/870 (63%), Gaps = 37/870 (4%)

Query: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77
           ++++NITVAVRCRGRN+REI+AKS +VVTVPDVT + EVSINT+   GI A++ ++TYTV
Sbjct: 22  KDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTV 81

Query: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGQLS 136
           DKV+GP + Q L+F++ AEPLF DFM+GYNCT+LVYGMTSTGKTYTMTGD E   +G ++
Sbjct: 82  DKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVN 141

Query: 137 DSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHD------------- 183
             AGI PRI+ KLF+ L+    D++VKCS++ELYNE+L+DLL E  D             
Sbjct: 142 GQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQP 198

Query: 184 ----SSKRLRIFDXXXXXXXXXXXXXXX---XPREPEVAHNGFSRRRQRPPPVKANRMSA 236
               +SK+LRIFD                    R   +     S R++    +  N  + 
Sbjct: 199 ESLNASKKLRIFDSNNSRSNSPVTNTNNPTHKARSDYLKKKLKSNRKKSLDDMSLNANAG 258

Query: 237 TKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIM 296
            K  +  + +GIY+QN+++FHI  A+EG+ +LQ+GL+ RQVA+TK+ND SSRSHTIFTI 
Sbjct: 259 GKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTIT 318

Query: 297 LYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 356
           LYK    +L+R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADKS
Sbjct: 319 LYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKS 378

Query: 357 IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLG 416
            HIPFRESKLTRLLQDSLGGNTKT LIATISPAKI A+ET STLEYA+KAKNIKN+PQLG
Sbjct: 379 AHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLG 438

Query: 417 ALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQI 476
           + ++KDIL+K++S EL K+++D   TKSK+GIY+S ++Y+E+V+DL+N +TE+ E KR  
Sbjct: 439 SFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTN 498

Query: 477 ESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELA---TTIH 533
           +SL  +N LL K+KK+  E  +   S++  L+S ++ + +K+ + +   T+L+   T ++
Sbjct: 499 DSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMN 558

Query: 534 KLKEALHTM-QGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLS 592
           +++  L ++ +   + +ET + + Q  +K+ L   +T+   S    L+ V       N  
Sbjct: 559 RIQTELKSLIEVYQQKHETSKHKFQRLLKDELAT-LTAKILSQWDTLKNVNSG----NYQ 613

Query: 593 IKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKETPSMYLKEFNETVXXXXXXXXXX 651
           I  +I++I     + L++ + N   +  + +  L+KETP ++ +  ++ V          
Sbjct: 614 IHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIF-QLISDNVGDIRGMTEEH 672

Query: 652 XNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSM 711
              +    +++SEE N  ++YLD   F+N+  E++    + V   ++  SD LL  + + 
Sbjct: 673 YTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNS 732

Query: 712 VGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKST 771
           +  ++  +  ++ NS+ D   ++I+ E  LF P + +W  S D INQ D+    F    T
Sbjct: 733 IQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMT 792

Query: 772 SGLDKLKELSDASLKSSEDAVNK-AKHRTDSFHDFVQKLCCDQSLKKQMHDISDK-HRML 829
             +D +  +   S +S + +++   KH  ++  +  +++  ++ L      I +K + +L
Sbjct: 793 KSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNIL 852

Query: 830 EDHFDDNVKYFKESSKGFEDMDCSIKKIIH 859
                D     +ES  G +++D SI+ +IH
Sbjct: 853 HLVTGDLTVTAQESMDGIQNLDRSIRTLIH 882

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  535 bits (1377), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 284/610 (46%), Positives = 420/610 (68%), Gaps = 2/610 (0%)

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGEL 305
           +GIY+QN++EFHI +A+EGI +LQ+GL++RQVASTKMNDFSSRSHTIFTI LYK  DG++
Sbjct: 301 TGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEHDGKI 360

Query: 306 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 365
           FR+SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK+IHIPFRESK
Sbjct: 361 FRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPFRESK 420

Query: 366 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILV 425
           LTRLLQDSLGGNTKTALIATISPAK+N++ET STLEYAAKAK+IKN+PQLG+++ KDILV
Sbjct: 421 LTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITKDILV 480

Query: 426 KNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNL 485
           KNI+SELAK+K+D LSTKS+DG+YMS  HY+E+ NDLE+ +TE+QE KR I+ LT+QN L
Sbjct: 481 KNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTTQNGL 540

Query: 486 LLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGS 545
           LLKDKKAS EV  LQ  K++ ++ +I +L+D IE+QH  E  L   I KLK     MQ +
Sbjct: 541 LLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIEMQAT 600

Query: 546 LKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFD 605
           +K +   E   Q  +K++  + +   +  + ++LE++   ++  N  +  NI  I     
Sbjct: 601 IKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIKDEVK 660

Query: 606 DTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISE 664
             + + +A  + +  D + +L+KE+P + L   N+ +             L+  ++E++ 
Sbjct: 661 SIIDTTQAEANHVYKDCMEQLMKESP-ILLGSLNDDIIKMQKISDLYNEQLSISISELNI 719

Query: 665 ENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMV 724
           E+N L++YL+   FK+  +E+L+  +E  Y  ++  S  ++ +L + +  ++EESR +++
Sbjct: 720 EHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRNIII 779

Query: 725 NSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELSDAS 784
           +S+K+T ++I+ +E  LF P + +W  S + IN+CD+ +  +    ++ L  +K    ++
Sbjct: 780 DSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSVTST 839

Query: 785 LKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESS 844
               +D V++ +  TD+     +     + + +Q  ++ +K+  LE H ++++   + S 
Sbjct: 840 SDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNESITMNESSI 899

Query: 845 KGFEDMDCSI 854
             F+ +  SI
Sbjct: 900 NAFDKLSESI 909

 Score =  293 bits (749), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 135/177 (76%), Positives = 165/177 (93%), Gaps = 3/177 (1%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           +ELNI VAVRCRGRNEREIKAKSSVVV+VPDV GS+E++INTT++VGIA +MNS+TYTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGPSA+Q LIF+E+AEPLF+DF++GYNCTVLVYGMTSTGKTYTMTGDE+LY+G+LSDS
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDES---HDSSKRLRIFD 192
           AGIIPR++FKLFDA+E  + D+++KCS+IELYNEELKDLLDE    + ++K+LRIFD
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFD 187

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  536 bits (1382), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 302/687 (43%), Positives = 437/687 (63%), Gaps = 17/687 (2%)

Query: 217  NGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQ 276
            N  S  R  PP +  + +    Q   ++ +GIY+QN+QEFHI NA+EG+ +LQKGLK+RQ
Sbjct: 318  NTNSNTRTNPPKLPTSSLETPPQ--DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQ 375

Query: 277  VASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAG 336
            VASTKMNDFSSRSHTIFTI LYK   G LFR+SKMNLVDLAGSENI+RSGA NQRAKE G
Sbjct: 376  VASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETG 435

Query: 337  SINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADET 396
            SINQSLLTLGRVINSLAD++ HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET
Sbjct: 436  SINQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 495

Query: 397  SSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQ 456
             STLEYA+KAKNIKN+PQLG+++ KDIL+KNI++EL+++KSD LSTKSK+GIYMS EHYQ
Sbjct: 496  CSTLEYASKAKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQ 555

Query: 457  EIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYD 516
            +++N+L+N +TE  ESKR IE L+SQN LLLKDK+ S EV ELQ  K+ K Q +I  L +
Sbjct: 556  KLMNELDNHKTEADESKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQE 615

Query: 517  KIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMN 576
            KIE Q+  E  L +++ KL+ +  T +  +++YE  ++ +++ I+++L   + S R  + 
Sbjct: 616  KIEIQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQ 675

Query: 577  QHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVK-LIKETPSMYLK 635
             H  K+K      +  I  N++ I       L + +          ++  +K+TP  + K
Sbjct: 676  DHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENF-K 734

Query: 636  EFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQ 695
            +  E +            A+   L++ISEE N+L++YL+++LF+N+ +++++  + S  Q
Sbjct: 735  KIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQ 794

Query: 696  KVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDN 755
             + N +D L +    M+  H+E +R LM+NS K   +E+I+ E  LF P + +W  S D 
Sbjct: 795  TLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDL 854

Query: 756  INQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCC---- 811
            INQCD+ +  F+ + T GL   +    AS+    D   + K    + +     +      
Sbjct: 855  INQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVV 914

Query: 812  --DQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKIIHEM----SP-- 863
              +Q ++ Q ++++ K+ + +D+ ++++K    S      ++ SIK  + +      P  
Sbjct: 915  EDNQIIRTQFNELARKNSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTE 974

Query: 864  -EVGDIKSVETLMERINARTFSPVRPT 889
             EVG     E   E        P++PT
Sbjct: 975  GEVGVPFKKENGKEGPTKPGLQPLQPT 1001

 Score =  296 bits (757), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 137/179 (76%), Positives = 157/179 (87%), Gaps = 7/179 (3%)

Query: 21  LNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKV 80
           LNITVAVRCRGRNEREIK KSSV+VTVPD+ GSNEVSINTTD+VGI A+MNS+TYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 81  FGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAG 140
           FGPSA+Q LIF E+AEPLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LS+SAG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 141 IIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDE-------SHDSSKRLRIFD 192
           IIPRI+FKLFD LE    D++VKCS+IELYNE+LKDLL++       S  +  +LRIFD
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFD 230

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  530 bits (1365), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 285/600 (47%), Positives = 410/600 (68%), Gaps = 8/600 (1%)

Query: 242 SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301
           ++  +GIY+QN+QEFHI NA EG+N+LQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 308 NDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 367

Query: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361
             ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L D+S HIPF
Sbjct: 368 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPF 427

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421
           RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA MMK
Sbjct: 428 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMK 487

Query: 422 DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481
           DILVKNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR+IESL S
Sbjct: 488 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLAS 547

Query: 482 QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541
           +N+LL+KDK  S+E  + QNS+++ L++TI +L  ++++QH  E E++   +KL++    
Sbjct: 548 KNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEV 607

Query: 542 MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601
           MQ +L+ Y+  EL L    +  + + I S + ++   L+ ++   + +   I+ N++ + 
Sbjct: 608 MQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQETDIQPNLDMVK 667

Query: 602 TIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTN--- 657
                 +++++     M  D + K++ E+P    K FN  V           N   N   
Sbjct: 668 NEVLTLMETMQEKAELMYKDCVKKILNESP----KFFNVIVEKIDIIRIEFQNFYKNIAE 723

Query: 658 KLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVE 717
            L++ISEENN+L++YL  H FKN+ QE+L+  ++S Y+ ++  ++Q +      +  H+E
Sbjct: 724 NLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDHLE 783

Query: 718 ESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKL 777
           E++ L++ +M +  + +ID E  LF+P R +W  S D IN+CD+ +  F     + L ++
Sbjct: 784 ENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLSQI 843

Query: 778 KELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNV 837
           K+  D S  S  ++++  K + +   + +  L  +     Q   +  KH +L+D+ + ++
Sbjct: 844 KKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILKDNIESSI 903

 Score =  285 bits (730), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 10/184 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGP A Q LIF+E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+L+D+
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188
           AGIIPR++ KLFD LE   SD++VKCS+IELYNEELKDLLD + + S          K+L
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 189 RIFD 192
           RIFD
Sbjct: 215 RIFD 218

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  527 bits (1357), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 284/619 (45%), Positives = 415/619 (67%), Gaps = 2/619 (0%)

Query: 242 SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC 301
           ++  +GIY+QN+QEFHI NA EG+ +LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK  
Sbjct: 312 NDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 371

Query: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361
             ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPF
Sbjct: 372 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 431

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421
           RESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGA +MK
Sbjct: 432 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFIMK 491

Query: 422 DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTS 481
           DILVKNI+ ELAKIKSD LSTKSK+GIYM+ +HY+ + +DLE+ + E+QE KR+IESLTS
Sbjct: 492 DILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESLTS 551

Query: 482 QNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHT 541
           +N+LL+K+K  S+E  + QNS+I+ L++TI++L  ++++QH  E E++    KL++    
Sbjct: 552 KNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLTEV 611

Query: 542 MQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNIT 601
           MQ +L+ Y+  EL L    +  +   I + + ++   L  ++   + +   I+ N++ I 
Sbjct: 612 MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQETDIQPNLDIIK 671

Query: 602 TIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLT 660
                 +++++     M  D + K++ E+P  +     E +             +   L+
Sbjct: 672 NEVLTLMETMQEKAELMYKDCVKKILNESPK-FFNAIVEKIDIIGVDFERFYKNIAENLS 730

Query: 661 EISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESR 720
           +ISEENN+L++Y   H F+N+ QE+L   ++S Y+K++  ++Q +      +  H+EE++
Sbjct: 731 DISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKKALNDHLEENK 790

Query: 721 TLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKEL 780
            L++ ++  T + +ID E SLF+P R +W  S D IN+CD+ +  F     + L ++K  
Sbjct: 791 KLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSMATTLSQIKST 850

Query: 781 SDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYF 840
            D S  S   +++  K + +   + +  L  +     Q   + +KH +L+D+ + ++   
Sbjct: 851 VDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILKDNIESSITST 910

Query: 841 KESSKGFEDMDCSIKKIIH 859
                  +D+  +I+KI++
Sbjct: 911 NSHITNIDDIYNTIEKIMN 929

 Score =  287 bits (734), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 153/184 (83%), Gaps = 10/184 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GI A+MN++ YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSDS
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD + +SS          K+L
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 189 RIFD 192
           RIFD
Sbjct: 213 RIFD 216

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  524 bits (1350), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 281/596 (47%), Positives = 405/596 (67%), Gaps = 8/596 (1%)

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGEL 305
           +GIY+QN+QEFHI NA EG+N+LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK    EL
Sbjct: 314 NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 373

Query: 306 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 365
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFRESK
Sbjct: 374 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESK 433

Query: 366 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILV 425
           LTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+ +MKDILV
Sbjct: 434 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILV 493

Query: 426 KNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNL 485
           KNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR+IESLTS+N L
Sbjct: 494 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNAL 553

Query: 486 LLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGS 545
           L+KDK  S+E  + QN +I+ L++TI++L  ++++QH  E E++   +KL++    MQ +
Sbjct: 554 LVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMA 613

Query: 546 LKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFD 605
           L  Y+  EL L    +  + + I   + ++   L  ++   + +  +I+ N++ I     
Sbjct: 614 LHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVL 673

Query: 606 DTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFN---ETVXXXXXXXXXXXNALTNKLTE 661
             +++++     M  D + K++ E+P    K FN   E +             +   L++
Sbjct: 674 TLMRTMQEKAELMYKDCVKKILNESP----KFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729

Query: 662 ISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRT 721
           ISEENN++++YL  H FKN+ QE+L+  ++S Y+ ++  +++ +     ++  H++E++ 
Sbjct: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789

Query: 722 LMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELS 781
           L++ ++    + +ID E  LF+P R +W  S D IN CD+ +  F     + L ++K   
Sbjct: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849

Query: 782 DASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNV 837
           D S  S  ++++  K + +   + +  L  +     Q   + +KH ML+D+  +++
Sbjct: 850 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSI 905

 Score =  288 bits (737), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 152/184 (82%), Gaps = 10/184 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GI A+MN++ YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD + + S          K+L
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 189 RIFD 192
           RIFD
Sbjct: 213 RIFD 216

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  503 bits (1294), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 283/613 (46%), Positives = 414/613 (67%), Gaps = 2/613 (0%)

Query: 226 PPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDF 285
           P  +  N    +    ++  +GIY+QN+QEFHI NA EG+N+LQ+GLKHRQVASTKMNDF
Sbjct: 293 PGNINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDF 352

Query: 286 SSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 345
           SSRSHTIFTI LYK    ELFR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTL
Sbjct: 353 SSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 412

Query: 346 GRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAK 405
           GRVIN+LADKS HIPFRESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+K
Sbjct: 413 GRVINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 472

Query: 406 AKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENC 465
           AKNIKN+PQLGA +MKDILVKNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ 
Sbjct: 473 AKNIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESY 532

Query: 466 QTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNE 525
           + E+QE KR IESL+S+N+LLLKDK  S++  + QNS+++ L+ TI  L  ++++QH  E
Sbjct: 533 KNEVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTE 592

Query: 526 TELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVS 585
            E++   +KL++    MQ +L+ Y+  EL L    +  + + I S + ++   L  ++ +
Sbjct: 593 LEISGFNNKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQN 652

Query: 586 MLDKNLSIKENINNITTIFDDTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFNETVXXX 644
            + +  +I+ N++ I       +++++     M  D + K++ E+P  +     E +   
Sbjct: 653 NISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPK-FFNVIVEKIDII 711

Query: 645 XXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQL 704
                   N +   L++ISEENN+L++YL  H FKN+ QE+L+  ++S Y+ ++  + + 
Sbjct: 712 RVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEF 771

Query: 705 LSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQ 764
           +    + +  H+EE++ L++ ++ +  + +I+ E  LF+P R +W  S D IN+CD+ + 
Sbjct: 772 VENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNN 831

Query: 765 NFEAKSTSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISD 824
            F     + L ++K   D S  S   +++  K + +   + V  L  ++    Q   + +
Sbjct: 832 EFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVN 891

Query: 825 KHRMLEDHFDDNV 837
           KH +L+D+ ++++
Sbjct: 892 KHTILKDNIENSI 904

 Score =  285 bits (728), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 10/184 (5%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS EVSINTT + GI A+MN++ YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEELKDLLD + ++S          K+L
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 189 RIFD 192
           RIFD
Sbjct: 213 RIFD 216

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  469 bits (1208), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 295/916 (32%), Positives = 512/916 (55%), Gaps = 43/916 (4%)

Query: 20  ELNITVAVRCRGR--NEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77
           E NI V  R +G+  NE+    +  +++  P +     +     D+   A K   R + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDD---AVK---REFGM 60

Query: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEK--LYDGQL 135
           D +F     Q  ++ +  +P+F DF+ GYNC+ LVYG T +GKTYT++G+E   L+    
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 136 SDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDS-----SKRLRI 190
             S G+IPR++ +LFD L   + D +VKCSY+E+YNEELKDLL + H+S      K+LRI
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHN-----GFSRR---RQRPPPVK-ANRMSATK--- 238
            D                     +  +        R+   RQ    +K AN +S ++   
Sbjct: 181 VDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQSLTALKQANTLSISRSNS 240

Query: 239 -------QQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHT 291
                  + + E     Y+QN++EFHI NA+EGI +L +GLK+RQ+AS+K   +SSR+ T
Sbjct: 241 FNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRAST 300

Query: 292 IFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 351
           IFTI+LYK  +GE+FRVSK N VDLAG+E+  +    NQR K+   INQ +  L +++NS
Sbjct: 301 IFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNS 360

Query: 352 LADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKN 411
           L +K   IPF++SKLT L++D+L GN+K+  I T+   K + DE   TLE+  K +++K 
Sbjct: 361 LHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKC 420

Query: 412 RPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQE 471
            P LG  + K+ L+K+IS+ELAK+KSD LSTKSK+G+YMSHEHY  +  DL+  + EI +
Sbjct: 421 YPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMD 480

Query: 472 SKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATT 531
            K+ I+ L  Q+  L KDK+A +EV E+Q  K++ ++ ++  +Y  IE+Q   E +L  +
Sbjct: 481 LKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINS 540

Query: 532 IHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNL 591
             KLKE ++ M  ++  Y   E  +Q  +K +  + ++  +  + ++L + + + L  NL
Sbjct: 541 TDKLKETVNNMNVTIARYTDRESSVQTQMKTLFNEELSKLKSMLLKNLRQFEKNELIDNL 600

Query: 592 SIKENINNITTIFDDTLKSVEAN-GSDMCDTLVKLIKETPSMYLKEFNETVXXXXXXXXX 650
            I+ N+N         L+  E    S   D + K+ +E+P ++   F + V         
Sbjct: 601 EIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLF-SSFIQDVSRLENSTSE 659

Query: 651 XXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVS 710
             N L   L+++SEE N+L++Y+++  FKN+ +E+L   +   Y +V+  SD  L K   
Sbjct: 660 NYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSSDDFLLKFND 719

Query: 711 MVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKS 770
           ++ +++E ++++++ ++K   +E+I+NE + F P +++W  S + I +   S   F+ K+
Sbjct: 720 LLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKHSSNEFKTKN 779

Query: 771 TSGLDKLKELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLE 830
              + KL++    + +S  D +++ K + +        +  ++ + ++   I  K+ +L+
Sbjct: 780 RVIVGKLQDTLKGTSESLFDTLSEMKSKINELQKAANIIENNEVVTEEFISIMKKNGILK 839

Query: 831 DHFDDNVKYFKESSKGFEDMDCSIKKII-HEMSPEVGDIKSV-ETLMERINARTFSPVRP 888
           D  + N+   +ES   F+ +D SI+ +  +E+   +   +S+ + + ++++ +  +P   
Sbjct: 840 DTLNINMTSTEESIVAFDKLDDSIRNVFKNEIDTNITGYQSILKEIFDQLDQQRLTPNMR 899

Query: 889 TGKTPSRQVLKNAITS 904
             K+P RQ +  + TS
Sbjct: 900 NRKSPVRQSVSPSRTS 915

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  461 bits (1187), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/558 (46%), Positives = 364/558 (65%), Gaps = 36/558 (6%)

Query: 238 KQQLSES------GSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHT 291
           K+QL+ S       + IY+QN+QEF+I NA +GI +LQKGL+HR+VASTKMND SSRSHT
Sbjct: 318 KEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHT 377

Query: 292 IFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 351
           IFTI LYK  +G L+RVSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINS
Sbjct: 378 IFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINS 437

Query: 352 LADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKN 411
           LADKSIHIPFRESKLTRLLQDSLGGNTKT LI+TISPAKIN DETSSTLEYA+KAKNIKN
Sbjct: 438 LADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKN 497

Query: 412 RPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQE 471
           +P LG+ +MKD+L+KNI++EL KIKSD +ST+ KDG+YMS +HY+E+ NDLE+ +TE+QE
Sbjct: 498 KPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQE 557

Query: 472 SKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATT 531
           SKR  E L SQN  LLKDKKAS E+ ELQ  +I+K    I+ LY+ ++  +  E  L   
Sbjct: 558 SKRANERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVEL 617

Query: 532 IHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLD--- 588
           I +LK    +MQ ++++Y   +L ++   K++L       +  ++Q L  +  +++D   
Sbjct: 618 IRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLK 677

Query: 589 -------------------KNLSIKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKE 628
                              KN+ I EN    TT+    LK V+     +  + + +++ +
Sbjct: 678 SSIISNNSSIEAIDSSNFQKNIDIIEN----TTL--KILKQVQEKSQHIYSSCIERILSD 731

Query: 629 TPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDL 688
            P++ L +F   +           N +T  L+++SEE N+ +EYL+    +N+ + +L  
Sbjct: 732 IPNI-LNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKN 790

Query: 689 RMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDR 748
            +ES   ++++ S+ LL  +   +      +  L    + +  N+I+  E    +P +++
Sbjct: 791 HLESGQSQIESFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEK 850

Query: 749 WIASCDNINQCDASHQNF 766
           W+ S + IN  D  +  F
Sbjct: 851 WVKSIEIINSTDKINNTF 868

 Score =  312 bits (800), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 165/175 (94%), Gaps = 1/175 (0%)

Query: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78
           EELNITVAVRCRGRNERE++AKSSVVV+VPD+ GSNEVSINT+DEVGIAA MNS+TYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138
           KVFGPSA Q L+FKEIAEPLF+DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYDG+LSDS
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128

Query: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS-KRLRIFD 192
           AGIIPR++FKLF++ E  + D+++KCS++ELYNE+LKDLLD+S D++ K+LRIFD
Sbjct: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFD 183

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  372 bits (956), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 227/569 (39%), Positives = 327/569 (57%), Gaps = 60/569 (10%)

Query: 1   MPDHEVQTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINT 60
           MP    +  +S    + + E NI V VRCR RNEREI+ KSSVV++     G   +  N 
Sbjct: 33  MPTTTQKRVRSSQQSEGEPEYNIKVYVRCRSRNEREIREKSSVVISTLGNNGREVILTN- 91

Query: 61  TDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGK 120
                     +++TYT D+VFG  +DQ  +F ++A    ++ ++GYNCTV  YG T TGK
Sbjct: 92  ------PGTGSNKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGK 145

Query: 121 TYTMTGDEKLYDGQ--------LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNE 172
           TYTM+GD  +            LS+ AGIIPR++ +LF  L     D+ VK S++ELYNE
Sbjct: 146 TYTMSGDITMMGSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNE 205

Query: 173 ELKDLLDESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKAN 232
           +L+DLL +  D S     F                         NG +     PP     
Sbjct: 206 KLRDLLVDDKDVSLEDHNF-------------------------NGMA-----PPESIRI 235

Query: 233 RMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTI 292
             S    + S +G  I+V+ ++E +I +A+EG+ +L  G   R+VA+TK ND SSRSHTI
Sbjct: 236 YDSLKTDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTI 295

Query: 293 FTIM-----LYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGR 347
           FTI      ++     +  +V K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGR
Sbjct: 296 FTITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGR 355

Query: 348 VINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAK 407
           VIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYA +AK
Sbjct: 356 VINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAK 415

Query: 408 NIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVND---LEN 464
           +IKN PQ+  LM K+  +     E+ +++ +  ++ SK+GIY++ E ++   ++   +E 
Sbjct: 416 SIKNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYESNSILVEE 475

Query: 465 CQTEI---QESKRQIESLTSQNNLLLKDKKASQEVTELQNSKI----KKLQSTIEYLYDK 517
            Q +I   QE  R+++    +   L+K+K    +  ++ N K     K L   I  ++ K
Sbjct: 476 QQAKIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSK 535

Query: 518 IERQHHNETELATTIHKLKEALHTMQGSL 546
           +E   H    +     KL E ++  +G++
Sbjct: 536 LEDYEHTMIGIHNNNMKLLEDINDNRGNI 564

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  370 bits (950), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 216/501 (43%), Positives = 305/501 (60%), Gaps = 45/501 (8%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           N+ V VRCR RNE+EI+ KSSVV++     G   +  N    +      + RTYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAGSLS----HSKRTYTFDQVF 96

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY---DGQ---- 134
           G  +DQ  +F E+A+    + ++GYNCTV  YG T TGKTYTM+GD  +    D Q    
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXX 194
           L + +GIIPR++  LF  L    +++ VK S++ELYNE+LKDLL ES    + +RIFD  
Sbjct: 157 LGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEEENIRIFDN- 215

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQ 254
                                ++GF+  +     VK +  S      S S S I V+ ++
Sbjct: 216 ---------------------NSGFNCNKNVKQLVKLDGSSHRTSSASSSSSSIMVKGME 254

Query: 255 EFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN-----CDGELFRVS 309
           EF+I +A EG+ +L  G   R+VA+TK ND SSRSHT+FTI           + +  ++ 
Sbjct: 255 EFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSNEQYIKIG 314

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRL 369
           K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+RESKLTRL
Sbjct: 315 KLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYRESKLTRL 374

Query: 370 LQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNIS 429
           LQDSLGG TKT +IATISPAKI+ DET STLEYA +AK+IKN PQ+   M K+  +    
Sbjct: 375 LQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKNSCLGEYI 434

Query: 430 SELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKD 489
            E+ +++ +  +++ K+G+Y++ + +Q      E+    ++E K +I+++  Q   +LK 
Sbjct: 435 HEIERLRQELKASRQKEGMYITEDQFQL----YESNSILVEEQKVRIQNMEDQ---ILKF 487

Query: 490 KKASQEVTELQNSKIKKLQST 510
           K    E T L     K+L+ +
Sbjct: 488 KAKYVEQTNLSKDAEKRLKQS 508

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  364 bits (935), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 285/971 (29%), Positives = 493/971 (50%), Gaps = 82/971 (8%)

Query: 13  MLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNS 72
           M++ A+ E NITVAVRCR   + E  + S  ++++    G NE    T++EV +  +   
Sbjct: 1   MIESAKME-NITVAVRCREPIDEEKHSGSPTIISI----GDNEDG--TSNEVIVLDESTG 53

Query: 73  R--TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EK 129
           R   YT+D V+G   DQ  +F E   P +  F  GYN +++ YG   +GK YT+ G+  +
Sbjct: 54  RKKIYTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSE 113

Query: 130 LYDGQLSDSA--GIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESH----- 182
           L +   ++S   G++PR++ +LF  LE+  +D ++KCS++E+YN+EL+DLL ++      
Sbjct: 114 LQNANNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANG 173

Query: 183 --------DSSKRLRIFDXXXXXXXXXXXXXXXX---------PREPEVAHNGFSRRRQR 225
                    + K+LRI D                          + P         +R  
Sbjct: 174 NNSNGATGSTGKKLRIVDSASNGLRSAGSSNSSTRDNSPLTNSKKIPTAMMRKRMGKRSL 233

Query: 226 PP-------PVKANRMSATK---------QQLSESGSGIYVQNVQEFHIINAREGINVLQ 269
           PP           NR+S ++         Q   E  + IY+QN+QE  I    EG+ +++
Sbjct: 234 PPNNSISNNTANNNRLSLSRTNSFSDYSLQSSHERLNSIYIQNLQEITITEIEEGMAIIK 293

Query: 270 KGLKHRQVAST----KMNDFSSRSHTIFTIMLYKNCD-GELFRVSKMNLVDLAGSENISR 324
           KGLK+R++AST      N+FS RSH+IF I LYK  +  E+FR+SK++ V+ AGSE    
Sbjct: 294 KGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLSFVNFAGSEYGDN 353

Query: 325 SGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIA 384
           + ++N      G+ N +L +  ++IN + + S +  F +SKLT+LLQ++  G T+T  IA
Sbjct: 354 NTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQNNFDGITRTLFIA 407

Query: 385 TISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKS 444
            I+P K   D T S L  A K K IKN P+ G+++ K+ L+K +S+EL K KSD LS KS
Sbjct: 408 NIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNELVKTKSDLLSYKS 467

Query: 445 KD-GIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQNSK 503
            D GIYM  +HY E+   LE+ + +IQ SK  I  LT + N +  +K+  +E+ E Q  K
Sbjct: 468 NDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKRTFEEINERQRIK 527

Query: 504 IKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEV 563
           ++ L+ TI  L   +E+Q   E+EL     KL   L  MQ S++ Y   E+ LQN +K +
Sbjct: 528 LQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSDKEIHLQNKLKLL 587

Query: 564 LYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLV 623
             + +   + S+  +   +K  M D N ++  NI+NI           ++   ++     
Sbjct: 588 YDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSA 647

Query: 624 KLIKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEENNHLREYLDQHLFKNSTQ 683
             + +T   Y ++ +  +           N  +  L++ISEE N+L  Y++ +  K+S +
Sbjct: 648 NQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHE 707

Query: 684 EVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQ 743
           E++D  +   Y +V+  S +       ++  +VE++   +  S+    +EI++NE + F 
Sbjct: 708 ELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFN 767

Query: 744 PIRDRW-IASCDNINQCDASHQNFEAKSTSGLDKLKELSDASLKSSEDAVNKA---KHRT 799
           P + +W +AS + I   + S    + K++  L KL  LS+++  +SE  +N     K   
Sbjct: 768 PEKKKWELASNEIIENFNESITKNKNKNSEILAKL--LSEST-STSELFINNMSSIKKNV 824

Query: 800 DSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVKYFKESSKGFEDMDCSIKKII- 858
           +   +F +    +  +K +  +I +K++ L+D   DN    + S   F+++  +++ +  
Sbjct: 825 EIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNLKEAMQNVFK 884

Query: 859 HEMSPEV-GDIKSVETLMERINARTFSPVRPTGKTPSRQVLKNAITSKASSRSMSPIKTL 917
           +EM      D  +++ + E++  +       + K   +Q L        S   +SPIK  
Sbjct: 885 NEMKESYSNDTLNLKEIFEQMEQQKLGVNSSSKKKAYKQNL--------SPSKISPIK-- 934

Query: 918 DTNVRIISPVK 928
            ++ ++ SP+K
Sbjct: 935 -SSTKLNSPLK 944

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  367 bits (942), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 226/543 (41%), Positives = 313/543 (57%), Gaps = 85/543 (15%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI V VRCR RN+REI  KSSVV++     G + +  N +     +     +TYT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ------- 134
           G  +DQ ++F  +A+    + ++GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 135 ---LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESH----DSSKR 187
              LS+ AGIIPR++  LF  L+   +D+ VK S++ELYNE LKDLL +S+    ++++ 
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNAES 233

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
           +RIFD                  +PE    G                             
Sbjct: 234 IRIFDNI----------------KPEKNTQG--------------------------SHS 251

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKNCDG 303
           I V+ ++E +I +A+EG+ +L +G   RQVASTK ND SSRSHT+FTI           G
Sbjct: 252 IMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITTNVTKVDPLSG 311

Query: 304 ELF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 362
           E + +  K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+R
Sbjct: 312 EEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYR 371

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKD 422
           ESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET STLEYA +AK+IKN PQ+   M KD
Sbjct: 372 ESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNTPQINQSMTKD 431

Query: 423 ILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDL--ENCQTEIQESKRQIESLT 480
             +     E+ +++ +  +T++KDGIY++ E Y     DL   NC   + E K +I++L 
Sbjct: 432 SCITEYIHEIDRLRKELRATRTKDGIYITQEKY-----DLYESNC-ILVGEQKARIDNLE 485

Query: 481 SQNNLLLKDKKASQ-EVTELQNSKIKK--------------LQSTIEYLYDKIERQHHNE 525
            Q     K+K   Q  +T+    K++K              L+S+++YL  K     H  
Sbjct: 486 EQIK-RFKEKYVQQVNITKETEQKLQKIDLSYQQVWEKKQLLESSLDYLQQKCNSFEHEI 544

Query: 526 TEL 528
           TE+
Sbjct: 545 TEI 547

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  366 bits (940), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/489 (42%), Positives = 292/489 (59%), Gaps = 52/489 (10%)

Query: 7   QTRKSRMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGI 66
           + R + M+   ++  NI V VRCR RN REIK KSSVVV+     G   +  N       
Sbjct: 41  RVRSNMMVGSEEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSN------- 93

Query: 67  AAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTG 126
            +  N++TYT D+VFG  +DQ  +F ++A     + ++GYNCTV  YG T TGKTYTM+G
Sbjct: 94  QSTGNNKTYTFDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSG 153

Query: 127 DEKLYDGQLSDS--------AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLL 178
           D  +    L D         AGIIPR++ +LF  L+    D+ VK S++ELYNE+L+DLL
Sbjct: 154 DISVVGASLEDPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLL 213

Query: 179 DESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATK 238
            E                             +EP +   G        P       +   
Sbjct: 214 VED----------------------------KEPLIDEGGIGGGVANSPETIRIYDNLKL 245

Query: 239 QQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIM-- 296
            + + SG  I V+ ++E +I +A+EG+ +L +G   R+VA+T+ ND SSRSHTIFTI   
Sbjct: 246 DRSNSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTN 305

Query: 297 ---LYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 353
              ++     +  ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 306 VTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 365

Query: 354 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRP 413
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + +ET+STLEYA +AK+IKN P
Sbjct: 366 DHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTP 425

Query: 414 QLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESK 473
           Q+  LM K+  +     E+ K++ +  +  +K+GIY++ E Y+   +   NC   ++E +
Sbjct: 426 QINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYES---NC-ILVEEQQ 481

Query: 474 RQIESLTSQ 482
            +I++L  Q
Sbjct: 482 AKIDNLQEQ 490

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  362 bits (930), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/455 (45%), Positives = 279/455 (61%), Gaps = 39/455 (8%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI V VRCR RN+REI  KSSVVV+     G + +  N +  +    K    TY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPKK----TYMFDEVF 99

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY---DGQ---- 134
           G  +DQ  IF E+A+    + ++GYNCTV  YG T TGKTYTM+GD  ++   D Q    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXX 194
           L + AGIIPR++  LF  L    ++  VK S++ELYNE LKDLL ++      +RIFD  
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADNDSDEDNIRIFDNN 219

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSAT---------KQQLSESG 245
                               A NG S+ +     V+A  +S               S S 
Sbjct: 220 NSNAHG--------------ASNGMSQVKMNKSKVRAPTLSGATVSSSASNSSTSSSSSS 265

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY----KNC 301
           S I V+ ++E +I +A EG+ +L KG   R+VA+TK ND SSRSHTIFTI+ +       
Sbjct: 266 SSITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPV 325

Query: 302 DGELF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIP 360
            GE + ++ K+NLVDLAGSENI+RSGA+N RA+EAG IN+SLLTLGRVIN+L + S HIP
Sbjct: 326 SGEQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIP 385

Query: 361 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMM 420
           +R SKLTRLLQDSLGG TKT +IATISPA+I+ DET STLEYA +AK+IKN PQ+   + 
Sbjct: 386 YRGSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLS 445

Query: 421 KDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHY 455
           KD  +     E+ +++ +  +++ ++G+Y++ E Y
Sbjct: 446 KDSCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  357 bits (917), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 278/460 (60%), Gaps = 73/460 (15%)

Query: 16  DAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTY 75
           +A  E NI V VRCR RN REI  KSSVV++     G   +  N + +   ++K   +TY
Sbjct: 46  NATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTY 102

Query: 76  TVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGQ 134
             D+VFG  +DQ ++F   A+    + + GYNCT+  YG T TGKTYTM+GD   L D Q
Sbjct: 103 QFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQ 162

Query: 135 LSDS------AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDE-------S 181
            +D+      AGIIPR++  LF  L + + ++ VK S++ELYNE LKDLL +       +
Sbjct: 163 STDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTA 222

Query: 182 HDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQL 241
           +DS K++RIFD                                                 
Sbjct: 223 NDSKKQIRIFDN------------------------------------------------ 234

Query: 242 SESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY--- 298
           + + S I V+ +QE  I +A EG+N+L +G   R+VA+TK ND SSRSHT+FTI      
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 299 -----KNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 353
                   +    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 354 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRP 413
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET+STLEYA +AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 414 QLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHE 453
           Q+   + KD  +K+   E+ K+++D  ++++K GI+++ +
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  356 bits (914), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 234/624 (37%), Positives = 349/624 (55%), Gaps = 87/624 (13%)

Query: 17  AQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYT 76
           A  + NI V VRCR RN+REI+ KSSVV++     G   +  N + +   ++K   +TY 
Sbjct: 47  ATSDSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQ 103

Query: 77  VDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGQL 135
            D+VFG  +DQ  +F   A+    + + GYNCT+  YG T TGKTYTM+GD   L D Q 
Sbjct: 104 FDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQS 163

Query: 136 SDS------AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDES-------H 182
           +D+      AGIIPR++  LF  L + + ++ VK S++ELYNE LKDLL +S       +
Sbjct: 164 TDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVN 223

Query: 183 DSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLS 242
           D  +++RIFD                                                 +
Sbjct: 224 DPKRQIRIFDN------------------------------------------------N 235

Query: 243 ESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY---- 298
            + S I V+ +QE  I +A EG+N+L +G   R+VA+TK ND SSRSHT+FTI       
Sbjct: 236 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 295

Query: 299 ----KNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 354
                  +    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 355 KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQ 414
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET+STLEYA +AK+IKN PQ
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 415 LGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKR 474
           +   + KD  +K+   E+ K+++D  ++++K GI+++    Q+ ++  E+    I E   
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFIT----QDQLDLYESNSILIDEQNL 471

Query: 475 QIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIE-------YLYDKIERQHHNETE 527
           +I +L  Q     ++     ++  L  S+ +KL + I+         Y +I++ HH   E
Sbjct: 472 KIHNLREQIKKFKENYLNQLDINNLLQSEKEKLIAIIQNFNVDFSNFYSEIQKIHHTNLE 531

Query: 528 LATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSML 587
           L   +  +++   +++ S K Y T++  +Q  I + + Q + + + S+N +  K    + 
Sbjct: 532 LMNEV--IQQRDFSLENSQKQYNTNQ-NMQLKISQQVLQTLNTLQGSLNNYNSKCSEVIK 588

Query: 588 DKNLSIKENINNITTIFDDTLKSV 611
                +  N+N      D TLKS+
Sbjct: 589 GVTEELTRNVNTHKAKHDSTLKSL 612

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  357 bits (915), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 232/614 (37%), Positives = 335/614 (54%), Gaps = 97/614 (15%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI V VRCR R+EREIK KSSVV++     G+  +  N +  +    K    +Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPKK----SYSFDRVF 163

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ------- 134
           G  +DQ  +F + A+    + + GYNCTV  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXX 194
           L + AGIIPR++  LF  L A ++D+ VK S++ELYNE LKDL  ++    + +RIFD  
Sbjct: 224 LGEHAGIIPRVLVNLFKML-ALENDYSVKISFLELYNERLKDLFAQNESEEETIRIFDNN 282

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQ 254
                                                          + + S I V+ ++
Sbjct: 283 -----------------------------------------------NNASSSIMVKGME 295

Query: 255 EFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKNCDGELF-RVS 309
           E +I +A EG+ +L  G   R+VASTK ND SSRSHT+FTI           GE + +  
Sbjct: 296 EIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITKIDPISGEQYIKTG 355

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRL 369
           K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HIP+RESKLTRL
Sbjct: 356 KLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRL 415

Query: 370 LQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNIS 429
           LQDSLGG TKT +IATISPAKI+ +ET STLEYA +AK+IKN PQ+   M KD  +    
Sbjct: 416 LQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQINQSMSKDTCINEYV 475

Query: 430 SELAKIKSDFLSTKSKDGIYMSHEH---YQ-------EIVNDLENCQTEIQESKRQIESL 479
           SE+ +++ +  +++ KDGI ++ +    Y+       E    + N + +IQ+ K +    
Sbjct: 476 SEIERLRLELKTSRQKDGICITQDQLDLYESNGILVDEQKTKIHNMEEQIQKFKEKYVRQ 535

Query: 480 TSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEAL 539
           T  N  L  + K +++VT       K+L+S    L D +E    N               
Sbjct: 536 TELNKNLESNLKENEQVT-------KQLRSEKYQLMDLLENYQINSNSF----------- 577

Query: 540 HTMQGSLKSYETHELRLQNDIKE--VLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENI 597
             +Q  L+ +E++   +QN  KE   ++   T Y  +M +   ++ +   D+ L +K ++
Sbjct: 578 --VQRVLQIHESNIALIQNLDKERNRIHHNSTQYMNNMEETFNQLSIQR-DELLRLKNSL 634

Query: 598 NNITTIFDDTLKSV 611
            +    F+D ++SV
Sbjct: 635 QSYNINFNDVMQSV 648

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  355 bits (912), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/454 (44%), Positives = 279/454 (61%), Gaps = 52/454 (11%)

Query: 16  DAQEEL--NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSR 73
           D + EL  NI V VRCR RN+REI+ KSSVV++     G  EV ++    V    K   +
Sbjct: 51  DFESELGSNIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLSDPSSVLSHTK---K 106

Query: 74  TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY-- 131
           TY  D+VFG  +DQ ++F   A+    + ++GYNCT+  YG T TGKTYTM+GD  +   
Sbjct: 107 TYIFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGD 166

Query: 132 -DGQ----LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSK 186
            + Q    L + AGIIPR++  LF  L    +++ VK S++ELYNE LKDLL +S ++ +
Sbjct: 167 LESQDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKETEE 226

Query: 187 RLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGS 246
            +RIFD                                    + +      K   + + S
Sbjct: 227 SIRIFDNH----------------------------------IPSGNSKIQKSSRNNTYS 252

Query: 247 GIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN----CD 302
            I V+ ++E +I +A EG+ +L +G   R+VASTK ND SSRSHTIFTI           
Sbjct: 253 SIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTITTNITKIDPVS 312

Query: 303 GELF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361
           GE + ++ K+NLVDLAGSENISRSGA+N RA+EAG IN+SLLTLGRVIN+L D S HIP+
Sbjct: 313 GEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINALVDHSQHIPY 372

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK 421
           RESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET STLEYA +AK+IKN PQ+   M K
Sbjct: 373 RESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKNTPQINQSMSK 432

Query: 422 DILVKNISSELAKIKSDFLSTKSKDGIYMSHEHY 455
           D+ +     E+ +++ +  +++ KDG+Y++ E +
Sbjct: 433 DVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  354 bits (909), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 231/617 (37%), Positives = 341/617 (55%), Gaps = 102/617 (16%)

Query: 17  AQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYT 76
           A  + NI V VRCR RN+REI  KSSVV++     G   +  N + +   ++K   +TY 
Sbjct: 46  ATSDSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQ 102

Query: 77  VDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGQL 135
            D+VFG  +DQ  +F   A+    + + GYNCT+  YG T TGKTYTM+GD   L D Q 
Sbjct: 103 FDQVFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQS 162

Query: 136 SDS------AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDES-------H 182
           +D+      AGIIPR++  LF  L + + ++ VK +++ELYNE LKDLL ++       +
Sbjct: 163 TDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVN 222

Query: 183 DSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLS 242
           DS +++RIFD                                                 +
Sbjct: 223 DSKRQIRIFDN------------------------------------------------N 234

Query: 243 ESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY---- 298
            + S I V+ +QE  I +A EG+N+L +G   R+VA+TK ND SSRSHT+FTI       
Sbjct: 235 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 294

Query: 299 ----KNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD 354
                  +    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 295 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 354

Query: 355 KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQ 414
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET+STLEYA +AK+IKN PQ
Sbjct: 355 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQ 414

Query: 415 LGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHY-----QEIVND-----LEN 464
           +   + KD  +K+   E+ K+++D  ++++K GI+++ +         I+ D     + N
Sbjct: 415 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHN 474

Query: 465 CQTEIQESKRQIESLTSQNNLLLKDKKASQEVTE-------LQNSKIKKLQSTIEYLYDK 517
            + +I++ K    +    NN L  +K+    V           NS+I+K+  T   L ++
Sbjct: 475 LRGQIKKFKGNYLNQLDVNNFLQSEKEKLINVIRNFNVDFSNFNSEIQKIHHTNLELMNE 534

Query: 518 I-----------ERQHHNETELATTI-HKLKEALHTMQGSLKSYETHELRLQNDIKEVLY 565
           I           + Q+    EL T I  ++ + L T+Q SL +Y +   ++ N + E L 
Sbjct: 535 ITLQRDLSQETSQEQYTTSQELQTKITQQVLQTLSTLQSSLMNYNSKFSQVINGVTEELS 594

Query: 566 QGITSYRESMNQHLEKV 582
           + +  ++   +  LE +
Sbjct: 595 RNVNFHKLKHDSALESL 611

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  354 bits (908), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 213/530 (40%), Positives = 305/530 (57%), Gaps = 71/530 (13%)

Query: 23  ITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVFG 82
           I V VRCR RNEREI+ KSSVV++      S ++ ++        AK   RTYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 83  PSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQL------- 135
             +DQ  +F + A+    + ++GYNCTV  YG T TGKTYTM+GD  +  G L       
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 136 -SDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXX 194
             + AGIIPR++ +LF  L+  +  + VK S++ELYNE LKDLL       + +RIFD  
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNERLKDLLASEQSEEENIRIFD-- 234

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQ 254
                                                  +SA+        S I V+ ++
Sbjct: 235 --------------------------------------NVSAS--------SSIMVKGME 248

Query: 255 EFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKNCDGELF-RVS 309
           E +I +A +G+ +L  G   R+VA+TK ND SSRSHT+FTI           GE + +  
Sbjct: 249 EIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSGEQYVKTG 308

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRL 369
           K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D + HIP+RESKLTRL
Sbjct: 309 KLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYRESKLTRL 368

Query: 370 LQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNIS 429
           LQDSLGG TKT +IATISPAKI+ DET STLEYA +AK+IKN PQ+   M KD  +    
Sbjct: 369 LQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKDSCINEYV 428

Query: 430 SELAKIKSDFLSTKSKDGIYMSHEHYQEIVND---LENCQTEIQESKRQIESLTS---QN 483
            E+ +++ +  +++ KDGI ++ + +    ++   ++  +T+IQ  + QI+       + 
Sbjct: 429 HEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQIQRFKDKYVKQ 488

Query: 484 NLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIH 533
             L K+ ++  +  ELQ  ++K  ++ +  L +  +   ++  E  T IH
Sbjct: 489 TELNKNLESRLKQNELQTIQLKSQRTQLLSLLENFQSNSNHYIERVTKIH 538

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  353 bits (905), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 260/805 (32%), Positives = 417/805 (51%), Gaps = 126/805 (15%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI V VRCR RN+REI  KSSVV++     G   +  N + +   ++K   +TY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQSYSSSK---KTYQFDQVF 108

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGQ------ 134
           G  +DQ  +F   A+    + + GYNCT+  YG T TGKTYTM+GD   L D Q      
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDES-------HDSSKR 187
           L + AGIIPR++  LF  L   + ++ VK S++ELYNE LKDLL +S       +D+ ++
Sbjct: 169 LGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDTKRQ 228

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
           +RIFD                                                 + + S 
Sbjct: 229 IRIFDN------------------------------------------------NNNNSS 240

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY--------K 299
           I V+ +QE  I +A EG+N+L +G   R+VA+TK ND SSRSHT+FTI            
Sbjct: 241 IMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDH 300

Query: 300 NCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI 359
             +    ++ K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D S HI
Sbjct: 301 GQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHI 360

Query: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALM 419
           P+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ +ET+STLEYA +AK+IKN PQ+   +
Sbjct: 361 PYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQSL 420

Query: 420 MKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESL 479
            KD  +K+   E+ K+K+D  ++++K GI+++    Q+ ++  E+    I E   +I +L
Sbjct: 421 SKDTCLKDYIQEIEKLKNDLKNSRNKQGIFIT----QDQLDLYESNSILIDEQNLKIHNL 476

Query: 480 TSQNNLLLKDKKASQ-EVTELQNSKIKKLQSTIE-------YLYDKIERQHHNETELATT 531
             Q     K+K  +Q ++  L  S+ +KL + I        + Y KI++ H+   EL   
Sbjct: 477 REQIK-KFKEKYLTQLDINNLLQSEKEKLVTVIRDFDIDYSHFYSKIQQIHYTNLELINQ 535

Query: 532 I--------------------------HKLKEALHTMQGSLKSYETHELRLQNDIKEVLY 565
           +                           ++ + L+++Q SL++Y +   ++ N + E L 
Sbjct: 536 VTQQRDSSHENCQKQYTANQNMQLKISQQVLQTLNSLQNSLRNYNSKFSQVINGVTEELT 595

Query: 566 QGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLVKL 625
             + S++ + +   + +  +  +  L IK  +N +     ++ K  +++ +  C+  +  
Sbjct: 596 NSVNSHKVNHDSTFKSLMNTTANL-LMIK--MNELVLSISNSFKDFQSDFASHCNKDLND 652

Query: 626 IKETPSMYLKEFNETVXXXXXXXXXXXNALTNKLTEISEEN-NHLREYLDQH------LF 678
           I ++  + L+     +            A  N++++    N N +   +++H      + 
Sbjct: 653 IYQSHKLLLRNLQSDIKKCLDSIGRSVLASINEISDSCSTNLNSMNVLINKHESEVLKVI 712

Query: 679 KNSTQEVLDLRMESVYQ-KVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDN 737
           +    E+  L+ + V + K+ N+  + L++L      HV  +R  + + +   +N++ D 
Sbjct: 713 EKKDSEIKKLKNDLVNERKISNEFSEQLTQLKWYFQNHVSRTRNELHDELDGFINKLKDK 772

Query: 738 ERSLFQPIRDRWIASCDNINQCDAS 762
           +  L Q   D W  +    NQ D +
Sbjct: 773 QLKLDQ---DIWHKTTSVFNQTDIA 794

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  330 bits (846), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 228/643 (35%), Positives = 342/643 (53%), Gaps = 120/643 (18%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEV-------SINTTDEVGIA------- 67
           NI V VRCR R +REI  KSSVV++     G+  +        +  T+  G         
Sbjct: 51  NIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILSPNQSRKLYNTNANGSTRTKNNTN 110

Query: 68  -------------AKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYG 114
                           N RTYT DKVFG  +DQ  +F+ +A+    + ++GYNCTV  YG
Sbjct: 111 LNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEMLQGYNCTVFAYG 170

Query: 115 MTSTGKTYTMTGDEKLYDGQ-------LSDSAGIIPRIMFKLFDALEATDS--------- 158
            T TGKTYTM+GD  +           L + AGIIPR++  LF  L   D+         
Sbjct: 171 QTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLFKELSKNDTITNTKVNNN 230

Query: 159 --------------------DFLVKCSYIELYNEELKDLLD----ESHDSSKRLRIFDXX 194
                               ++ VK S++ELYNE+L DLL     ++ +S+ +L I    
Sbjct: 231 KNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNYKTDALNSNDKL-INQTS 289

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQ 254
                           + ++ +N       +   + +N+    K   + +GS I V+ ++
Sbjct: 290 GNSTPYSITNGLNVNDKFKIKNNNLHDFDGKNVRIMSNQ---NKSASNCNGSSITVKGME 346

Query: 255 EFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML----YKNCDGELF-RVS 309
           E +I +A EG+ +L +G   R+VASTK+ND SSRSHTIFTI+          G+ F +  
Sbjct: 347 EIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPVTGKHFVKTG 406

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRL 369
           K+NLVDLAGSENI+RSGA+N+RA+EAG IN+SLLTLGRVIN+L D+S HIP+RESKLTRL
Sbjct: 407 KLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDRSHHIPYRESKLTRL 466

Query: 370 LQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILVKNIS 429
           LQDSLGG TKT +IAT+SPAKI+ +ET STLEYA +AK+IKN PQ+   + KD  +    
Sbjct: 467 LQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKNTPQINQSLSKDTFIHEYI 526

Query: 430 SELAKIKSDFLSTKSKDGIYMSHEH---YQ-------EIVNDLENCQTEIQESKRQIESL 479
           +E+ +++++    ++K+GIY++ +    Y+       E    ++N + +I+  K +    
Sbjct: 527 NEIDRLRNELKLARTKEGIYITQDQLDLYESNSILITEQKAKIDNMEDQIKRFKAKYVEE 586

Query: 480 TSQNNLLL----KDKKASQEVTE-----------------LQNSKIKKLQSTIEYLYDKI 518
           T  N +LL    + + A+Q+++E                 + NS I ++ S+   ++D +
Sbjct: 587 TESNRILLNKLEQSEDANQKLSEKTKVIISLFKRYQENFKIFNSNINQIHSSNLEVFDSL 646

Query: 519 ERQHHNETELAT--TIHKLK----------EALHTMQGSLKSY 549
           +  H ++ +L +   I  LK          E L+T++ SL SY
Sbjct: 647 Q-NHKDKLDLCSKKNIKTLKEIYIAEEKYTEQLNTLKASLSSY 688

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  290 bits (743), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 200/507 (39%), Positives = 273/507 (53%), Gaps = 95/507 (18%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI V VRCR RN++EI  KSSVVV+     G         +++ I+   N   Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNG---------NQIIISNSTNKNKYIFDNVF 59

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------DGQ 134
           G  +DQ  IF  +A     + + GYNCT+  YG T TGKTYTM+GD  +        +  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD--------FLVKCSYIELYNEELKDLLDESHDSSK 186
           L + AGIIPR++ +LF +LE + S+        + VK S++ELYNE LKDLL    D   
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSADAD--- 176

Query: 187 RLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKAN-RMSATKQQLSESG 245
                                 P     + N         P V +N ++   K     S 
Sbjct: 177 --------------------LPPNSGSSSAND--------PSVSSNIKIFDNKD---SSD 205

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIM-----LYKN 300
           S I V+ +QE  I NA EG+N+L KG   R+V STK+ND SSRSHTIFTI      L   
Sbjct: 206 SSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQ 265

Query: 301 CDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---- 356
            + E  ++ K+NLVDLAGSENI++SG +  R++E G IN+SLLTLGRVIN+L+DK+    
Sbjct: 266 TNKEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNNTH 323

Query: 357 --------------------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADET 396
                                HIP+RESKLTRLLQDSLGG TKT +IATISPAK   DET
Sbjct: 324 GSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDET 383

Query: 397 SSTLEYAAKAKNIKNRPQLGALMMKDILVKNISSELAKIKSDF-LSTKSKDGIYMSHEHY 455
            STLEYA +A +IKN P++         + +  +++ ++K +   ST    GI++  E  
Sbjct: 384 ISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGIFIPLEK- 442

Query: 456 QEIVNDLENCQTEIQESKRQIESLTSQ 482
              +N  ++ +  I+E   +I ++T+Q
Sbjct: 443 ---LNYYKSNEILIEEQNAKINNMTNQ 466

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  195 bits (496), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 171/554 (30%), Positives = 252/554 (45%), Gaps = 133/554 (24%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI VAVR R    RE        VT P  +   +  I+T+  +        + +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 82  ----GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE--------- 128
                 S DQ +I+  I        + GYN  +L YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 129 KLYDGQLSDSA-GIIPRIMFKLFDALEATDSD-------FLVKCSYIELYNEELKDLLDE 180
              D  + DSA GIIPR+   LFD     +S+       F + CSY+E+YNE+++DLL E
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

Query: 181 SHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQ 240
             D SK                                  R R+R               
Sbjct: 183 --DGSK---------------------------------CRVRERADKT----------- 196

Query: 241 LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 300
                   +V+ + EF +    E +  +++G + R V  T MN+ SSRSH IFTI + ++
Sbjct: 197 -------TFVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQS 249

Query: 301 ---CDGELF-RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 356
                G+L  R S + LVDLAGSE +S +GA+  R KE  +IN+SL TLGRV++ LA K+
Sbjct: 250 ETTLAGDLTERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKN 309

Query: 357 IH--IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQ 414
               IP+R+S LT +L+++LGGN+KT +IA +SP   + +ET STL YA  AK +KN  +
Sbjct: 310 RPKLIPYRDSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTAR 367

Query: 415 LGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKR 474
           +             SSE  K K   ++ +                N LE  Q E+     
Sbjct: 368 VN------------SSESLKNKEQLVTMR----------------NQLEELQKEL----- 394

Query: 475 QIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHK 534
            ++S+  QN  LL++             +I K++ T  YL  +IE+    E   AT  H+
Sbjct: 395 SLQSVKLQNQELLRE-------------QINKIKCTNAYLEKRIEQ----EAAFATKYHE 437

Query: 535 LKEALHTMQGSLKS 548
             + +   +  L+S
Sbjct: 438 RWDKITREKAQLES 451

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  192 bits (487), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 139/412 (33%), Positives = 210/412 (50%), Gaps = 70/412 (16%)

Query: 16  DAQEELNITVAVRCRGRNEREIKAKSSVV------VTVPDVTGSNEVSINTTDEVGIAAK 69
           D++   N+ V VR +  +  E +   +VV      V  P+    N+ S  +T+  G+  +
Sbjct: 28  DSRGNNNVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPN----NDTSPGSTN--GVQGE 81

Query: 70  MNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEK 129
             SR++  D VFG ++ Q  ++  +AE + D F  GYN T+L YG T +GK+YTM G   
Sbjct: 82  SPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP-- 139

Query: 130 LYDGQLSDSAGIIPRIMFKLFDAL----EATDSDFLVKCSYIELYNEELKDLLDESHDSS 185
                  D+ G+IPRI  ++F+ +     + D +++V  S++E+Y E++ DLL ES + S
Sbjct: 140 ------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGESINKS 193

Query: 186 KRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESG 245
                                                   P      R S T  +   S 
Sbjct: 194 AS--------------------------------------PKKTSEKRTSLTIHE--SST 213

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK--NCDG 303
            G+YVQ+     + +  E ++ +  G   R  +ST MN  SSRSH I  I L K  N +G
Sbjct: 214 FGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEG 273

Query: 304 ELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---IHIP 360
            + + S + LVDLAGSE +S++ A     +EA  IN SL +LG VIN+L  K     HIP
Sbjct: 274 SIQK-SDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIP 332

Query: 361 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           +R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + ++AK I+N+
Sbjct: 333 YRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  187 bits (475), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 206/414 (49%), Gaps = 65/414 (15%)

Query: 40  KSSVVVTVPDVTGSNEVSINTTDEVGI---AAKMNSRTYTVDKVFGPSADQSLIFKEIAE 96
           K  VVV +  +      ++   DE  +    A   +R +  D VFG  A Q  +F  +AE
Sbjct: 22  KMKVVVRLRPLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAE 81

Query: 97  PLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDAL--- 153
            + D F  GYN T+L YG T +GK+YTM G             G+IPRI  ++F+ +   
Sbjct: 82  EMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLL 133

Query: 154 -EATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREP 212
               D +++V  S++E+Y E++ DLL ES +                             
Sbjct: 134 KNCADIEYVVSVSFLEIYLEKVYDLLGESIN----------------------------- 164

Query: 213 EVAHNGFSRRRQRPPPVKANRMSATKQQLSESGS-GIYVQNVQEFHIINAREGINVLQKG 271
                    +   P      R S T   + ES + G+YV+      + +  E +N +  G
Sbjct: 165 ---------KASSPKKNSDKRASLT---VHESNTFGVYVEGATIVSVSDGDELLNCIHLG 212

Query: 272 LKHRQVASTKMNDFSSRSHTIFTIMLYK--NCDGELFRVSKMNLVDLAGSENISRSGAQN 329
              R   ST MN  SSRSH I  I L K  N +G + + S + LVDLAGSE ++++ A  
Sbjct: 213 EAQRYKGSTDMNLESSRSHAIVKINLLKRDNLEGNIQK-SDLFLVDLAGSEKVAKTNAVG 271

Query: 330 QRAKEAGSINQSLLTLGRVINSLA--DKSIHIPFRESKLTRLLQDSLGGNTKTALIATIS 387
              +EA  IN SL +LG VIN+L   +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +
Sbjct: 272 ATLEEAKKINLSLSSLGNVINALTQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCA 331

Query: 388 PAKINADETSSTLEYAAKAKNIKNRPQLGA--LMMKDILVKNISSELAKIKSDF 439
             K N  ET +TL + ++AK+IKN+  +    L +K  L + I ++L K + D+
Sbjct: 332 CDKSNESETLTTLRFGSRAKHIKNKAIVNKSDLFLKKKLERKI-AQLEKKEQDY 384

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  187 bits (474), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 183/352 (51%), Gaps = 65/352 (18%)

Query: 71  NSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           N R +T D+VF   + Q  +++ +A  +   F +GYN T+L YG T +GK++TM G +  
Sbjct: 71  NDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK-- 128

Query: 131 YDGQLSDSAGIIPRIMFKLFDALEATDSD---FLVKCSYIELYNEELKDLLDESHDSSKR 187
                 ++ G+IPRI   +F  +E  D +   F V  S++E+Y E++ DLL +S +    
Sbjct: 129 ------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLEK--- 179

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
                                                  P  K  R+S +     +SG  
Sbjct: 180 ---------------------------------------PADK--RISLSLHDTKDSG-- 196

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELF 306
           IYV+ +   ++ + +E ++ +++G   R V+ST MN  SSRSH+I  I L K N   E  
Sbjct: 197 IYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEENI 256

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------KSIHI 359
           + S + LVDLAGSE + ++ A     +EA  IN SL  LG VIN+L          S HI
Sbjct: 257 QHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSAHI 316

Query: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKN 411
           P+R+SKLTRLLQDSLGGN+KT LI   S ++ N  ET STL + ++AK IKN
Sbjct: 317 PYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  182 bits (461), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 132/413 (31%), Positives = 206/413 (49%), Gaps = 92/413 (22%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI VAVR R   ERE+    S++  V D    N + +   ++     K  +R++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVED---GNVIQVKDRNQ-----KNETRSFHFDQCF 53

Query: 82  GPS----ADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137
             S    ADQ  ++++++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 138 SAGIIPRIMFKLFDALEATDSD-------FLVKCSYIELYNEELKDLLDESHDSSKRLRI 190
           S GI+ R+  +LF+  E  +S        F ++CSY+E+YNE ++DLL            
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLG----------- 154

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
                                      G  R R+R                       +V
Sbjct: 155 --------------------------TGRCRIRERADKT------------------TFV 170

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY---KNCDGELF- 306
           + ++EF + +  + +N +++G + R + ST +N++SSRSHTIFTI +    K+  G +  
Sbjct: 171 EGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHVIE 230

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH--IPFRES 364
           R S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R++
Sbjct: 231 RHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYRDA 290

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGA 417
            LT +L++SLGGN+KT +IA +SP   + +ET STL YA  A+N+K   QL A
Sbjct: 291 ALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQLNA 341

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  168 bits (426), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 127/408 (31%), Positives = 196/408 (48%), Gaps = 83/408 (20%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI VA+R R +  RE    S     V     SNE+++   +   +   +   T+  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPS-----VIKRKTSNEITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 82  GPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGI 141
             S++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 142 IPRI---MFKLFDAL--EATDSD----FLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
           IP +   +FK+ D    E  D D    F V  SY ++YNE++ D+L              
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLS------------- 156

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                                    G +  R R  P K                  Y++ 
Sbjct: 157 ------------------------GGCNVLRVRDGPRKVT----------------YIEG 176

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK----NCDGELFRV 308
           + +  + +  E +  +++G   R VA T +N+ SSRSH I TI + +    +    + RV
Sbjct: 177 LSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDTVERV 236

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-DKSIHIPFRESKLT 367
           S + LVDLAGSE    S  +++R KE  +IN+SL+TL RV+  L+ +K   +P+RES LT
Sbjct: 237 SSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRESLLT 296

Query: 368 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQL 415
           R+L+D+L GN+ T ++A ISP   + +E+ STL YA+ AK+++    L
Sbjct: 297 RVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHL 342

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  166 bits (421), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 172/363 (47%), Gaps = 87/363 (23%)

Query: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137
           D+ FG    QS  +K        D + GYNC +L YG T +GKTYTM G+ K      +D
Sbjct: 64  DEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------ND 117

Query: 138 SAGIIPRIMFKLFDALEATD----------SDFLVKCSYIELYNEELKDLLDESHDSSKR 187
           + G+IPR    LF  +E+            S++ V CS  E+YNE++ DLL+ +   S  
Sbjct: 118 TRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNEVQS-- 175

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
                                           S+ R     V+ NR              
Sbjct: 176 -------------------------------CSKYR-----VRENR-----------DRS 188

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-----NCD 302
           +Y++N+ E  + N  + I  ++ G ++R   ST MN  SSRSH I +I + +     N +
Sbjct: 189 MYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNTN 248

Query: 303 GELFRVSKMNLVDLAGSE-NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK------ 355
             +   S    VDLAGSE + +     N R KE  SIN+SL TL RV+ SL  +      
Sbjct: 249 SSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKYN 308

Query: 356 --------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAK 407
                   +I +PFRES LT +L+D+LGGN+KT +IA ISP   N +E++STL YA  A+
Sbjct: 309 SNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIAQ 366

Query: 408 NIK 410
            IK
Sbjct: 367 TIK 369

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  169 bits (427), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 177/351 (50%), Gaps = 72/351 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F   + Q  IF++   PL D  + G+N TV  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 135 LSDSAGIIPRIMFKLFDALE-----ATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLR 189
            S+  GII R M +LF  +E     +  S   +  SY+E+YNE ++DLL +    SK+L 
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL-KPETPSKKLI 202

Query: 190 IFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIY 249
           I                   RE                               +  S I 
Sbjct: 203 I-------------------RE-------------------------------DQNSKIS 212

Query: 250 VQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI---MLYKNCD--GE 304
           V N+      N ++ I+++ +G  +R  + T+ N+ SSRSH++  I    + KN D  G 
Sbjct: 213 VTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLKNFDDIGS 272

Query: 305 LFRV-SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKSIHIPF 361
             ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    KS HIP+
Sbjct: 273 TNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINKKSCHIPY 332

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           R+SKLTRLL+ SLGGN KT +I  +SP+ ++ DET +TL+YA +AK IK +
Sbjct: 333 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  168 bits (425), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 114/348 (32%), Positives = 174/348 (50%), Gaps = 69/348 (19%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F  ++ Q+ ++KE   PL D  + GYN TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
                G+I   M +LF+ ++    + +F +  SY+E+YNE ++DLL +    SKRL I  
Sbjct: 206 -PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL-KPETPSKRLII-- 261

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                            RE    H                               I V N
Sbjct: 262 -----------------REDTQNH-------------------------------IKVAN 273

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FRV 308
           +   H     + +N++ +G  +R  + T+ N+ SSRSH +  I ++  N   +L      
Sbjct: 274 LSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTF 333

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSIHIPFRES 364
           + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      ++ HIP+R+S
Sbjct: 334 ATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSRTCHIPYRDS 393

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 174/348 (50%), Gaps = 69/348 (19%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F  ++ QS ++KE   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
                GII   M +LF+ +     + +F +  SY+E+YNE ++DLL +    SKRL I  
Sbjct: 206 -PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL-KPETPSKRLVI-- 261

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                            RE   +H                               I V N
Sbjct: 262 -----------------REDTQSH-------------------------------IKVAN 273

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FRV 308
           +   H     + ++++ +G  +R  + T+ N+ SSRSH +  I ++  N   +L      
Sbjct: 274 LSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTF 333

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSIHIPFRES 364
           + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S HIP+R+S
Sbjct: 334 ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDS 393

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  167 bits (424), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 137/449 (30%), Positives = 217/449 (48%), Gaps = 99/449 (22%)

Query: 54  NEVSINTTDEVGIAAKMNSRTY---------TVDKVFGPSADQSLIFKEIAEPLFDDFMK 104
           N++S N  + +  +++++ R Y           DK+   ++ Q  +F+   EPL D  + 
Sbjct: 80  NKISENILNSIYSSSQLSRRHYRKNGGELRFIFDKLLDQNSTQQHVFQSTTEPLLDSILD 139

Query: 105 GYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATD--SDFLV 162
           GYN TV  YG T  GKTYT++G          ++ GII   +  LF+ +E      +  +
Sbjct: 140 GYNGTVFAYGATGCGKTYTISGT--------PENPGIIFLTLQSLFNKIENLKDTKEISI 191

Query: 163 KCSYIELYNEELKDLLDESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRR 222
             SY+E+YNE +KDLLD +  SSK+L I                   RE           
Sbjct: 192 SLSYLEIYNESIKDLLDPT-ISSKKLVI-------------------RE----------- 220

Query: 223 RQRPPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKM 282
                               ++ + I V N+  +      E ++++ +G  +R  +ST  
Sbjct: 221 --------------------DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHA 260

Query: 283 NDFSSRSHTIFTIMLYK--------NCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKE 334
           N+ SSRSH +  I L +        N   +LF  S ++++DLAGSE  + +  + +   E
Sbjct: 261 NETSSRSHAVLQIHLTQQNKLNNDINSTEQLF--STLSIIDLAGSERAASTKNRGETLLE 318

Query: 335 AGSINQSLLTLGRVINSL-------ADKSIHIPFRESKLTRLLQDSLGGNTKTALIATIS 387
             +IN+SLL LG  IN+L       + + IHIP+R+SKLTRLL+ SLGGN KT +I  +S
Sbjct: 319 GANINKSLLALGNCINALCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVS 378

Query: 388 PAKINADETSSTLEYAAKAKNIKN---RPQLGALMMKDILVKNISSELAKI--KSDFLST 442
           P+  + DET +TL+YA +AK IK    R QL        L ++ISS L  I  +   +  
Sbjct: 379 PSSKHYDETLNTLKYANRAKEIKTKIIRNQLS-------LNRHISSYLKMITQQKQEIEN 431

Query: 443 KSKDGIYMSHEHYQEIVNDLENCQTEIQE 471
             K+ + + + H  +I  DL+  + EI +
Sbjct: 432 LRKNQLTIINNHLSKIEIDLKKIEFEIDQ 460

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  162 bits (410), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 176/369 (47%), Gaps = 84/369 (22%)

Query: 72  SRTYTVDKVFGPS----ADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD 127
           ++ +  D  FG +     DQS+I++ +        ++GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 128 EKLYDGQLSDSAGIIPRIMFKLFDALEATD---------SDFLVKCSYIELYNEELKDLL 178
           +         + GI+PR   +LF+               +DF VKCS+ E+YNE++ DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

Query: 179 DESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATK 238
                                                    S   QR   ++     +T 
Sbjct: 161 -----------------------------------------SSLSQRKCKIRERHDHST- 178

Query: 239 QQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML- 297
                     +V+ ++E  + N  E I+ + KG ++R V ST MN  SSRSH IF I + 
Sbjct: 179 ----------FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVN 228

Query: 298 ----YKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA 353
               +K     +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA
Sbjct: 229 QKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLA 288

Query: 354 D----KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
           +    +S  IP+RES LT +L+++LGGN+ T L+A +SP   N  E+ STL YA+  K +
Sbjct: 289 EGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKV 346

Query: 410 KNRPQLGAL 418
           K    + ++
Sbjct: 347 KTNATINSM 355

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  167 bits (422), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 173/348 (49%), Gaps = 69/348 (19%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F  ++ Q+ ++KE   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
                GII   M +LF+ +     + DF +  SY+E+YNE ++DLL +    SKRL I  
Sbjct: 206 -PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL-KPETPSKRLVI-- 261

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                            RE    H                               I V N
Sbjct: 262 -----------------REDTQNH-------------------------------IKVAN 273

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FRV 308
           +   H     + ++++ +G  +R  + T+ N+ SSRSH +  I ++  N   +L      
Sbjct: 274 LSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTF 333

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSIHIPFRES 364
           + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      +S HIP+R+S
Sbjct: 334 ATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDS 393

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  164 bits (415), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 115/350 (32%), Positives = 174/350 (49%), Gaps = 69/350 (19%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           YT D VF P A    ++    +PL D    G+N TV  YGMT +GKTYTM+G     DG 
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG----VDG- 158

Query: 135 LSDSAGIIP---RIMF-KLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRI 190
              +AG+IP     M+ K+FD+    +  +    SY+E+YNE++ DLL+   D       
Sbjct: 159 ---NAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFD------- 208

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
                                              P P++++      +   +   G+ V
Sbjct: 209 -----------------------------------PKPLRSSIAVPELKIRDDPNYGVRV 233

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--CDGELFRV 308
             + E    +  E +N ++ G KHR+ +ST  N  SSRSH I  I L  +    GE+   
Sbjct: 234 IGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDLSSGEVV-T 292

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK---------SIHI 359
           S ++L DLAGSE ++   AQ++R +E   IN+SLL LG VI+ L+ +         + HI
Sbjct: 293 STLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTESVNNSHI 349

Query: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
           P+R+SKLTR+LQ +L GN+    I TI  +    +E+ +TL +A++AKN+
Sbjct: 350 PYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 174/350 (49%), Gaps = 71/350 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F   A Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD--FLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
             +  GII R+M +LF+ +E       F +  SY+E+YNE ++DLL              
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLLKPE----------- 251

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                           P+   +  +G            AN++S              V N
Sbjct: 252 --------------TVPKRLIIREDG------------ANKIS--------------VSN 271

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FRV 308
           +   +    +E I+++ KG  +R  + T+ N+ SSRSH +  I ++  N   +L      
Sbjct: 272 LSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLTSEHTF 331

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKSIHIPFR 362
           + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++S HIP+R
Sbjct: 332 ATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSCHIPYR 391

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           +SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 392 DSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  163 bits (413), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 114/348 (32%), Positives = 171/348 (49%), Gaps = 69/348 (19%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F  ++ Q  ++KE   PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------- 205

Query: 135 LSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
                GII   M +LF+ +     + +F +  SY+E+YNE + DLL      SKRL I  
Sbjct: 206 -PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL-RPETPSKRLVI-- 261

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                            RE    H                               I V N
Sbjct: 262 -----------------REDTQNH-------------------------------IKVAN 273

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FRV 308
           +   H     + ++++ +G  +R  + T+ N+ SSRSH++  I ++  N   +L      
Sbjct: 274 LSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKLVDLTSQHTF 333

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSIHIPFRES 364
           + ++++DLAGSE  S +  +  R  E  +IN+SLL LG  IN+L      ++ HIP+R+S
Sbjct: 334 ATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRTCHIPYRDS 393

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           KLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 394 KLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  162 bits (411), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 110/349 (31%), Positives = 167/349 (47%), Gaps = 70/349 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D+VF   + Q  +++    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 177

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD--FLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
             ++ GII   M +LF  +E       F +  SY+E+YNE ++DLL              
Sbjct: 178 -PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL-------------- 222

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                             EPE        R                    +S   I V N
Sbjct: 223 ------------------EPETPTKKLVLRE-------------------DSHRHITVAN 245

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-YKNCDGEL---FRV 308
           +    +    + ++++ KG  +R  ++T  N+ SSRSH +  + +  +N   EL    + 
Sbjct: 246 LSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELTEDHKF 305

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFRE 363
           + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H+P+R+
Sbjct: 306 ATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGYHVPYRD 365

Query: 364 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 366 SKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 176/349 (50%), Gaps = 71/349 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F   A Q+ +++    PL D  + G+N TV  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 135 LSDSAGIIPRIMFKLFDALE-ATDSD-FLVKCSYIELYNEELKDLLDESHD-SSKRLRIF 191
             +  G+I   M +LF  +E   DS  F +  SY+E+YNE ++DLL  S D SSK+L I 
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDISSKKLVI- 244

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQ 251
                             RE                               +S  GI V 
Sbjct: 245 ------------------RE-------------------------------DSIKGISVA 255

Query: 252 NVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FR 307
           N+        ++ ++++ +G  +R  + T  N+ SSRSH +  I ++ KN   EL     
Sbjct: 256 NLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAELSEAHT 315

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----DKSIHIPFRE 363
            + ++++DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L       + H+P+R+
Sbjct: 316 FATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCHVPYRD 375

Query: 364 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           SKLTRLL+ SLGGN KT +I  I+P+  + DET +TL+YA +AK IK +
Sbjct: 376 SKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  161 bits (407), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 115/360 (31%), Positives = 180/360 (50%), Gaps = 74/360 (20%)

Query: 68  AKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD 127
           AK N   +  DK+F  ++ Q  ++      L D  + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 128 EKLYDGQLSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSS 185
           +        ++ GII R+M +LF+ +E    +  F +  SY+E+YNE + DLL +    S
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL-KPDTPS 294

Query: 186 KRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESG 245
           K+L I                   RE                               +  
Sbjct: 295 KKLII-------------------RE-------------------------------DKD 304

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGE 304
           S I V N+   +  + ++ I+++ +G  +R  +ST+ N+ SSRSH +  I ++  N   +
Sbjct: 305 SKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNTKID 364

Query: 305 L---FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-------- 353
           L      + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L         
Sbjct: 365 LTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNNTRR 424

Query: 354 -DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
            +   HIP+R+SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 425 RNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 484

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  159 bits (401), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 194/414 (46%), Gaps = 88/414 (21%)

Query: 12  RMLDDAQEELNITVAVRCRGRN--EREIKAKSSVVVTVPD-VTGSNEVSINTTDEVGIAA 68
           R L +  +EL   + V CR R   E E++  S + V+  D   GS  + I+  D      
Sbjct: 346 RKLHNELQELRGNIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDR----- 400

Query: 69  KMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE 128
             NSR +  DKVF  +A    +F+E+ + L    + GYN  +  YG T +GKTYTM    
Sbjct: 401 --NSR-FLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 129 KLYDGQLSDSAGIIPRIMFKLFDA---LEATDSDFLVKCSYIELYNEELKDLLDESHDSS 185
                 ++D  G+IP  +  +FD    L+    D+  +  +IE+YNE++ DLL       
Sbjct: 453 ------MNDPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL------- 499

Query: 186 KRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESG 245
                                  P + E+ H+G S+R                       
Sbjct: 500 ---------------RSLNPEPGPTKYEIRHDGDSQRTS--------------------- 523

Query: 246 SGIYVQNVQEFHIINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY------ 298
               + NV    +   R  +N VL+   K + +A+T  N+ SSRSH++FTI ++      
Sbjct: 524 ----ITNVTSIKL-ETRARVNTVLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSIT 578

Query: 299 -KNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI 357
            +  DG L      NLVDLAGSE I  S     R +E  +IN+SL  LG VI +L  K +
Sbjct: 579 GEASDGVL------NLVDLAGSERIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDM 632

Query: 358 -HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
            HIPFR SKLT LLQ SL G++KT +   +SP+  +  ET ++L +A+K  + K
Sbjct: 633 KHIPFRNSKLTYLLQYSLIGDSKTLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 173/349 (49%), Gaps = 70/349 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D++F   + Q  +++    PL D  + G+N TV  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD--FLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
             ++ GII + M +LF+ +E       F +  S++E+YNE ++DLL     SSK+L I  
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLC-PETSSKKLVI-- 236

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                                                           L +S   I V N
Sbjct: 237 ------------------------------------------------LEDSNESIRVSN 248

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL---FRV 308
           +  ++     + ++++ KG  +R  ++T  N+ SSRSH +  I ++  N   +L      
Sbjct: 249 LSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADLKSDHTF 308

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFRE 363
           + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L       +S H+P+R+
Sbjct: 309 ATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSCHVPYRD 368

Query: 364 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 369 SKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/378 (31%), Positives = 174/378 (46%), Gaps = 89/378 (23%)

Query: 71  NSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           N+  Y  D VF P  D   I+K  A PL D    G+N T+  YGMT +GKTYTM GD + 
Sbjct: 129 NNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNEN 188

Query: 131 YDGQLSDSAGIIPRIMFKLFDAL--EATDSDFLVKCSYIELYNEELKDLLDESHDSSKRL 188
            DG       I+P  +  LF+ +     D  + V  SY+E+YNE++ DLLD+  D +  L
Sbjct: 189 PDG-------IVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDD--DRTNHL 239

Query: 189 RIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESG--- 245
                                                   +  +R ++T  +L+ S    
Sbjct: 240 ----------------------------------------LTPSRFTSTPSRLNSSELRI 259

Query: 246 -----SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN 300
                 G+ +  + E     ++E +  ++ G  +R+ + T+ N  SSRSH +  + L  +
Sbjct: 260 RDDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTH 319

Query: 301 --CDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI- 357
              DG     S + L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S+ 
Sbjct: 320 NVIDGSK-TSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLS 375

Query: 358 -----------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINAD 394
                                  HIP+R+SKLTRLLQ +L GN+    I TI P      
Sbjct: 376 NSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYA 435

Query: 395 ETSSTLEYAAKAKNIKNR 412
           ET +TL +A++AKN+  R
Sbjct: 436 ETINTLRFASRAKNVSLR 453

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 175/349 (50%), Gaps = 67/349 (19%)

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S+ Y  D++F  +   + +FKEI + L    + G+N  +  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 132 DGQLSDSAGIIPRIMFKLFDALEATDSD---FLVKCSYIELYNEELKDLL-DESHDSSKR 187
              L+D+ G+IP  +  +FD  E+       + + C +IE+YNE + DLL D S D ++ 
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTDGNE- 534

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
                                P + E+ H+                    K+ ++ S + 
Sbjct: 535 ------------------AGSPNKHEIRHD--------------------KETMTTSVTN 556

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR 307
           I    +    I+N     NVL+K  K R  A+T  N+ SSRSH++F  M+Y     E+  
Sbjct: 557 INTIALNNKGIVN-----NVLKKATKLRATAATNSNERSSRSHSVF--MIYLKGKNEITG 609

Query: 308 VSK---MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DKSIHIPF 361
            S    +NLVDLAGSE ++ S A   R +E  +IN+SL  LG VI++L    +   HIPF
Sbjct: 610 DSSEGILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPF 669

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           R SKLT LLQ SL G++KT +   ISP K + +ET ++L +A+K  + K
Sbjct: 670 RNSKLTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 132/417 (31%), Positives = 189/417 (45%), Gaps = 85/417 (20%)

Query: 12  RMLDDAQEELNITVAVRCRGR--------NEREIKAKSSVVVTVPDVTGSNEVSINTTDE 63
           R L +  +EL   + V CR R        N   IK     V    D  G   ++IN  + 
Sbjct: 338 RALHNELQELRGNIRVYCRIRPPLPHEDDNIEHIK-----VQPFDDDNGDQGMTINRGNS 392

Query: 64  VGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYT 123
             I  K        DK+F        IFKE+ + L    + GYN  +  YG T +GKTYT
Sbjct: 393 QVIPFKF-------DKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYT 444

Query: 124 MTGDEKLYDGQLSDSAGIIPRIM---FKLFDALEATDSDFLVKCSYIELYNEELKDLLDE 180
           M          L+   GI+P  +   F   D L A    + V C +IE+YNE + DLL  
Sbjct: 445 M----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL-- 492

Query: 181 SHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQ 240
                                                    R   P     +R + +K +
Sbjct: 493 -----------------------------------------RSGAPSQENNDRNADSKHE 511

Query: 241 L--SESGSGIYVQNVQEFHIINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIML 297
           +   +     Y+ N+    ++++R+ ++ VL++  K R  AST  N+ SSRSH+IF I L
Sbjct: 512 IRHDQELKTTYITNITTC-VLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIFIIHL 570

Query: 298 YKNCDGELFRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI---NSLA 353
               +G   +    +NLVDLAGSE ++ S    +R +E  SIN+SL  LG VI   NS  
Sbjct: 571 EGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIHALNSPD 630

Query: 354 DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
            +  HIPFR SKLT LLQ SL G++KT +   ISPA ++ +ET ++L +A+K  N K
Sbjct: 631 GQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNNTK 687

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  158 bits (399), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 170/359 (47%), Gaps = 78/359 (21%)

Query: 71  NSRTYTV--DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE 128
           N+ TY+   D VF      S +F EI E L    + GYN  +  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 129 KLYDGQLSDSAGIIP---RIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS 185
                 L+ + G+IP   + +F   D+L+    ++ V C +IELYNE + DL  ++    
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRDN---- 542

Query: 186 KRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESG 245
                                  P +  ++H            ++ +  S          
Sbjct: 543 ----------------------GPTKDSISH-----------EIRHDDQSKI-------- 561

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKNCDG 303
              YV N++ F I N  + I ++ K    R  +ST +N  SSRSH IF I L  Y +   
Sbjct: 562 --TYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNHKTN 619

Query: 304 ELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----------- 352
           E   +SK+NLVDLAGSE I+ S  Q  R KE  SIN+SL  LG VI++L           
Sbjct: 620 EKC-ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLNSN 678

Query: 353 -ADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
              K+ HIPFR SKLT LL+ SL G++KT +   +S  + + +ET ++L +A K  N K
Sbjct: 679 DLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  157 bits (396), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 110/356 (30%), Positives = 177/356 (49%), Gaps = 71/356 (19%)

Query: 69  KMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE 128
           +   + +  D++F     Q  +++    PL D  + G+N TV  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 129 KLYDGQLSDSAGIIPRIMFKLFDALEATD--SDFLVKCSYIELYNEELKDLLDESHDSSK 186
                  S+  GII   M +LF  +E       F ++ S++E+YNE++ DLLD  + SSK
Sbjct: 177 -------SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLD-PNISSK 228

Query: 187 RLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGS 246
           +L I                   RE                               +S +
Sbjct: 229 KLVI-------------------RE-------------------------------DSYN 238

Query: 247 GIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGEL 305
             +V N+ +    N  E ++++ KG  +R  + T  N+ SSRSH +  I + + N   ++
Sbjct: 239 RTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNRTADI 298

Query: 306 FR---VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKS 356
            +    + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L         S
Sbjct: 299 KQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTRTGFS 358

Query: 357 IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
            H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+YA +AK IK +
Sbjct: 359 CHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 193/415 (46%), Gaps = 71/415 (17%)

Query: 12  RMLDDAQEELNITVAVRCRGRNE-REIKAKSSVVVTVPDVTGSNEVSINTTDEV--GIAA 68
           R L +  +EL   + V CR R     I++K +  + V D    N +    + EV  GI  
Sbjct: 336 RSLHNELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQ---SMEVMKGIEV 392

Query: 69  KMNSRT-----YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYT 123
             N+ T     +  DK+F  +   + +FKE+ + L    + GYN  +  YG T +GKTYT
Sbjct: 393 NNNNATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYT 451

Query: 124 MTGDEKLYDGQLSDSAGIIPRIMFKLFDA---LEATDSDFLVKCSYIELYNEELKDLLDE 180
           M          L    GIIP  +  +F+    L+     + + C ++E+YNE + DLL  
Sbjct: 452 M----------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRS 501

Query: 181 SHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQ 240
           S +   R                     P + E+ H+            + NR +     
Sbjct: 502 SSNDDTR---------------NIDSNIPTKHEIRHD------------QENRNTT---- 530

Query: 241 LSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-- 298
                    + N+   ++ +     N+L++  K R  AST  N+ SSRSH+IF I L   
Sbjct: 531 ---------ITNIVTRNLDSEETADNILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGS 581

Query: 299 KNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA---DK 355
            +  GE      +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++L      
Sbjct: 582 NSLTGE-ESYGILNLVDLAGSERINSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQG 640

Query: 356 SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
             HIPFR SKLT LLQ SL GN+KT +   ISP+  + +ET ++L +A+K  + K
Sbjct: 641 KRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSANHINETINSLRFASKVNSTK 695

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  155 bits (391), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 108/351 (30%), Positives = 171/351 (48%), Gaps = 74/351 (21%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F   + Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 135 LSDSAGIIPRIMFKLFDALEATD--SDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
             +  GII   M +LF  +E      +F +  SY+E+YNE ++DLL+     SK+L I  
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNPD-TPSKKLVI-- 254

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                            RE                               ++ S I V N
Sbjct: 255 -----------------RE-------------------------------DNESKISVAN 266

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN------CDGELF 306
           +        ++ ++++ KG  +R  ++T  N+ SSRSH +  I + +           +F
Sbjct: 267 LSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNRTVDLTSSHVF 326

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPF 361
             + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       +S H+P+
Sbjct: 327 --ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGTRRSCHVPY 384

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           R+SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+YA +AK IK +
Sbjct: 385 RDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 435

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 118/372 (31%), Positives = 182/372 (48%), Gaps = 74/372 (19%)

Query: 54  NEVSINTTDEVGIAAKMNS-RTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLV 112
           N + + +  EV    + N  + +  DK+F   A Q  +F+    PL D  + G+N TV  
Sbjct: 106 NTMLVGSRGEVRRRMRRNGEQKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFA 165

Query: 113 YGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLF---DALEATDSDFLVKCSYIEL 169
           YG T  GKT+T++G          DS GII   M +LF   + L+ T + F +  SY+E+
Sbjct: 166 YGATGCGKTFTISGT--------PDSPGIIFLTMQELFQRINNLKDTKT-FELTVSYLEI 216

Query: 170 YNEELKDLLDESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPV 229
           YNE ++DLL E    S++L I                   RE                  
Sbjct: 217 YNETIRDLL-EPDTPSQKLII-------------------RE------------------ 238

Query: 230 KANRMSATKQQLSESGSGIYVQNVQEFHIINAREGI-NVLQKGLKHRQVASTKMNDFSSR 288
                        +S S   V N+  +H     E + +++ +G  +R  + T  N+ SSR
Sbjct: 239 -------------DSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSR 284

Query: 289 SHTIFTIMLYKNCDGELFRVSKM----NLVDLAGSENISRSGAQNQRAKEAGSINQSLLT 344
           SH +  + + ++      +  KM    +++DLAGSE  S +  + +R  E  +IN+SLL 
Sbjct: 285 SHAVLQVHVVQSSRTVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLA 344

Query: 345 LGRVINSLADKS----IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTL 400
           LG  IN+L         H+P+R+SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL
Sbjct: 345 LGNCINALCMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTL 404

Query: 401 EYAAKAKNIKNR 412
           +YA +AK+IK +
Sbjct: 405 KYANRAKDIKTK 416

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  154 bits (388), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 111/350 (31%), Positives = 171/350 (48%), Gaps = 72/350 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F     Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 143 FVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSGTR------ 196

Query: 135 LSDSAGIIPRIMFKLF---DALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIF 191
             ++ GII R M +LF   DAL  T  DF +  S++E+YNE + DLL  S D+       
Sbjct: 197 --ENPGIIFRTMEELFVKMDALAGT-KDFELTVSFLEIYNETIHDLL--SPDT------- 244

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQ 251
                                             PP     R         +S   I V 
Sbjct: 245 ----------------------------------PPQKLVIR--------EDSNEKISVS 262

Query: 252 NVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGELFR--- 307
           N+      + ++ ++++ +G  +R  + T+ N  SSRSH +  I ++ +N   +L     
Sbjct: 263 NLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNKLVDLKEHQT 322

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-----KSIHIPFR 362
              ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++ H+P+R
Sbjct: 323 FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCSNDGSHRNQHVPYR 382

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           +SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 383 DSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEIKTK 432

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  154 bits (388), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 107/350 (30%), Positives = 170/350 (48%), Gaps = 72/350 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F  +A Q  ++      L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 135 LSDSAGIIPRIMFKLFDALEATDS--DFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
             +  G+I   M +LF  +E  +    F +  SY+E+YNE ++DLL              
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLLS------------- 227

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSE-SGSGIYVQ 251
                              PE                    MS  K  + E S + I V 
Sbjct: 228 -------------------PE--------------------MSPKKLVIREDSENRISVA 248

Query: 252 NVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNC-DGEL---FR 307
           N+         + ++++  G  +R  ++T  N+ SSRSH +  I + ++    E+     
Sbjct: 249 NLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSRTAEITSDHT 308

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPFR 362
            +K++++DLAGSE  + +  + +R +E  +IN+SLL LG  IN+L       ++ H+P+R
Sbjct: 309 FAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGTRRTCHVPYR 368

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           +SKLTRLL+ SLGGN KT +I  +SP+  + DET +TL+YA +AK IK +
Sbjct: 369 DSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  153 bits (387), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 194/412 (47%), Gaps = 73/412 (17%)

Query: 12  RMLDDAQEELNITVAVRCRGRNE--REIKAKSSVVV-TVPDVTGSNEVSINTTDEVGIAA 68
           R L +  +EL   + V CR R     E +  S +++    +  G+  ++IN  +      
Sbjct: 354 RKLHNELQELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNE-----G 408

Query: 69  KMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE 128
           ++ S  +  D +F PS     IF+EI + L    + GYN  +  YG T +GKTYTM    
Sbjct: 409 RILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 463

Query: 129 KLYDGQLSDSAGIIPRIM---FKLFDALEATDSDFLVKCSYIELYNEELKDLLDE--SHD 183
                 L+   G+IP  +   FK    L+    ++ ++C YIE+YNE + DLL +  SHD
Sbjct: 464 ------LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRDFKSHD 517

Query: 184 SSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSE 243
           +     I D                 ++ ++ H+                          
Sbjct: 518 NIDE--ILDS----------------QKHDIRHD-------------------------H 534

Query: 244 SGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCD 302
              G Y+ NV    + +  +   +L+K  K R  A+T+ N+ SSRSH++F + +  +N  
Sbjct: 535 EKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLH 594

Query: 303 GELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL----ADKSIH 358
                  K+NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI +L    A K  +
Sbjct: 595 TGETSQGKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKR-Y 653

Query: 359 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           IPFR SKLT LLQ SL G++KT +   I P   +  ET ++L +A+K  + K
Sbjct: 654 IPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  152 bits (385), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 106/347 (30%), Positives = 170/347 (48%), Gaps = 62/347 (17%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF P  +   +++ +A P+ D   +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 135 LSDSAGIIPRIMFKLFDALEA--TDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
                GIIP  +  +FD +        F V+ SY+E+YNE                RIFD
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE----------------RIFD 201

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                           P+   +  N           V ++ ++   +   +   G+ V  
Sbjct: 202 LLNL------------PQGKTLNSNIM---------VPSSTLTNDLKLRDDLKYGVKVVG 240

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR---VS 309
           + E ++ + +E +  +  G  +R+   T  N  SSRSH +  I ++  C  E+     +S
Sbjct: 241 LVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF--CTDEITGEQVMS 298

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI-------HIPFR 362
            ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S        HIP+R
Sbjct: 299 TLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNVGHIPYR 355

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
           +SKLTR+LQ +L G++  A I T+      + E+ +T+ +A++AKNI
Sbjct: 356 DSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI 402

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 110/351 (31%), Positives = 171/351 (48%), Gaps = 74/351 (21%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F  +A+Q+ ++      L D  + G+N TV  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 135 LSDSAGIIPRIMFKLFDALEATDS--DFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
             +  GII   M +LF  +E+     +  +  SY+E+YNE ++DLL+  + SSK+L I  
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLN-PNVSSKKLVI-- 236

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                                        R      +  + +S  K Q         VQ 
Sbjct: 237 -----------------------------REDSDQKITVSNLSHHKPQT--------VQE 259

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN------CDGELF 306
           V +F I           +G  +R  + T  N+ SSRSH +  I + +            F
Sbjct: 260 VMDFVI-----------RGNMNRTTSPTDANETSSRSHAVLQIHIAQTDRTPDLISNSTF 308

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIHIPF 361
             + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L       ++ H+P+
Sbjct: 309 --ATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGTRRTCHVPY 366

Query: 362 RESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           R+SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL YA +AK+IK +
Sbjct: 367 RDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/344 (33%), Positives = 170/344 (49%), Gaps = 64/344 (18%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           Y+ DKVF  +     IFKE++E L    + G+N  +  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD---FLVKCSYIELYNEELKDLLDESHDSSKRLRIF 191
           L+   GIIP     +FD ++ +  +   + V C ++E+YN+E+ DLL    + S      
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSN----- 486

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQ 251
                                  + NG        P  K +   A+K  + E+   I   
Sbjct: 487 -----------------------SSNG--------PRHKIHHDDASKTTVVENLETI--- 512

Query: 252 NVQEFHIINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDG-ELFRVS 309
                  + ++E ++ VL+  +K R  AST  N+ SSRSH+IF I ++   +G    R  
Sbjct: 513 ------TLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGLGEERNG 566

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKL 366
            +NL+DLAGSE +S S  Q++R KE   IN+SL  LG V+NSL        HI FR+SKL
Sbjct: 567 LLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISFRDSKL 626

Query: 367 TRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           T LLQ SL GN+KT ++  IS +  + +ET  +L +A K  + K
Sbjct: 627 TYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  151 bits (381), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 114/393 (29%), Positives = 188/393 (47%), Gaps = 68/393 (17%)

Query: 43  VVVTVPDVTGSNEVSI-NTTDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDD 101
           +V   P    +NE  + N  D   IA   +   + +D++F        I+ E+ +PL D 
Sbjct: 77  IVAIRPKPISNNEKKVWNIVDNKRIAHD-DVGEFRLDRIFDCDVSNLEIYSELCKPLIDK 135

Query: 102 FMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATD---- 157
              GYN T+  YGMT +GKT+TM+G +        +  G+IP  +  LF+ +   +    
Sbjct: 136 LAMGYNATLFAYGMTGSGKTFTMSGTQ--------EDTGLIPLSISHLFNTINEENLLGK 187

Query: 158 SDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHN 217
             + +  SY+E+YNE+L DLLD +                               E  + 
Sbjct: 188 KKYEMLVSYMEIYNEKLYDLLDTN------------------------------VEGVNF 217

Query: 218 GFSRRRQRPPPVKANRMSATKQQLSESGS-GIYVQNVQEFHIINAREGINVLQKGLKHRQ 276
           G+S   Q PP    +  SA   ++ +    GI V  + E    +  + +  ++ G K+++
Sbjct: 218 GYSSNLQTPPRFGNSFNSAQDLRIRDDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKK 277

Query: 277 VASTKMNDFSSRSHTIFTI-MLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEA 335
           ++ T+ N  SSRSH+I  + ++  + +  +   S ++L DLAGSE   ++ +Q +R KE 
Sbjct: 278 ISETEYNSRSSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEG 334

Query: 336 GSINQSLLTLGRVINSLADKS-------------------IHIPFRESKLTRLLQDSLGG 376
             IN+SLL LG VI  L+ +S                    HIP+R+SKLTR+LQ +L G
Sbjct: 335 AFINKSLLALGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSG 394

Query: 377 NTKTALIATISPAKINADETSSTLEYAAKAKNI 409
           N+    I T+      + ET +TL +A++AKN+
Sbjct: 395 NSIITTICTVDIRSDASSETLNTLRFASRAKNV 427

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  149 bits (376), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 114/358 (31%), Positives = 176/358 (49%), Gaps = 68/358 (18%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF  + +   ++ + ++P+ D   +G N TV  YGMT +GKT+TM G E      
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE------ 175

Query: 135 LSDSAGIIPRIMFKLF-----DALEATDSDFLVKCSYIELYNEELKDLLDESHD----SS 185
             ++ G+IP  +  L+     ++L+  DS F +  SY+E+YNE++ DLLD  ++    ++
Sbjct: 176 --ETLGLIPLSVAYLYSRVMEESLQG-DSRFEIAVSYLEIYNEKIYDLLDCENELKPTAA 232

Query: 186 KRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESG 245
              R+F                       AH G +R  + P  +K            +S 
Sbjct: 233 TSSRMF-----------------------AHMG-TRSSKTPVELKLRE---------DSK 259

Query: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGEL 305
            G+ +  + E    ++ E +  ++ G K R+   T  N  SSRSH I  I L K    E 
Sbjct: 260 YGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEG 319

Query: 306 FRVSK-MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI------- 357
             VS  ++L DLAGSE   ++   N+R KE   IN+SLL LG VI+ L+ +S        
Sbjct: 320 TSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGS 376

Query: 358 ------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
                 HIP+R+SKLTR+LQ +L GN     I TI      + ET +TL +A++AKN+
Sbjct: 377 SSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNV 434

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  148 bits (373), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 132/491 (26%), Positives = 228/491 (46%), Gaps = 81/491 (16%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           ++ D VF P+ D   +++E A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 135 LSDSAGIIPRIMFKLFDALEA---TDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIF 191
            S+  G+IP  +  +F  + +    +  F VK SY+E+YNE                +I+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNE----------------KIY 242

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQL-SESGSGIYV 250
           D                    +V+   F             + +  + ++  +S  G+ V
Sbjct: 243 DLLNY----------------QVSKGSF-----------GTKTTGIELKIRDDSKYGVKV 275

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCDGELFRVS 309
             + E  +  + + +  +  G  +R+   T  N  SSRSH I  I L   +    L   S
Sbjct: 276 IGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGLETTS 335

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---------HIP 360
            ++L DLAGSE   R+ AQ +R KE   IN+SLL LG VI+ L+ +S          HIP
Sbjct: 336 TLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGGHHIP 392

Query: 361 FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK---NRPQLGA 417
           +R+SKLTR+LQ +L G+     I T+     ++ ET +T+ +A++AKNI     R ++  
Sbjct: 393 YRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISLVVKRNEMDI 452

Query: 418 LMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQI- 476
              KD +++N+  +L +        KS +G   + +       D  + Q+E +  K ++ 
Sbjct: 453 SNEKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGAS--EDALSLQSENKVLKLRLE 510

Query: 477 --ESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTI-H 533
             E L  +++++L+D    QE+ E+ +     + + +E     IE Q       A  + H
Sbjct: 511 HCEKLLDKDSMILQD----QELVEIVDMLPPDVSTVLESKIQGIESQLREHKAYAAHLEH 566

Query: 534 KLKEALHTMQG 544
           +L+   H + G
Sbjct: 567 QLQNLQHQVTG 577

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score =  148 bits (374), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 114/371 (30%), Positives = 170/371 (45%), Gaps = 76/371 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF        +++   +P+ D  + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 135 LSDSAGIIPRIMFKLFDAL--EATDSD--FLVKCSYIELYNEELKDLLDESHDSSKRLRI 190
                G+IP  +  LF  +  ++ D D  F V  SY+E+YNE + DLL+   + S     
Sbjct: 218 ---ELGLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEESG---- 270

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
                             P  P  ++ G S          +N M    +   +S  G+ V
Sbjct: 271 ----------------SRPGTPSRSYMGKS---------NSNAMGVELKIRDDSKYGVKV 305

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRVS 309
             + E    +  E +  +  G K R++  T  N  SSRSH I  I L   + +    R S
Sbjct: 306 IGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRSS 365

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADKSI----------- 357
            ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK+            
Sbjct: 366 TLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVDSNISTTPT 422

Query: 358 -------------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSS 398
                              HIP+R+SKLTRLLQ +L G++    I T+      A ET +
Sbjct: 423 GSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMN 482

Query: 399 TLEYAAKAKNI 409
           TL +A++AKN+
Sbjct: 483 TLRFASRAKNV 493

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  147 bits (372), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 174/361 (48%), Gaps = 76/361 (21%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DKVF P  +   +++EI +P+ D   +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 135 LSDSAGIIPRIMFKLFDAL---EATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIF 191
             D AG+I   + ++F  +      +  + V+ SY+E+YNE++ DLL+  + S+K     
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN--YPSAK----- 244

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLS---ESGSGI 248
                               P   +  F          ++  +     +L    ++  G+
Sbjct: 245 -------------------SPGGTYGSF----------QSKNVPGAGAELPVRDDARHGV 275

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR- 307
            V  + E  + ++ + +  ++ G  +R+   T  N  SSRSH I TI +   C  EL   
Sbjct: 276 RVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKV--TCT-ELLSG 332

Query: 308 ---VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS-------- 356
               S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+  S        
Sbjct: 333 TDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGGGAA 389

Query: 357 --------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKN 408
                    H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ +A++AKN
Sbjct: 390 TPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASRAKN 449

Query: 409 I 409
           +
Sbjct: 450 V 450

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  147 bits (372), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 170/342 (49%), Gaps = 59/342 (17%)

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S  +  DK+F        +F E+ E L    + G+N  +  YG T +GKTYTM       
Sbjct: 405 SVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM------- 456

Query: 132 DGQLSDSAGIIPRIMFKLFD---ALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRL 188
              L++  GIIP  +  + D   +++     + +K  ++E+YN+ + DLL++     K  
Sbjct: 457 ---LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGKGKHK-- 511

Query: 189 RIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGI 248
                                 E EV H+   RR +    +   R    ++ L ES    
Sbjct: 512 ----------------------ECEVRHDDIGRRTELTNVI--TREFQLEEDLIES---- 543

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFR 307
                      N RE   ++Q+  K R+ A T MN+ SSRSH++F + +   N D E   
Sbjct: 544 -----------NRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERC 592

Query: 308 VSKMNLVDLAGSENISRSG-AQNQRAKEAGSINQSLLTLGRVINSL--ADKSIHIPFRES 364
              +NLVDLAGSE ++RSG    +R +E   IN+SL ++G VI++L     S+HIPFR +
Sbjct: 593 KGVLNLVDLAGSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNT 652

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKA 406
           KLT LL+ SL G++KT ++ T+SP+  + +ET ++L +A K 
Sbjct: 653 KLTYLLKHSLQGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  147 bits (371), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 129/417 (30%), Positives = 192/417 (46%), Gaps = 88/417 (21%)

Query: 12  RMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVG---IAA 68
           R L +  +EL   + V CR R   E +  SS  + +   +          DE G   I  
Sbjct: 351 RKLHNELQELRGNIRVFCRLRPALENENYSSSSIEIEKFS----------DETGMQSITI 400

Query: 69  KMNSRT--YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTG 126
           K +S+   +T D+ F        +F EI + L    + GYN  +  YG T +GKT+TM  
Sbjct: 401 KRDSKQHKFTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM-- 457

Query: 127 DEKLYDGQLSDSAGIIPRIMFKLF---DALEATDSDFLVKCSYIELYNEELKDLLDESH- 182
                   L+ + GIIP  +  +F   + L+     + +   ++E+YNE +KDL  E+  
Sbjct: 458 --------LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDA 509

Query: 183 ---DSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQ 239
              D+ + L+                       E+ H+  SR                  
Sbjct: 510 DVDDTGESLKF----------------------EIRHDNESR------------------ 529

Query: 240 QLSESGSGIYVQNVQEFHIINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIML- 297
                    ++ N+    +  +RE +N +L++ LK R  A+T  N  SSRSH++F I L 
Sbjct: 530 -------TTHITNITVCKLT-SREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLD 581

Query: 298 -YKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL--AD 354
            Y    GE      +NLVDLAGSE I     Q +R +E  +IN+SL  LG VI++L  AD
Sbjct: 582 GYNTISGEK-STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSAD 640

Query: 355 KSI-HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
            S  HIPFR SKLT LLQ SL G++KT +   +SP   +  ET ++L +AAK  + K
Sbjct: 641 ASKRHIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  147 bits (371), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 189/416 (45%), Gaps = 63/416 (15%)

Query: 12  RMLDDAQEELNITVAVRCRGRNE---REIKAKSSVVVT-VPDVTGSNEVSINTTDEVGIA 67
           R L +  +EL   + V CR R     +E    S + V+   D  G+  + I        +
Sbjct: 386 RSLHNTLQELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSS 445

Query: 68  AKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD 127
               +  +  DK+F  +     +FKE+ + L    + GYN  +  YG T +GKTYTM   
Sbjct: 446 NNSTTLKFKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--- 501

Query: 128 EKLYDGQLSDSAGIIPRIMFKLFDA---LEATDSDFLVKCSYIELYNEELKDLLDESHDS 184
                  L    GIIP  +  +F+    L+     + ++C ++E+YNE + DLL   HD+
Sbjct: 502 -------LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDN 554

Query: 185 SKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSES 244
           + ++                       P  +++     R  P        + T  +L   
Sbjct: 555 NGKVNDLLAS-----------------PSQSNSTKHEIRHDPETQTTKVTNITTCKLD-- 595

Query: 245 GSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCD-- 302
            S I V N              +L++  K R  AST  N+ SSRSH+IF I L    +  
Sbjct: 596 -SKITVDN--------------ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEIT 640

Query: 303 GELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLAD-------- 354
           GE      +NLVDLAGSE I+ S    +R +E  +IN+SL  LG VI++L          
Sbjct: 641 GEK-SYGILNLVDLAGSERINSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENA 699

Query: 355 KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           K  HIPFR SKLT LLQ SL GN+KT +   ISP+    +ET ++L +A+K  + K
Sbjct: 700 KKRHIPFRNSKLTYLLQYSLIGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 127/395 (32%), Positives = 191/395 (48%), Gaps = 82/395 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +T D+VF  +     I++  + P+ D  ++G+N TV  YGMT +GKT+TMTG E      
Sbjct: 112 FTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE------ 165

Query: 135 LSDSAGIIPRIMFKLFD-----ALEATDSDFLVKCSYIELYNEELKDLLD---ESHDSSK 186
             D AG+IP  +  LF      ++  T S + V  SY+E+YNE++ DLLD   E+  +S 
Sbjct: 166 --DEAGLIPLSVTYLFSKILEHSMRGT-SKYEVVVSYLEIYNEKIYDLLDCESENKFNST 222

Query: 187 RLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGS 246
             R+F                 PR    +  G         PV+       K        
Sbjct: 223 PSRMF-------------LSGTPR----SSGG---------PVELRIRDDLKY------- 249

Query: 247 GIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCD---G 303
           G+ +  + E    ++ E    +Q G K+R+ + T  N  SSRSH I  + L  N D   G
Sbjct: 250 GVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRL-NNTDLRSG 308

Query: 304 ELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVI-------------- 349
           E    S ++L DLAGSE   ++ +Q +R KE   IN+SLL LG VI              
Sbjct: 309 ETVS-STLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPP 364

Query: 350 ----NSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAK 405
                +  + + HIP+R+SKLTR+LQ +L GN+    I TI      A ET +T+ +A++
Sbjct: 365 TFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASR 424

Query: 406 AKN----IKNRPQL--GALMMKDILVKNISSELAK 434
           AKN    +  RP +  G+   KD  ++N++ +L K
Sbjct: 425 AKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEK 459

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score =  145 bits (366), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/384 (29%), Positives = 181/384 (47%), Gaps = 77/384 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF      S ++  + +P+ D   +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 135 LSDSAGIIPRIMFKLFDAL-----EATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLR 189
                G+IP  +  +FD +     ++T+  + VK SY+E+YNE++ DLL  +        
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLSITE------- 249

Query: 190 IFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIY 249
                                      NG    RQ        R S+  +   +S  G+ 
Sbjct: 250 --------------------------ANGAVASRQ------LGRNSSGLKIRDDSKYGVK 277

Query: 250 VQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFR-- 307
           V ++ E  + +  E I  +  G K+R+   T  N  SSRSH I  + L + C+ +     
Sbjct: 278 VVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTR-CELKTGTEV 336

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---------- 357
            S ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+  S           
Sbjct: 337 TSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGSGSNGQP 393

Query: 358 ------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK- 410
                 HIP+R+SKLTR+LQ +L G++    I TI     +  ET++T+ +A++AKNI  
Sbjct: 394 PSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASRAKNISL 453

Query: 411 --NRPQLGALMMKDILVKNISSEL 432
              + ++     KD +++N+  +L
Sbjct: 454 NVRKNEMDTSNEKDSIIQNLRKQL 477

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score =  144 bits (364), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 112/368 (30%), Positives = 176/368 (47%), Gaps = 80/368 (21%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +T D VF        I+ +  +PL D  ++GYN T+  YGMT +GKT+TM+G E      
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTE------ 186

Query: 135 LSDSAGIIPRIMFKLFDAL-EATDSD---FLVKCSYIELYNEELKDLLDESHDSSKR--- 187
             +  G+IP  +  LF +L E T+++     V  SY+E+YNE++ DLLD +  S+ +   
Sbjct: 187 --EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVASGSNVQNTP 244

Query: 188 LRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSG 247
            R+F                       + +G  + R                   +S  G
Sbjct: 245 SRLFTST------------------HTSSSGDLKIRD------------------DSECG 268

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGELF 306
           + V  + +     + E ++ + KG K+R+ + T+ N  SSRSH I  I ++ K+      
Sbjct: 269 VRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQ 328

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------- 353
            +  ++L DLAGSE   R   QN+R KE   IN+SLL LG VI+ L+             
Sbjct: 329 NIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAA 385

Query: 354 ------------DKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLE 401
                           HIP+R+SKLTRLLQ +L G++    + TI  A  ++ ET +TL 
Sbjct: 386 NSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLR 445

Query: 402 YAAKAKNI 409
           +A+++KN+
Sbjct: 446 FASRSKNV 453

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 169/345 (48%), Gaps = 64/345 (18%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D++F        +F EI + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 135 LSDSAGIIPRIMFKLFD---ALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIF 191
           L+ + G+IP  +  +FD   +L+    ++ V C ++E+YNE + DLL E  ++S  L   
Sbjct: 446 LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLRE--ETSAEL--- 500

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQ 251
                                E+ +NG  R   R    K  R++              + 
Sbjct: 501 --------------------DEITNNG--RHDIRHDSDK--RITT-------------IT 523

Query: 252 NVQEFHIINAREGINVL-QKGLKHRQVASTKMNDFSSRSHTIFTIMLY--KNCDGELFRV 308
           N++   I+ +++ ++ L +K  K R  A+T  N+ SSRSH+IF I L    N  GE    
Sbjct: 524 NIKT-SILKSKDSVDFLIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGE-SSY 581

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESK 365
             +NLVDLAGSE ++ S  +  R +E  +IN+SL  LG VI++L        HIPFR SK
Sbjct: 582 GILNLVDLAGSERLNSSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSK 641

Query: 366 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           LT LLQ SL GN+KT +   ISP +    ET ++L +A+K    K
Sbjct: 642 LTYLLQYSLTGNSKTLMFVNISPTQQQIQETLNSLRFASKVNTTK 686

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score =  141 bits (356), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 113/372 (30%), Positives = 171/372 (45%), Gaps = 78/372 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF        +++  ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 135 LSDSAGIIPRIMFKLF-DALEAT---DSDFLVKCSYIELYNEELKDLLDES-HDSSKRLR 189
                G+IP  +  LF + +E +   D  F V  SY+E+YNE + DLL+    +S  R+ 
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRI- 273

Query: 190 IFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIY 249
                              P    ++ +             +N +    +   +S  G+ 
Sbjct: 274 -----------------STPSRLYMSKS------------NSNGLGVELKIRDDSQYGVK 304

Query: 250 VQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRV 308
           V  + E    ++ E +  +  G K R++  T  N  SSRSH I  I L   N      R 
Sbjct: 305 VIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRS 364

Query: 309 SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------------ 355
           S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK            
Sbjct: 365 STLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPS 421

Query: 356 ------------------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETS 397
                             S HIP+R+SKLTRLLQ +L G++    I T+      A ET 
Sbjct: 422 ASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETM 481

Query: 398 STLEYAAKAKNI 409
           +TL +A++AKN+
Sbjct: 482 NTLRFASRAKNV 493

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  140 bits (354), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 186/411 (45%), Gaps = 76/411 (18%)

Query: 12  RMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMN 71
           R L +  +EL   + V CR R   + +   S  V + ++   +E     T  + I     
Sbjct: 355 RKLHNELQELRGNIRVFCRIRPLLQGEGSESCHVHI-NLFNDDE----GTQSMNITRDSK 409

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
              +  DK+F P      IF+EI + L    + GYN  +  YG T +GKTYTM       
Sbjct: 410 KHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 461

Query: 132 DGQLSDSAGIIPRIM---FKLFDALEATDSDFLVKCSYIELYNEELKDLL----DESHDS 184
              L    G+IP  +   F+    L+    ++ +   +IE+YNE + DLL    +++ D 
Sbjct: 462 ---LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRGLNNDTEDI 518

Query: 185 SKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSES 244
           ++ L+                       E+ H+                         + 
Sbjct: 519 TESLK----------------------HEIRHD-------------------------QE 531

Query: 245 GSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKNCD 302
               +V NV    + +      +L++  K R  A+T  N+ SSRSH++F I L  Y +  
Sbjct: 532 SQTTHVTNVTTCKLTDRDMVDTLLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNT 591

Query: 303 GELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HI 359
           GE  +   +NLVDLAGSE I+ S     R +E  +IN+SL  LG VI++LA       HI
Sbjct: 592 GEECQ-GTLNLVDLAGSERINASQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHI 650

Query: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           PFR SKLT LLQ SL G++KT +   ISP   + +ET ++L +A+K  + +
Sbjct: 651 PFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDHFNETLNSLRFASKVNSTR 701

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  140 bits (352), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 132/424 (31%), Positives = 193/424 (45%), Gaps = 94/424 (22%)

Query: 23  ITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVFG 82
           ITVA+R +  +     + SS +VT       +E +I   D+VG         +  D VF 
Sbjct: 101 ITVAIRPKPTSNPSDVSTSSWLVT-------DEKTI-AHDDVG--------EFKFDHVFN 144

Query: 83  PSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGII 142
                  I++ I  P+ D   +G+N T+  YGMT +GKTYTM G       +     G+I
Sbjct: 145 SFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLI 199

Query: 143 PRIMFKLFDAL--EATDSD--FLVKCSYIELYNEELKDLL-DESHDSSKRLRIFDXXXXX 197
           P  +  LF  +  E  D D  F +  SY+E+YNE++ DLL DE+++++            
Sbjct: 200 PLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLLGDENNNNNNNNGTL------ 253

Query: 198 XXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLS---ESGSGIYVQNVQ 254
                                F        P + N     + +L    +S  G+ V  + 
Sbjct: 254 --------------------AFGT------PTRNNNNICFQNELKIRDDSKYGVRVIGLT 287

Query: 255 EFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--CDGELFRVSKMN 312
           E    ++ E +N + KG K R+ A T  N  SSRSH I  I L  +   DG     S ++
Sbjct: 288 EKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDMKDGTSIS-STLS 346

Query: 313 LVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---------------- 356
           L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S                
Sbjct: 347 LCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRSPTLPSPPLSSS 403

Query: 357 -----------IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAK 405
                       HIP+R+SKLTRLLQ +L G++    I TI     ++ ET +TL +A++
Sbjct: 404 SSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSAETLNTLRFASR 463

Query: 406 AKNI 409
           AKNI
Sbjct: 464 AKNI 467

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 115/379 (30%), Positives = 173/379 (45%), Gaps = 86/379 (22%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF        ++++ ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 135 LSDSAGIIPRIMFKLF-DALEAT---DSDFLVKCSYIELYNEELKDLLDES-HDSSKRLR 189
                G+IP  +  LF + +E +   D  F V  SY+E+YNE + DLL+    +S  RL 
Sbjct: 218 ---ELGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSRL- 273

Query: 190 IFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIY 249
                              P    ++ N             +N +    +   +S  G+ 
Sbjct: 274 -----------------GTPSRSYMSKN------------NSNALGVELKIRDDSQYGVK 304

Query: 250 VQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--CDGELFR 307
           V  + E    ++ + +  +  G K R++  T  N  SSRSH I  I L      DG   R
Sbjct: 305 VIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDVRDGT-SR 363

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK----------- 355
            S ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK           
Sbjct: 364 SSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVGSIIPTT 420

Query: 356 -------------------------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 390
                                    S HIP+R+SKLTRLLQ +L G++    I T+    
Sbjct: 421 PTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 480

Query: 391 INADETSSTLEYAAKAKNI 409
             A ET +TL +A++AKN+
Sbjct: 481 DAAAETMNTLRFASRAKNV 499

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  137 bits (346), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 109/354 (30%), Positives = 162/354 (45%), Gaps = 55/354 (15%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D V+ P      I++ I +P+ D   +G+N TV  YGMT +GKTYTM G        
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXX 194
                  +  +  K+ +     +  F V  SY+E+YNE                RI+D  
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNE----------------RIYDLL 238

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLS---ESGSGIYVQ 251
                           + E    G +   +          S +  +L    +S  G+ V 
Sbjct: 239 ----------------DSESLVGGTTTPSRGFGSGGGRNESVSTNELKIRDDSKYGVRVM 282

Query: 252 NVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKN--CDGELFRVS 309
            ++E    ++ E +  +++G  HR+ A T  N  SSRSH I  I L      DG     S
Sbjct: 283 GLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGTSIS-S 341

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI------------ 357
            ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L+ +S             
Sbjct: 342 TLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSPNANG 398

Query: 358 --HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
             HIP+R+SKLTR+LQ +L G++    I TI   K +A ET +TL +A++AKN+
Sbjct: 399 NGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 112/371 (30%), Positives = 171/371 (46%), Gaps = 76/371 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF        +++  ++P+ D  + G+N T+  YGMT +GKT+TM+G+E+     
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 135 LSDSAGIIPRIMFKLF-DALEAT---DSDFLVKCSYIELYNEELKDLLDESHDSSKRLRI 190
                G+IP  +  LF + +E +   D  F V  SY+E+YNE + DLL+   + S     
Sbjct: 218 ---ELGLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEES----- 269

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
                             P  P   + G            +N +SA  +   ++  G+ V
Sbjct: 270 ---------------LSRPSTPSRLYMGKG---------NSNGLSAELKIRDDTQYGVKV 305

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRVS 309
             + E    ++ E +  +  G K R++  T  N  SSRSH I  I L   + +    R S
Sbjct: 306 IGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLESGTSRSS 365

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSL-ADK------SIHIP-- 360
            ++L DLAGSE   R+  Q +R KE   IN+SLL LG VI+ L ADK      +IH    
Sbjct: 366 TLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGSNIHTTPT 422

Query: 361 ----------------------FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSS 398
                                 +R+SKLTRLLQ +L G++    I T+      A ET +
Sbjct: 423 NTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETIN 482

Query: 399 TLEYAAKAKNI 409
           TL +A++AKN+
Sbjct: 483 TLRFASRAKNV 493

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 103/347 (29%), Positives = 163/347 (46%), Gaps = 61/347 (17%)

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S  +  DK+F P    + +F+EI + L    + GYN  +  YG T +GKTYTM       
Sbjct: 414 SYNFHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------- 465

Query: 132 DGQLSDSAGIIPRIMFKLFDALE---ATDSDFLVKCSYIELYNEELKDLLDESHDSSKRL 188
              L+   G+IP  +  +F   E        + + C YIE+YNE + DLL E + +    
Sbjct: 466 ---LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLREFNSNDNID 522

Query: 189 RIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGI 248
            I +                 ++ E+ H+                               
Sbjct: 523 DILES----------------QKHEIRHD-------------------------HDNHAT 541

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCD--GELF 306
            + NV +  + +  +  ++L++  + R  A T+ N+ SSRSH++F + +  + D  GE+ 
Sbjct: 542 SITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHINGHNDQTGEVS 601

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRE 363
              K+NL+DLAGSE I+ S     R +E  +IN+SL  LG VI +L        HIPFR 
Sbjct: 602 H-GKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRHIPFRN 660

Query: 364 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
           SKLT LLQ SL G++KT +   I   + + +ET ++L +A+K  + K
Sbjct: 661 SKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  132 bits (333), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRV 308
           +V+ +QEF + +  E ++ L++G + + V +T +N+ SSRSHTIFTI + +  +  L  V
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 309 ----SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH--IPFR 362
               S + L+DLAGSE  + SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQL 415
           ++ LT +L++SLGGN+KT +IA +SP   + +ET STL YA  A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DFEETMSTLRYATLARSVKTFAQL 339

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 81/168 (48%), Gaps = 29/168 (17%)

Query: 22  NITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVF 81
           NI V+VR R   ERE     S    +  V   N + +        A +  +R +  D   
Sbjct: 4   NIKVSVRLRKPLERE-----SAERVIAQVVSENLIKVEQR-----AKREETRNFEFDLCC 53

Query: 82  GPSA----DQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSD 137
             S     DQ+ +++++A       + GYN  +  YG T +GK++TMTG  +L       
Sbjct: 54  TYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL------- 106

Query: 138 SAGIIPRIMFKLFDALEATDS-------DFLVKCSYIELYNEELKDLL 178
             GI+PR+  +LF+  E  +S        F ++CSY+E+YNE ++DLL
Sbjct: 107 -PGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  135 bits (340), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 177/378 (46%), Gaps = 71/378 (18%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VF        +++ +  P+ D   +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 135 LSDSAGIIPRIMFKLFDAL----EATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRI 190
                G+IP+ +  +FD +          + VK SY+E+YNE++ DLL+           
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLNYVD-------- 249

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
                                           RQ     + +R +   +   +S  G+ V
Sbjct: 250 --------------------------------RQAGSTGQPSRNATGLKIRDDSKYGVKV 277

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRVS 309
            ++ E  + +  + +  +  G ++R+   T  N  SSRSH I  + L + +        S
Sbjct: 278 VDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDLKTGSEATS 337

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------------DKSI 357
            ++L DLAGSE   R+  Q  R KE   IN+SLL LG VI  L+              + 
Sbjct: 338 TLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANGLQPSPAAG 394

Query: 358 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK---NRPQ 414
           HIP+R+SKLTR+LQ +L G++    I TI     ++ ET++T+ +A++AKNI     + +
Sbjct: 395 HIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNIALNVRKNE 454

Query: 415 LGALMMKDILVKNISSEL 432
           + +   KD +++N+  +L
Sbjct: 455 MDSHAEKDTIIQNLRKQL 472

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score =  131 bits (330), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 154/351 (43%), Gaps = 76/351 (21%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  D VFGP+A    +F E+   L +    G N T+L YG T +GKTYTM G     DG 
Sbjct: 127 FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGHN---DGI 183

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXX 194
           +      +   M    D  +   S   V  SY+E+YNE++ DLL+ S+  ++ L++ D  
Sbjct: 184 VKMCGDCVFTRMLNAADERQVKRS---VTVSYLEIYNEKICDLLN-SNCRNEELKVRDD- 238

Query: 195 XXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQ 254
                                            PV                 G+ V  V 
Sbjct: 239 ---------------------------------PVL----------------GVKVHGVL 249

Query: 255 EFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGELFRVSKMNL 313
           E     A E +  +  G   R+   T  N  SSRSH I  + ++  N        + ++L
Sbjct: 250 EQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGTTHFNTLSL 309

Query: 314 VDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS---------------IH 358
            DLAGSE  S    Q +R KE   IN+SLL LG VI+ L+ +S                H
Sbjct: 310 CDLAGSEKASE---QLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRPSSGSLNNSH 366

Query: 359 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI 409
           IP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +A++AKN+
Sbjct: 367 IPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  128 bits (322), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 149/261 (57%), Gaps = 31/261 (11%)

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-YKNCDGELFR 307
           +VQ++  F +    E +  L  G   R VAST+MN  SSRSH IFT+ +  +  DG + R
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSI-R 207

Query: 308 VSKMNLVDLAGSE--NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH-IPFRES 364
            S + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ LA  S H IP+R+S
Sbjct: 208 ESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDS 267

Query: 365 KLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALM----- 419
            LT +L+++LGGN+KT +IA ISP  I+ +E+ STL YA  AK IK R  +  ++     
Sbjct: 268 LLTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIVPNINE 325

Query: 420 -MKDILVKNISS--ELAKIKSDFLSTKSKDGI----YMSHE-------HYQEIVNDLENC 465
            MK  +    SS  EL  +KS+  S +S+  I    + +HE       H  ++ + LEN 
Sbjct: 326 DMKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHEKLLVRFNHITKLNDYLENQ 385

Query: 466 QT-EIQESKRQIESLTSQNNL 485
            T EI +S    +SL ++N L
Sbjct: 386 LTNEITKS----QSLQNENKL 402

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 12/118 (10%)

Query: 73  RTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132
           R++  D +F  S+ Q+ I  E+        ++GYN  +  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 133 GQLSDSAGIIPRIMFKLFDALEATDSDF-LVKCSYIELYNEELKDLLDESHDSSKRLR 189
              + + GIIP +   LFDALE   +    V  +Y E+YNE+L DLL    D+S R+R
Sbjct: 90  ---NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLG---DTSPRVR 141

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score =  119 bits (298), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 98/338 (28%), Positives = 150/338 (44%), Gaps = 58/338 (17%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +T DK+FG   D   +F +I + L    + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 135 LSDSAGIIPR---IMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIF 191
           L++  GII +    +      L     ++ ++  +IE+YNE ++DLL+            
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN------------ 480

Query: 192 DXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQ 251
                               PE  H    R   +    +         +L+ +      +
Sbjct: 481 --------------------PEAKHQHVIRHDDKKGTTEVTNTHKITIKLTHNEDDEIAK 520

Query: 252 NVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCDGELFRVSK 310
           + Q   +I  R G N        R   ST MN+ SSRSH++F + +   N   +     +
Sbjct: 521 SAQIRQLI--RNGNNT-------RNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTGR 571

Query: 311 MNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTR 368
           +NLVDLAGSE + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR SKLT 
Sbjct: 572 LNLVDLAGSERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTY 631

Query: 369 LLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKA 406
           LL++SL   +KT +   ISP   +  ET ++L  A K 
Sbjct: 632 LLKNSLINKSKTLMYVNISPNINSIRETINSLRLARKV 669

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/174 (39%), Positives = 104/174 (59%), Gaps = 9/174 (5%)

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-YKNCDGEL- 305
           I V N+    +    + ++++ KG  +R  ++T  N+ SSRSH +  + +  KN   EL 
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 306 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA-----DKSIH 358
              + + ++L+DLAGSE  S +  + +R  E  +IN+SLL LG  IN+L          H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 359 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           +P+R+SKLTRLL+ SLGGN KT +I  ISP   + DET +TL+YA +AK IK +
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 69/139 (49%), Gaps = 16/139 (11%)

Query: 57  SINTTDEVGIAAKMNSR-----TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVL 111
           SI T         MNSR      +  D+VF   A Q  +++    PL D  + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 112 VYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATD--SDFLVKCSYIEL 169
            YG T  GKTYT++G         +++ GII   M +LF  +E       F +  SY+E+
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEI 213

Query: 170 YNEELKDLLDESHDSSKRL 188
           YNE ++DLL E    SK+L
Sbjct: 214 YNESIRDLL-EPETPSKKL 231

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 96/328 (29%), Positives = 151/328 (46%), Gaps = 74/328 (22%)

Query: 90  IFKEIAEPLFD----DFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRI 145
           IF    +PL      D + G   T++ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIV--- 167

Query: 146 MFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFDXXXXXXXXXXXXX 205
              + D L     +  +  SY+E+YNE L DLL    D +K LRI D             
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNERLHDLL---CDGTKELRILDDSA---------- 214

Query: 206 XXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGI 265
                               P   + + +  T   L +S      Q+V           +
Sbjct: 215 --------------------PIACRLHGLKETTITLDDSE-----QSVSRV--------L 241

Query: 266 NVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSKMNLVDLAGSENISRS 325
            ++ +G ++R+V ST+ N  SSRSH +  + +  +  G   RV  + L DLAGSE   R+
Sbjct: 242 ELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRITDSM-GSKARV--LTLCDLAGSE---RA 295

Query: 326 GAQNQRAK-EAGSINQSLLTLG---RVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTA 381
              ++  + E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN    
Sbjct: 296 SVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVT 355

Query: 382 LIATISPAKINADETSSTLEYAAKAKNI 409
           ++ T+S +  + +++  TL +A +A  +
Sbjct: 356 MVCTVSLSGTDYEQSLGTLRFARRASGV 383

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score =  115 bits (288), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 141/538 (26%), Positives = 234/538 (43%), Gaps = 127/538 (23%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           Y  DKVF  S D  +  +E  E   +  ++GYN +++ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD------FLVKCSYIELYNEELKDLLDESHDSSKRL 188
                G+I +++ KLF+ ++    +      + VK S++E+Y E++ DL+D S    K L
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMD-SPSVKKHL 181

Query: 189 RIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGI 248
           +I D                      A NGF     R           T Q L+      
Sbjct: 182 KINDST-------------------YAMNGFQVENLR-----------TTQVLT------ 205

Query: 249 YVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFR 307
               ++E  I+     IN+     K R       N+   RSHTI  + + K N   E   
Sbjct: 206 ----LEELKIL-----INICLLNQKERH------NNLIQRSHTIMEVSIEKRNKLDESIT 250

Query: 308 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA----------DKS- 356
           +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN L           D S 
Sbjct: 251 MSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDIST 310

Query: 357 -IH-IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQ 414
            +H +P++ S LTRLL D LGGN KT  + T S  K + +ET STL++    K+    P+
Sbjct: 311 LMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTNPR 370

Query: 415 LGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKR 474
           +    +            +K   D   T  K    +  +++  I N+L N          
Sbjct: 371 INRFGLN-----------SKATMDIFLTDMK----LKEDNFISITNNLTN---------- 405

Query: 475 QIESLTSQNNLL---LKDK--KASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELA 529
           Q+ +L +Q N L   LK+   K +++ T +  S+++ L   +    ++ +    N+ E  
Sbjct: 406 QVNNLMTQANSLEDELKNNETKYNKKETNILKSQVETLTELLNNPNNRSQVDLRNQNENT 465

Query: 530 TTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVL--------YQGITSYRESMNQHL 579
             + KL E       SL      EL L + +KE+L        Y+   +  E+MNQHL
Sbjct: 466 EILTKLLEKCE-HNASL------ELSLDDKMKEILILRRRESEYKARIASTETMNQHL 516

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 104/175 (59%), Gaps = 10/175 (5%)

Query: 248 IYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTI-MLYKNCDGEL- 305
           I V N+ +      +E ++++ +G  +R  + T+ N+ SSRSH +  I ++ KN   ++ 
Sbjct: 272 ITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIK 331

Query: 306 --FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA------DKSI 357
                  ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L           
Sbjct: 332 EEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRC 391

Query: 358 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           H+P+R+SKLTRLL+ SLGGN KT +I  ISP+  + DET +TL+YA +AK IK +
Sbjct: 392 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F   A Q  +++     L D  + G+N TV  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 135 LSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSSK 186
             ++ GI+ + M +LF  +E       F +  S++E+YNE ++DLL     S K
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLLKPETPSQK 261

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 97/153 (63%), Gaps = 4/153 (2%)

Query: 258 IINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRVSKMNLVD 315
           ++ ++E ++ VL++  K R  AST  N+ SSRSH+IF I L+  N   +      +NLVD
Sbjct: 602 VLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVD 661

Query: 316 LAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI--HIPFRESKLTRLLQDS 373
           LAGSE +  S    +R +E  +IN+SL  LG VI +L DK+   HIPFR SKLT LLQ S
Sbjct: 662 LAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYS 721

Query: 374 LGGNTKTALIATISPAKINADETSSTLEYAAKA 406
           L GN+KT +   ISP+  + +ET ++L +A+K 
Sbjct: 722 LVGNSKTLMFVNISPSSSHINETINSLRFASKV 754

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 74  TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           ++  DK+F        +FKE+ + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 134 QLSDSAGIIPRIMFKLFDALE---ATDSDFLVKCSYIELYNEELKDLL 178
            L  + G+IP  +  +FD +E       ++ + C ++E+YNE + DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 62/156 (39%), Positives = 97/156 (62%), Gaps = 8/156 (5%)

Query: 265 INVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSK----MNLVDLAGSE 320
           ++++ KG  +R  + T  N+ SSRSH +  I + ++      +  K    ++++DLAGSE
Sbjct: 263 MDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTYATLSIIDLAGSE 322

Query: 321 NISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS----IHIPFRESKLTRLLQDSLGG 376
             S +  + +R  E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGG
Sbjct: 323 RASATKNRGERLHEGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGG 382

Query: 377 NTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
           N KT +I  +SP+  + DET +TL+YA +AK+IK +
Sbjct: 383 NCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (50%), Gaps = 10/114 (8%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F   A Q  +F     PL D  + G+N TV  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 135 LSDSAGIIPRIMFKLFDALE--ATDSDFLVKCSYIELYNEELKDLLDESHDSSK 186
             ++ GII   M +LF  +E       F +  SY+E+YNE ++DLL+    S K
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLEPDTPSQK 235

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 89/148 (60%), Gaps = 4/148 (2%)

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCDGELFRVSKMNLVDLAGSENISRS 325
           VL +  K R  ASTK N+ SSRSH+IF I L+ KN          +NLVDLAGSE I+ S
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGILNLVDLAGSERINSS 614

Query: 326 GAQNQRAKEAGSINQSLLTLGRVI---NSLADKSIHIPFRESKLTRLLQDSLGGNTKTAL 382
               +R +E   IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT +
Sbjct: 615 QVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLM 674

Query: 383 IATISPAKINADETSSTLEYAAKAKNIK 410
              IS +  + +ET ++L +A+K  + K
Sbjct: 675 FVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 87/187 (46%), Gaps = 22/187 (11%)

Query: 4   HEVQTRKSRMLDDAQEELNITVAVRCRGRNE-REIKAKSSVVVTVPDVTGSNEVSINTTD 62
           HE   R  R L +  +EL   + V CR R   + I+  ++  + V  +   +      T 
Sbjct: 356 HEETVR--RQLHNKLQELRGNIRVYCRLRPPLKSIEDPNTSHIKVYSLDNDH-----GTQ 408

Query: 63  EVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTY 122
            + I    N+  Y  DK+F      S IFKE+ + L    + GYN  +  YG T +GKT+
Sbjct: 409 TMEITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTF 467

Query: 123 TMTGDEKLYDGQLSDSAGIIP---RIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLD 179
           TM          L+ S GIIP   R +F   D L+    ++ + C ++E+YNE + DLL 
Sbjct: 468 TM----------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLR 517

Query: 180 ESHDSSK 186
           E   S K
Sbjct: 518 EKQTSQK 524

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 117/445 (26%), Positives = 195/445 (43%), Gaps = 109/445 (24%)

Query: 68  AKMNSRTYTVDKVFGPSAD-----QSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTY 122
           A  N + + VD++F P A       S+I   +A+ LF+    GYN  ++ YG T +GKT 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQ-LFN----GYNVAIMAYGQTDSGKTS 118

Query: 123 TMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEA---TDSDFLVKCSYIELYNEELKDLLD 179
           TM G  K          G+I  +  ++F  +E     + D+ +  S IE+  E ++DLL 
Sbjct: 119 TMFGYNK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLA 170

Query: 180 ESHDSSKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQ 239
              +                                        Q+P           K 
Sbjct: 171 PLSE----------------------------------------QKP----------LKL 180

Query: 240 QLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIML-Y 298
           +L    S I ++N++  ++ +  E ++  +KG   R +AS       SRS  I  I +  
Sbjct: 181 RLDSKKSSISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQ 230

Query: 299 KNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLA--DKS 356
           ++   E+F+     LVDL  S+ I +        +    INQS++TL  V  SLA  ++S
Sbjct: 231 RDNVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQS 290

Query: 357 I----------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKA 406
           +          +IP++ES LT+LLQ+++GGN KT L+   S AK + +ET +TL + A  
Sbjct: 291 VKNGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANM 350

Query: 407 KNIKNRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQ 466
           K +KN      L  ++    N  + L  +  DF    +K+  Y SH      +  LE   
Sbjct: 351 KLVKN------LFQQNKAGTNSKAMLDLLMKDF---DAKEKNYQSH------IQLLEKEL 395

Query: 467 TEIQESKRQIESLTSQNNLLLKDKK 491
             +++ +   E+   QN ++L++KK
Sbjct: 396 MNLKKLQYGSETADKQNEIMLENKK 420

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCDGELFRVSKMNLVDLAGSENISRS 325
           +L+K  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 326 GAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTAL 382
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 383 IATISPAKINADETSSTLEYAAKA 406
              ISP+  + +ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 81/171 (47%), Gaps = 17/171 (9%)

Query: 12  RMLDDAQEELNITVAVRCRGRNE-REIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKM 70
           R L +  +EL   + V CR R   + ++   + ++ V +   ++ V      ++   A++
Sbjct: 374 RTLHNELQELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQV 433

Query: 71  NSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           +   +  DK+F        +FKE+ + L    + GYN  +  YG T +GKT+TM      
Sbjct: 434 HE--FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM------ 484

Query: 131 YDGQLSDSAGIIPRIM---FKLFDALEATDSDFLVKCSYIELYNEELKDLL 178
               L+   GIIP  +   F   + L+    D+ V C +IE+YNE + DLL
Sbjct: 485 ----LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCDGELFRVSKMNLVDLAGSENISRS 325
           +L+K  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 326 GAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTAL 382
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 383 IATISPAKINADETSSTLEYAAKA 406
              ISP+  + +ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 79/173 (45%), Gaps = 21/173 (12%)

Query: 12  RMLDDAQEELNITVAVRCRGRNERE-IKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKM 70
           R L +  +EL   + V CR R   E ++   + ++ V +   +    + + +   I +  
Sbjct: 374 RTLHNELQELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNR--GVQSMEVTKIQSTT 431

Query: 71  NSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTM--TGDE 128
               +  DK+F        +FKE+ + L    + GYN  +  YG T +GKT+TM  TGD 
Sbjct: 432 QVHEFKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD- 489

Query: 129 KLYDGQLSDSAGIIPRIM---FKLFDALEATDSDFLVKCSYIELYNEELKDLL 178
                      GIIP  +   F   + L+    D+ V C +IE+YNE + DLL
Sbjct: 490 -----------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNCDGELFRVSKMNLVDLAGSENISRS 325
           +L+K  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 326 GAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTAL 382
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 383 IATISPAKINADETSSTLEYAAKA 406
              ISP+  + +ET ++L +A+K 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 78/171 (45%), Gaps = 17/171 (9%)

Query: 12  RMLDDAQEELNITVAVRCRGRNERE-IKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKM 70
           R L +  +EL   + V CR R   E ++   + ++ V +    +   I + +   I    
Sbjct: 374 RTLHNELQELRGNIRVYCRIRPALETLEDSDTSLINVNEF--DDNCGIQSMEVTKIHNTA 431

Query: 71  NSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
               +  DK+F      + +FKE+ + L    + GYN  +  YG T +GKT+TM      
Sbjct: 432 QVHEFKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM------ 484

Query: 131 YDGQLSDSAGIIPRI---MFKLFDALEATDSDFLVKCSYIELYNEELKDLL 178
               L+   GIIP     +F   + L+    D+ V C +IE+YNE + DLL
Sbjct: 485 ----LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRVSKMNLVDLAGSENISRS 325
           VL++  K R  AST  N+ SSRSH+IF I L   N          +NLVDLAGSE I+ S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 326 GAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTAL 382
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 383 IATISPAKINADETSSTLEYAAKA 406
              ISP+  + +ET ++L +A+K 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 53/107 (49%), Gaps = 14/107 (13%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  DK+F        +FKE+ + L    + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 135 LSDSAGIIPRI---MFKLFDALEATDSDFLVKCSYIELYNEELKDLL 178
           L+   GIIP     +F   + L+    D+ V C +IE+YNE + DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 96/163 (58%), Gaps = 17/163 (10%)

Query: 259 INAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-------KNCDGELFRVSK 310
           +N+ E ++ +L+K  + R  AST  N+ SSRSH++F I L        +  DG L     
Sbjct: 557 LNSEEQVDGLLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGIL----- 611

Query: 311 MNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLT 367
            NLVDLAGSE I+ S    +R +E  +IN+SL  LG V+++L        HIPFR SKLT
Sbjct: 612 -NLVDLAGSERINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLT 670

Query: 368 RLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
            LLQ SL GN+KT +   IS  + + +ET ++L +A+K  + K
Sbjct: 671 YLLQYSLTGNSKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 82/178 (46%), Gaps = 20/178 (11%)

Query: 12  RMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTV---PDVTGSNEVSINTTDEVGIAA 68
           R L +  +EL   + V CR R   + +  ++  +TV    D  G   + I  ++  G + 
Sbjct: 365 RSLHNELQELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSI 424

Query: 69  KMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDE 128
             N   +  D++F  +     +F+EI + L    + GYN  +  YG T +GKTYTM    
Sbjct: 425 PQN---FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 476

Query: 129 KLYDGQLSDSAGIIPRI---MFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHD 183
                 L+   GIIP     +F   + L+    ++ + C +IE+YNE + DLL    D
Sbjct: 477 ------LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQD 528

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 92/152 (60%), Gaps = 12/152 (7%)

Query: 267 VLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRVSK-----MNLVDLAGSEN 321
           +L++  K R  AST  N+ SSRSH+IF + L     GE     +     +NLVDLAGSE 
Sbjct: 549 LLKRANKLRSTASTACNERSSRSHSIFIVHL----SGENVLTGERSHGILNLVDLAGSER 604

Query: 322 ISRSGAQNQRAKEAGSINQSLLTLGRVINSL--ADKSI-HIPFRESKLTRLLQDSLGGNT 378
           I+ S    +R +E  SIN+SL  LG VI++L  AD S  HIPFR SKLT LLQ SL GN+
Sbjct: 605 INTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNS 664

Query: 379 KTALIATISPAKINADETSSTLEYAAKAKNIK 410
           KT +   IS    + +ET ++L +A+K  + K
Sbjct: 665 KTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 78/172 (45%), Gaps = 20/172 (11%)

Query: 12  RMLDDAQEELNITVAVRCRGRNE--REIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAK 69
           R L +  +EL   + V CR R    RE    + + V   +    N+V     +  G   +
Sbjct: 342 RTLHNELQELRGNIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNGYGSGPQ 401

Query: 70  MNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEK 129
           +    +  D++F        +F+EI + L    + GYN  +  YG T +GKTYTM     
Sbjct: 402 I----FKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----- 451

Query: 130 LYDGQLSDSAGIIPRIMFKLFDA---LEATDSDFLVKCSYIELYNEELKDLL 178
                L+ + GIIP  +  +F+    L+     + V C ++E+YNE + DLL
Sbjct: 452 -----LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 108/205 (52%), Gaps = 20/205 (9%)

Query: 243 ESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLY-KNC 301
           +S  G+ V  + E  + ++ + +  +  G  +R+   T  N  SSRSH I T+ L   + 
Sbjct: 273 DSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDL 332

Query: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH--- 358
                  S ++L DLAGSE   R+  Q++R KE   IN+SLL LG VI+ L+  S+H   
Sbjct: 333 VSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTP 389

Query: 359 ------IPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNI--- 409
                 IP+R+SKLTR+LQ +L G +    I TI        ET +T+ +A++AKN+   
Sbjct: 390 SFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMT 449

Query: 410 --KNRPQLGALMMKDILVKNISSEL 432
             +N  +L     KD L+ N+  +L
Sbjct: 450 VKRNEAELA--HEKDALIHNLRRQL 472

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 79/153 (51%), Gaps = 12/153 (7%)

Query: 31  GRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVDKVFGPSADQSLI 90
           G N ++ +   SV + +     + +     +DE  IA   +   +  D VF P ++   +
Sbjct: 96  GENSQQYRGAISVSIRLKPTDANAKNPWFVSDEQTIAHN-DVGEFKFDNVFRPQSNNYEV 154

Query: 91  FKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLF 150
           +++I +P+ D   +GYN  +  YGMT +GKT+TM+G          + AG+I   +  +F
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHIF 206

Query: 151 DALEA---TDSDFLVKCSYIELYNEELKDLLDE 180
             + +    +  F V  SY+E+YNE++ DLL++
Sbjct: 207 AQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQ 239

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 124/513 (24%), Positives = 222/513 (43%), Gaps = 108/513 (21%)

Query: 80  VFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSA 139
           +F   ++  LI   I   + D+ M+GYN  ++ YG   +GKTY++ G++      + DS 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYSLYGND------VDDSF 142

Query: 140 GIIPRIMFK-LFDALE--ATDSD----FLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
           G+  +I+FK LF  +    TDS+    F+VK S++E++ +++ DLL              
Sbjct: 143 GL-GQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL-------------- 187

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                              P+           + P +K   +S  K        G+ V N
Sbjct: 188 ------------------APQ--------NLTKLPHLKIRHVSEHK--------GLPVDN 213

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NCDGELFRVSKM 311
           +++ H+ + +E +    + +    V ++K ++   R++TIF I + K +   E    S +
Sbjct: 214 LRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDESTTSSSI 270

Query: 312 NLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIH------------I 359
            LVDLAGS+ I R  +    +++   IN S+ ++  +I SL+  S              +
Sbjct: 271 YLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEFSLENSV 330

Query: 360 PFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALM 419
           P+  SKL +LL++ LGGN KT  + TIS      D+    L+     ++ K  PQ+    
Sbjct: 331 PYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVPQINKFG 390

Query: 420 MKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVN--------DLENCQTEIQE 471
           + +    +I+ E  K+K +    +  + +    E    I N        +L   ++E  +
Sbjct: 391 LNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLEELNKLRSENAK 450

Query: 472 SKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATT 531
            K Q+ +LT    L++  K AS     L+N+K  +  S         ER   NET     
Sbjct: 451 LKAQVNTLTQ---LMVSPKLASPSPM-LENNKTVRNNSA--------ER---NETSYENV 495

Query: 532 IHKLKEALHTMQGSLKSYETHELRLQNDIKEVL 564
           +  L E    +  +       EL L + +K++L
Sbjct: 496 VQTLMEKCEKLADT-------ELSLDDKLKDIL 521

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 85/359 (23%)

Query: 74  TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           T+  DKVF  +A Q  +   + +P  +D + GYN T+L YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 134 QLSDSAGIIPRIMFKLFDALEATD----SDFLVKCSYIELYNEELKDLLDESHDSSKRLR 189
              D  GI+P I   LF  LE  +    ++F V     E+Y E+  DLL           
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL----------- 175

Query: 190 IFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIY 249
                              P  PE       R+     P+K +R S+T          + 
Sbjct: 176 ------------------VPL-PE-------RK-----PLKLHRSSSTMD--------LE 196

Query: 250 VQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRS-----HTIFTIML-YKNCDG 303
           +++++  H +N+ E    L+  ++  Q  + +M  +S ++     H +F + +  +N   
Sbjct: 197 IKDIRPAH-VNSFED---LKSYIQSVQNPANRMG-YSGKAERSRSHVVFQLHVEQRNRRH 251

Query: 304 ELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSI------ 357
           ++ + S + L+DL G+E   +             +NQS+  L   + SL  KS+      
Sbjct: 252 DILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEALKNTVQSLEIKSMDSVYSA 311

Query: 358 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNR 412
                  +RES+LT +L+DSLGGN KT +I T   +  N   T STL++    + I NR
Sbjct: 312 KASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPTTLSTLKFGDSIRQINNR 368

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 122/303 (40%), Gaps = 74/303 (24%)

Query: 12  RMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMN 71
           R L +  +EL   + V CR R   + + + S  +++   +  N      T  + I  +  
Sbjct: 350 RKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREAK 404

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
              +T D+ FG       IF EI + L    + GYN  +  YG T +GKTYTM       
Sbjct: 405 YHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------- 456

Query: 132 DGQLSDSAGIIPRIMFKLF---DALEATDSDFLVKCSYIELYNEELKDLLD----ESHDS 184
              L+   GIIP  +  +F   + L+     + +   +IE+YNE +KDL      E+ D 
Sbjct: 457 ---LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDG 513

Query: 185 SKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSES 244
           S+ L+                       E+ H+  S+                       
Sbjct: 514 SEALK----------------------HEIRHDSDSQ----------------------- 528

Query: 245 GSGIYVQNVQEFHIINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKNC 301
               ++ N+    + N RE +N +L + +K R  A+T  N  SSRSH++F I L  Y   
Sbjct: 529 --TTHITNITVCKLTN-REMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAI 585

Query: 302 DGE 304
            GE
Sbjct: 586 SGE 588

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 122/303 (40%), Gaps = 74/303 (24%)

Query: 12  RMLDDAQEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMN 71
           R L +  +EL   + V CR R   + + + S  +++   +  N      T  + I  +  
Sbjct: 350 RKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGFSDEN-----GTQCITIKREAK 404

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
              +T D+ FG       IF EI + L    + GYN  +  YG T +GKTYTM       
Sbjct: 405 YHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------- 456

Query: 132 DGQLSDSAGIIPRIMFKLF---DALEATDSDFLVKCSYIELYNEELKDLLD----ESHDS 184
              L+   GIIP  +  +F   + L+     + +   +IE+YNE +KDL      E+ D 
Sbjct: 457 ---LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDHDTENDDG 513

Query: 185 SKRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSES 244
           S+ L+                       E+ H+  S+                       
Sbjct: 514 SEALK----------------------HEIRHDSDSQ----------------------- 528

Query: 245 GSGIYVQNVQEFHIINAREGIN-VLQKGLKHRQVASTKMNDFSSRSHTIFTIML--YKNC 301
               ++ N+    + N RE +N +L + +K R  A+T  N  SSRSH++F I L  Y   
Sbjct: 529 --TTHITNITVCKLTN-REMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKLRGYNAI 585

Query: 302 DGE 304
            GE
Sbjct: 586 SGE 588

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 64/129 (49%), Gaps = 12/129 (9%)

Query: 54  NEVSINTTDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVY 113
           N V   T + +    K    T+  DKVF  +A Q  + K +  P+ +D + GYN TV+ Y
Sbjct: 54  NTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITY 113

Query: 114 GMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFDALEATDS----DFLVKCSYIEL 169
           G + +GK+Y++ G +        +S GI+P I   LFD LE  +      F V     E+
Sbjct: 114 GPSFSGKSYSLIGSK--------ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEI 165

Query: 170 YNEELKDLL 178
           Y E+  DLL
Sbjct: 166 YMEKTYDLL 174

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 67/137 (48%), Gaps = 13/137 (9%)

Query: 287 SRSHTIFTIML-YKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 345
           SRSH +F + +  +N   ++ + S + LVDL G+E   +             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 346 GRVINSL----------ADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADE 395
              + SL          A  S    +RES+LT +L+DSLGGN KT +I T   +  N   
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 350

Query: 396 TSSTLEYAAKAKNIKNR 412
           T STLE+    + I N+
Sbjct: 351 TLSTLEFGDSIRQINNK 367

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 158/390 (40%), Gaps = 100/390 (25%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  +KV+        I K ++E +  D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 135 LSDSAGIIPRIMFKLFDALEATDSD----FLVKCSYIELYNEELKDLLDESHDSSKRLRI 190
             DS GII      +       + D      ++ S +E+  E++ D+L  + D       
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDMLHSADD------- 191

Query: 191 FDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYV 250
                              R+P  +H+                   TK+       G+Y 
Sbjct: 192 -------------------RKPLKSHH------------------ETKK------FGLYY 208

Query: 251 QNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGE-LFRV- 308
           Q     +I + +E   V++    +++ +  KM+   S SH +        C  E L RV 
Sbjct: 209 QEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVI------RCSVEQLDRVH 262

Query: 309 -----SKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS-----------L 352
                S +   DL GS    +   Q    +    +N S+  L  V+NS           +
Sbjct: 263 GTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYI 322

Query: 353 ADKSI---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYA 403
            +K +          +P+++S+LT L+Q++LGGN++T ++      K + +ET +TL + 
Sbjct: 323 ENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFG 382

Query: 404 AKAKNIKN--RPQLGALMMK---DILVKNI 428
            + +NI N  R  +  L  K   D+L+ N+
Sbjct: 383 VQLQNILNFVRADVTGLNSKKTLDLLIDNM 412

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 88/375 (23%), Positives = 156/375 (41%), Gaps = 76/375 (20%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           Y  D V   S +   ++  I   L ++  +GY+  V+ YG   TGK+    G +  Y+G 
Sbjct: 63  YQFDSVHEKSTE---LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG- 118

Query: 135 LSDSAGIIPRIMFKLFDALEA--TDSDFLVKCSYIELYNEELKDLLDESHDSSKRLRIFD 192
                G++   +  L+D +++   D+ F V  S IE++ E++ DLL              
Sbjct: 119 -----GVVLMFVQDLYDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL-------------- 159

Query: 193 XXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPPVKANRMSATKQQLSESGSGIYVQN 252
                                      + RR    P+K +    TKQ         Y ++
Sbjct: 160 --------------------------VNDRR----PLKLHH--ETKQD-----DEYYFKD 182

Query: 253 VQEFHIINAREGINVLQKGLKHRQVASTKMNDF--SSRSHTIFTIML-YKNCDGELFRVS 309
           +    + +  E IN +     +R   S    ++   S+SH I  I +  +N + ++ +  
Sbjct: 183 LHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRNLNEDVVKRG 242

Query: 310 KMNLVDLAGSENISRSG--AQNQRAKEAGSINQSLLTLGRVINSLADKSIH----IPFRE 363
            ++  DLA  + I +    +    + E   +N    TL   I S+++ S +    IP++ 
Sbjct: 243 SISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSENPNAVIPYKN 302

Query: 364 SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK-----NRPQLGAL 418
           S LT+LL     GN KT +I T S  K N  ET  TL+   K ++I      N+  L + 
Sbjct: 303 SNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVHMNKHALNSK 362

Query: 419 MMKDILVKNISSELA 433
              D++V+++ S+ A
Sbjct: 363 KKLDLIVEDMKSKEA 377

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 74  TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           T+  DKVF  +A Q  +   +  P   D + GYN T+L YG + +GK+Y++ G +  Y+ 
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGSQ--YN- 130

Query: 134 QLSDSAGIIPRIMFKLFDALEATD----SDFLVKCSYIELYNEELKDLL 178
                 G++P I   LF+ LE  +    ++F V     E+Y E+  DLL
Sbjct: 131 -----EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 102/217 (47%), Gaps = 28/217 (12%)

Query: 287 SRSHTIFTIML-YKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 345
           S+SH +F + +  +N   ++ + S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 346 GRVINSLADK----------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADE 395
             ++  LA K          S    +RES+LT +L+DSLGGN K  +I T   +  N   
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLS--NVPT 350

Query: 396 TSSTLEYAAKAKNIKNRPQLGA----------LMMKDILVK--NISSELAKIKSDFLSTK 443
           T STLE+    + I N+               L ++D+ +K  N  S++  +KS+  S K
Sbjct: 351 TISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQINILKSELDSLK 410

Query: 444 SKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLT 480
                  S E   ++  +LEN + E  + K Q++S+T
Sbjct: 411 DLSNESSSRE---DMKTELENYEKENVKLKLQLDSIT 444

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query: 74  TYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDG 133
           T+  DKVF  +A Q  +   +  P  DD + GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ----- 128

Query: 134 QLSDSAGIIPRIMFKLFDAL----EATDSDFLVKCSYIELYNEELKDLL 178
              +  GI+P I   LF+ L    E   ++F V     E++ E+  DLL
Sbjct: 129 ---EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 287 SRSHTIFTIML-YKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 345
           S+SH +F + +  +N + ++ R S + L+DL G+E   +             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 346 GRVINSLADK----------SIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADE 395
             ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   +  N   
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVST 350

Query: 396 TSSTLEYAAKAKNIKNR 412
           T STLE+    + I N+
Sbjct: 351 TLSTLEFGECIRQITNK 367

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 8/109 (7%)

Query: 73  RTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYD 132
           RT+++DKVF PSA Q+ +   +  P+ D+   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 133 GQLSDSAGIIPRIMFKLFDALEATDSDFL-VKCSYIELYNEELKDLLDE 180
                S G++ RI+ K+F  +   +   +    S +EL N+++ DLL++
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLLNK 143

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 117/246 (47%), Gaps = 25/246 (10%)

Query: 247 GIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELF 306
           G +++++ + H+ +  E  + L+ G K+     + ++   S+    F +      D ++ 
Sbjct: 196 GDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDRKD-DVT 250

Query: 307 RVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADK----SIHIPFR 362
           R S +  +DL GS+ +++  A    + +    NQ +  L  +I +L ++    S H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 363 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMK- 421
           +S L ++L D LGG+TK  L+  I     N       ++  AKAK IKN P +  + +  
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYPTMNKIGLNA 365

Query: 422 ----DILVKNISSE----LAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESK 473
               D+LV++++ +    LAKI  + L T+ K     +        N LEN   E  + K
Sbjct: 366 KRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKTLKTENDSTTNSTSNSLENALQENSKLK 423

Query: 474 RQIESL 479
            Q+ESL
Sbjct: 424 LQLESL 429

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           Y  D +F   + ++  +  I + L DD  KGYN T++ YG TS+GK++ + GD       
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPD----- 140

Query: 135 LSDSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLL 178
            S + G+I  I  +L       +   L   S  ELY +++ DLL
Sbjct: 141 -STNDGLINHIADRLLFPQCEDNLKTLCSISMWELYIDKVYDLL 183

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 100/458 (21%), Positives = 207/458 (45%), Gaps = 112/458 (24%)

Query: 69  KMNSRTYTVDKVFGPSADQS-LIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD 127
           K++S+ +  D +F  +++Q+ ++     + LFD    GYN + + YG +++GK+ T+   
Sbjct: 63  KLDSQDFKFDNIFPTNSEQNEMLTVSTIKDLFD----GYNQSFITYGKSNSGKSDTL--- 115

Query: 128 EKLYDGQLSDSAGIIPRIMFKLFDALEATDSD--------------FLVKCSYIELYN-E 172
                   ++  G+I  +  +LF  +++  +D              F    S +E+++ E
Sbjct: 116 -------FNEKDGLIRLLFEQLFKKVQSLTADNNNNNTREGNNILTFNFSLSMMEIFSSE 168

Query: 173 ELKDLLDESHDSS----KRLRIFDXXXXXXXXXXXXXXXXPREPEVAHNGFSRRRQRPPP 228
           ++ DLL   +       K L++                    + ++  NG          
Sbjct: 169 KIYDLLSNEYTKDNPILKSLKV-------------------HQHDIIENG---------- 199

Query: 229 VKANRMSATKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLK-HRQVASTKMNDFSS 287
           +K ++               +V+N+    I      ++ LQK  K   Q +S  +N  ++
Sbjct: 200 IKGDK---------------HVKNLSHIQI----ASLDDLQKWFKIGCQRSSAIINAGTA 240

Query: 288 RSHTIFTIMLYK------NCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQS 341
           +     +I++ K      N   +L+++S ++ +DL G +  ++   Q     E   +N  
Sbjct: 241 KEKRSNSIIISKIHLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKDIQ-LTNDEMKKLNTL 299

Query: 342 LLTLGRVINSLAD-KSIHIP---FRESKLTRLLQDSLGGNTKTALIATI-SPAKINADET 396
           + +   +I +L+D KS+      +++S L ++LQD +GGN+KT  I    SP+ I  +E 
Sbjct: 300 MSSFQNLITTLSDPKSLPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEEL 359

Query: 397 SSTLEYAAKAKNIKNRPQL----GALMMKDILV---------KNISSELAKIKSDFLSTK 443
              L++A   K+IKN P +    G  + K +L+         +N  +++  ++S+ L+ K
Sbjct: 360 IEMLKFAMGLKSIKN-PLIMNVFGLNLQKQMLLFIKSSKLREENCQTKINYLQSE-LALK 417

Query: 444 SKDGIYMSHEHYQEIVNDLENC--QTEIQESKRQIESL 479
           +K    ++ +H++E  ND  +C  +  I + K +IESL
Sbjct: 418 NKLLEPVATDHHEENYNDESSCSDKETIMKLKLKIESL 455

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 140/303 (46%), Gaps = 47/303 (15%)

Query: 243 ESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYK-NC 301
           ++ S + ++N+++ ++ +  E  + L +G  +R      M   +SRS+ +  I L +   
Sbjct: 232 KNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFL 286

Query: 302 DGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 361
           + +L + S + L+D+A S+ I ++ +    AKEA  +N  + +    IN LA+     P+
Sbjct: 287 EDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PY 345

Query: 362 RE-----------SKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIK 410
            +           S L  ++   +GGN KT  I+TISP   N +ET  TL  + + K+I 
Sbjct: 346 DQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITLRISEQIKSII 405

Query: 411 NRPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQ 470
           +        +K +   N   EL  I+ D         I +  E+Y+        CQ  I 
Sbjct: 406 SSSNNINKNIKGL---NSKKELELIRMD---------INLKEEYYK--------CQIRIL 445

Query: 471 ESKRQIESLTSQNNLL-----LKDKKASQEV--TELQNSKIKKLQSTIEYLYDKIERQHH 523
           E   Q++ + S +N++      ++    +E+   E +N K+KK   T+ Y+  K  R + 
Sbjct: 446 E--EQLKLMKSHSNIITETNTTRNSGLQEEIKYQEKENRKLKKQVKTLAYILTKTNRNNK 503

Query: 524 NET 526
           + T
Sbjct: 504 SAT 506

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 75  YTVDKVFGPSADQS-LIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKL 130
           + VDKVF     QS L+  +I +    +   G+N +++ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 5/133 (3%)

Query: 288 RSHTIFTIMLYK-NCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 346
           RS TI  I L + + D +L   S +  VDLAGS+  S+   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 347 RVINSLAD-KSIHIP---FRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEY 402
            ++ +LA+ +SI I    +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 403 AAKAKNIKNRPQL 415
           ++ A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 69/168 (41%), Gaps = 53/168 (31%)

Query: 72  SRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLY 131
           S  Y  DK+F P      I   ++    +D  KGYN T + YG T TGKTYT+ G    +
Sbjct: 55  SNQYRFDKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQTGTGKTYTLYG--TAF 112

Query: 132 DGQLSD-----------------------------------------SAGIIPRI---MF 147
           +   +D                                         + G+I ++   +F
Sbjct: 113 NDTPTDLDSKNINTNKNVKNDSNISSNSNIQTSASSNKSANSILQKKNYGLISKVGNDLF 172

Query: 148 KLFDALEATDSD--FLVKCSYIELYNEELKDLLDESHD---SSKRLRI 190
           ++ D + A      FLV  S++E+Y EE+ DLL   HD   S+K+L +
Sbjct: 173 EMIDQIRAIRKGITFLVNISFVEVYKEEVYDLL--QHDDTLSNKKLSL 218

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 50  VTGSNEV-SINTTDEVGIAAKMNSRTYTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNC 108
           V  SN V ++N T       K+  ++++  KV    A ++  F E+A  + DD + G NC
Sbjct: 69  VGNSNHVQTVNDT-----VVKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINC 123

Query: 109 TVLVYGMTSTGKTYTMTGDEKLYDGQLSDS---AGIIPRIMFKLFDALEA-TDSDFLVKC 164
            V  YG      +  M G +     +  DS   +G++ +    +F+A+++ + S++ V  
Sbjct: 124 CVTTYGSGLAADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSL 183

Query: 165 SYIELYNEELKDLL 178
           S  E+Y +++ DLL
Sbjct: 184 SLCEVYVDKVFDLL 197

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 12/108 (11%)

Query: 75  YTVDKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQ 134
           +  +KV+     Q  + ++I      + + G+N +++ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 135 LSDSAGIIPRIMFKLFDAL----EATDSDFLVKCSYIELYNEELKDLL 178
                GI+ R+   +FD L    E + ++  +  ++ EL+ E + DLL
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 121/265 (45%), Gaps = 47/265 (17%)

Query: 287 SRSHTIFTIML-YKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTL 345
           SRS     I +  +N   E  + S + L+DLA S+ + ++   +    E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 346 GRVINSLAD--------KSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETS 397
            +V+  L++         S     R S+L + LQ ++GG++KT  +   S  K + + T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 398 STLEYAAKAKNIKNRP-----QLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSH 452
            TL   ++ ++I N P      L +  + D+ +KN+S              +++  Y++ 
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS--------------TREDSYLTR 389

Query: 453 EHYQEIVNDLENCQTEIQESKRQI---ESLTSQNNLLL-----------KDKKASQE--V 496
             Y E  +++      IQ++K Q+   +SLT +N  L+             K  S+E  +
Sbjct: 390 IKYLE--DEVSKLGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEEENL 447

Query: 497 TELQNSKIK-KLQSTIEYLYDKIER 520
           T  QN +I+ ++   ++ L +K ER
Sbjct: 448 TSQQNGRIQNEMSEVLDNLMEKCER 472

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 28/152 (18%)

Query: 270 KGLKHRQVAS-TKMNDF--------SSRSHTIFTIML-YKNCDGELFRVSKMNLVDLAGS 319
           KGLK   V+S  ++ D+        +S  HT   I L   NC  + FR   +  VDL   
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQ 225

Query: 320 ENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTK 379
           E++                 Q + +L  V+++  DK I     +S+  +LL +S+GGN K
Sbjct: 226 EDVL----------------QLVCSLVAVLSNDNDKKIGK--EKSQFCKLLSNSIGGNRK 267

Query: 380 TALIATISPAKINADETSSTLEYAAKAKNIKN 411
           T  I   S  + N   +  TLE+  K   + N
Sbjct: 268 TTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 14/64 (21%)

Query: 96  EPL----FDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDSAGIIPRIMFKLFD 151
           EPL     ++  +G +C+++ YG ++TGKT+       L+D       GIIP  + +L+ 
Sbjct: 66  EPLVIDNINELTRGVDCSMVTYGQSATGKTHV------LFD----QVRGIIPLFIEQLYI 115

Query: 152 ALEA 155
            LEA
Sbjct: 116 YLEA 119

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 15/131 (11%)

Query: 259 INAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGELFRV---------S 309
           I+  + I +L    K+  V S  +N     S T   + L +      F           S
Sbjct: 368 IDIDDAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNS 427

Query: 310 KMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHI---PFRESKL 366
           +  +VD+ G++++ +S  QN   K    +N SLLTLG+ IN+L    + I   P  E  +
Sbjct: 428 EFTIVDMNGTQHLGKS--QNVMPKTT-ELNSSLLTLGKSINNLNLDEMPIVISPLAEFLI 484

Query: 367 TRLLQDSLGGN 377
            R L++S  GN
Sbjct: 485 RRALKNSRLGN 495

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 73/159 (45%), Gaps = 12/159 (7%)

Query: 459 VNDLENCQTE-IQESKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDK 517
           + DL    TE   E+  QI+SL  +N  LL   K + + TE+QN + K L++    L D+
Sbjct: 697 LQDLRRIATEKADEASVQIKSLEMENEKLLAQSKEAVDTTEVQN-RCKILETDNNALKDQ 755

Query: 518 IERQHHNETELATTIHKLKEALHTMQGSLK--SYETHELRLQNDIKEVLYQGITSYRESM 575
           I        EL   ++     ++ +   +K  S E   LRL  + KE L +   +  E +
Sbjct: 756 I-------LELEMLVNDKFLNVNVLNDIIKQQSKEIQILRLDENEKERLSELERNVTE-L 807

Query: 576 NQHLEKVKVSMLDKNLSIKENINNITTIFDDTLKSVEAN 614
           N   +++K  + D  L    NINN +T  DD L     N
Sbjct: 808 NDENQRLKKELQDHRLDSTSNINNYSTRLDDLLARWRNN 846

>KLTH0C03014g Chr3 (266161..268185) [2025 bp, 674 aa] {ON} similar
           to uniprot|P39682 Saccharomyces cerevisiae YML046W PRP39
           U1 snRNP protein involved in splicing contains multiple
           tetriatricopeptide repeats
          Length = 674

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 26/124 (20%)

Query: 659 LTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQL--LSKLVSMVGAHV 716
           L  +S+   + +E+      +NST   L      +Y K+   S +L  L + V+ +G  +
Sbjct: 492 LRNVSQSRKYFKEFESLPQIRNSTAFWL------LYYKILKVSVELNELERFVARLGTEI 545

Query: 717 EESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDK 776
                  + ++   VN+I+D+ +S F            N+N  D  H+ ++ + TSG+D 
Sbjct: 546 ------FLPTL--VVNDILDDFKSFF----------LTNVNYPDYEHEVYKGRYTSGIDP 587

Query: 777 LKEL 780
           L +L
Sbjct: 588 LTDL 591

>TDEL0E03260 Chr5 (614135..615946) [1812 bp, 603 aa] {ON} Anc_5.302
           YDR292C
          Length = 603

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 429 SSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLK 488
           SS +A +  D L  ++KDG ++  E     ++DL   QT+I +S  Q+ ++ S    L K
Sbjct: 226 SSNIALVDKDALGNRTKDGEFLIKE-----IDDLLTSQTDITKSTVQVGNVNSAFGFLKK 280

Query: 489 DKKASQEVTE 498
               ++ +TE
Sbjct: 281 HLLGNKTITE 290

>ZYRO0C08030g Chr3 (616547..618682) [2136 bp, 711 aa] {ON} similar
           to uniprot|P34237 Saccharomyces cerevisiae YKL179C
          Length = 711

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 449 YMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNLLLKDKKASQEVTELQN--SKIKK 506
           Y     Y  +  +LE+  + + + +++ E L   N LL K    +++ ++LQ+  +KIK 
Sbjct: 231 YTDSSEYNLLAQELESSHSRVLQLEKRNEEL---NGLLAKATSTAEQESQLQSRETKIKH 287

Query: 507 LQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGSLKSYET 551
           L+S    L   +ER+  + T+L T   +L E L ++Q     Y+T
Sbjct: 288 LESENALLSASLERERSSHTKLQT---ELSEQLKSLQAETTYYKT 329

>KLTH0D11902g Chr4 complement(971208..973667) [2460 bp, 819 aa] {ON}
           weakly similar to uniprot|P33420 Saccharomyces
           cerevisiae YPL174C NIP100 Large subunit of the dynactin
           complex which is involved in partitioning the mitotic
           spindle between mother and daughter cells putative
           ortholog of mammalian p150(glued)
          Length = 819

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 472 SKRQIESLTSQNNLLLKDK----KASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETE 527
           SK  +E    Q+NLL++D+      S     L++++I++L+  ++   +K+ER  H E  
Sbjct: 590 SKVSVEQPKLQSNLLVEDRVHNSNGSTPKARLRDNRIEELELKLKVYENKVERHKHQE-- 647

Query: 528 LATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSML 587
              TI KL++ LH ++ +  + E     LQ    E L + + S R   N    K ++  L
Sbjct: 648 --ETIVKLQQELHGLKCNKNTLEASVSALQARSSE-LTEKLESERIRQNFLFPKPQMIDL 704

Query: 588 DKNLSIKENINNITTIFD 605
            K +   + I+ I+ I D
Sbjct: 705 VKEMEATDKIDLISQISD 722

>Kwal_33.14840 s33 complement(836195..836812) [618 bp, 205 aa] {ON}
           [contig 101] FULL
          Length = 205

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 45/94 (47%), Gaps = 7/94 (7%)

Query: 762 SHQNFEAKSTSGLDKL-KELSDASLKSSEDAVNKAKHRTDSFHDFVQKL-----CCDQSL 815
           SH   EA +  GLD L K+  +A+ K  + A + A    D   D  Q          +S 
Sbjct: 78  SHIAAEA-TKQGLDALNKKTGEAAAKGIDKAQDMAGQAQDKAQDLKQSAKENMDSAQESA 136

Query: 816 KKQMHDISDKHRMLEDHFDDNVKYFKESSKGFED 849
           K+   D++DK + L+    +N+ Y KES+K  +D
Sbjct: 137 KEAKDDLADKAQDLKQDAKENIGYAKESAKDAKD 170

>TPHA0A03200 Chr1 (700189..703593) [3405 bp, 1134 aa] {ON} Anc_7.300
           YDL185W
          Length = 1134

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 779 ELSDASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNVK 838
           E +D S+   +   N+AK   + F +FV+ LC        +++  +KH   E  + DN++
Sbjct: 600 ECTDLSVILRDSVANQAKRENNPFWNFVESLCVKSKNIPSLNESFEKHIPFELSY-DNME 658

Query: 839 YFKESSKGFEDMDCSIKK 856
             ++   G  D   S+KK
Sbjct: 659 VREQFIAGLIDATGSVKK 676

>TBLA0E04660 Chr5 (1188116..1190680) [2565 bp, 854 aa] {ON}
           Anc_4.322 YML061C
          Length = 854

 Score = 32.0 bits (71), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 852 CSIKKIIHEMSPEVGDIKSVETLMERINARTFSPVRP--TGKTPSRQVLKNAITSKASSR 909
            S  ++ H+  P++ D+ S ET+++ IN        P     TP +Q + N  TS  S  
Sbjct: 144 SSFNEVSHDNPPQLIDLSSQETIIQDINIPKLKDSLPNLAASTPIKQSIPNPYTSPDSKL 203

Query: 910 SMSPIKTLDTNVRI 923
            +SP +   +N R+
Sbjct: 204 KVSPDRDDFSNQRL 217

>KLTH0H02750g Chr8 complement(245136..248195) [3060 bp, 1019 aa]
           {ON} highly similar to uniprot|P49095 Saccharomyces
           cerevisiae YMR189W GCV2 P subunit of the mitochondrial
           glycine decarboxylase complex required for the
           catabolism of glycine to 5 10-methylene-THF expression
           is regulated by levels of levels of 5 10-methylene-THF
           in the cytoplasm
          Length = 1019

 Score = 32.0 bits (71), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 477 ESLTSQNNL-LLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKL 535
           E++T ++ L LL+   AS+E+ EL     ++L  T   L +++  QHH+ET +   +H+L
Sbjct: 483 ETVTRKDLLNLLQVFGASEELPELLPEFPEELSRTDSILSNEVFNQHHSETAMLRYLHRL 542

Query: 536 K 536
           +
Sbjct: 543 Q 543

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 68/160 (42%), Gaps = 23/160 (14%)

Query: 425  VKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESK----------- 473
             K  + ++ K+K+D    +SK       E  Q+ VN+LEN Q  + + K           
Sbjct: 863  TKKFNEQINKLKNDLQEMESKKKFL--EEKNQKTVNELENTQDLLNQEKENLRKNESLLN 920

Query: 474  ----------RQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHH 523
                      +Q + L S+ + + ++K    +  E  + KI+ LQ TI      +E+ H 
Sbjct: 921  RVKTSSETLQKQFDDLVSEKDEISREKLEVAQNLEEAHQKIQGLQETIREREATLEKLHS 980

Query: 524  NETELATTIHKLKEALHTMQGSLKSYETHELRLQNDIKEV 563
               EL   I  L   +   Q S    +  +L+L+N+IK +
Sbjct: 981  KNNELIKQISDLNCDISKEQSSQSLIKESKLKLENEIKRL 1020

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,680,345
Number of extensions: 3995654
Number of successful extensions: 18708
Number of sequences better than 10.0: 945
Number of HSP's gapped: 18759
Number of HSP's successfully gapped: 1431
Length of query: 945
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 826
Effective length of database: 39,836,145
Effective search space: 32904655770
Effective search space used: 32904655770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)