Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR009W6.17ON68068036480.0
Ecym_30216.17ON67467822560.0
SAKL0E01100g6.17ON71072317650.0
Kwal_56.224116.17ON68970615820.0
KLTH0C11308g6.17ON69070215620.0
KLLA0D01067g6.17ON66067515350.0
TDEL0G045206.17ON67969615300.0
ZYRO0C07876g6.17ON68169314660.0
Kpol_1045.726.17ON69572414030.0
Skud_5.276.17ON61550712371e-162
YEL062W (NPR2)6.17ON61549712211e-159
Suva_5.56.17ON61950312091e-158
Smik_5.256.17ON61549812071e-157
TPHA0J003106.17ON67570012121e-157
KNAG0M011406.17ON59469411961e-156
CAGL0L13288g6.17ON64670611791e-153
TBLA0G010106.17ON71074311321e-145
NCAS0H008706.17ON61267311221e-145
NDAI0D008606.17ON66651310871e-139
KAFR0L003806.17ON54067710241e-131
TBLA0D052101.324ON825166810.38
Smik_2.2073.295ON979104790.67
KLTH0C04642g8.809ON775116771.2
Ecym_30066.4ON72594715.5
KNAG0C005101.45ON78035716.1
Ecym_82415.259ON130879709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR009W
         (680 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...  1409   0.0  
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   873   0.0  
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   684   0.0  
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   613   0.0  
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   606   0.0  
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   595   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   593   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   569   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   545   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   481   e-162
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   474   e-159
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    470   e-158
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   469   e-157
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   471   e-157
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   465   e-156
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   458   e-153
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   440   e-145
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   436   e-145
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   423   e-139
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   399   e-131
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    36   0.38 
Smik_2.207 Chr2 (368052..370991) [2940 bp, 979 aa] {ON} YBR074W ...    35   0.67 
KLTH0C04642g Chr3 (402533..404860) [2328 bp, 775 aa] {ON} weakly...    34   1.2  
Ecym_3006 Chr3 complement(11788..13965) [2178 bp, 725 aa] {ON} s...    32   5.5  
KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}...    32   6.1  
Ecym_8241 Chr8 complement(495524..499450) [3927 bp, 1308 aa] {ON...    32   9.4  

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score = 1409 bits (3648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/680 (100%), Positives = 680/680 (100%)

Query: 1   MPPALEKMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPK 60
           MPPALEKMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPK
Sbjct: 1   MPPALEKMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPK 60

Query: 61  SQLCNKLVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAK 120
           SQLCNKLVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAK
Sbjct: 61  SQLCNKLVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAK 120

Query: 121 MLRVLEEQSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATT 180
           MLRVLEEQSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATT
Sbjct: 121 MLRVLEEQSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATT 180

Query: 181 KYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCL 240
           KYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCL
Sbjct: 181 KYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCL 240

Query: 241 SFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVY 300
           SFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVY
Sbjct: 241 SFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVY 300

Query: 301 YDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGH 360
           YDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGH
Sbjct: 301 YDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGH 360

Query: 361 SRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRN 420
           SRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRN
Sbjct: 361 SRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRN 420

Query: 421 LESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIY 480
           LESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIY
Sbjct: 421 LESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIY 480

Query: 481 RCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIP 540
           RCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIP
Sbjct: 481 RCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIP 540

Query: 541 PFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLN 600
           PFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLN
Sbjct: 541 PFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLN 600

Query: 601 TTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEM 660
           TTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEM
Sbjct: 601 TTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEM 660

Query: 661 NKHEVERLLKGTGEYNIVNS 680
           NKHEVERLLKGTGEYNIVNS
Sbjct: 661 NKHEVERLLKGTGEYNIVNS 680

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/678 (65%), Positives = 531/678 (78%), Gaps = 9/678 (1%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M N FDGFVPIH IFY+LFHPTEGTKVRFQFP DSLE SGI FDTIKNYVIPK QLCNKL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+GSYRLVCYPVNI A YYARNSFSF+ VFVFPYDSATSPYEPAI RL KM RVLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHN--ATTKYHEI 185
           QSQ+LSK+ERDP+YY LKT + KA +Q +EE +SK    N + K R  H+  A  KYHEI
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 186 MKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDV 245
           MKHI  +EK L IEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLL PPNSC S EDV
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFSVEDV 240

Query: 246 PIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVA 305
           PIAK+NL++ VDVNWDPTM+KIVP+INGINSIAKISK SDS V LVMEC+KHL+YYDCV 
Sbjct: 241 PIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVV 300

Query: 306 LVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQT 365
           LVDMFQFSNIYAPT+ L +FL D  + RECQ+YV+SSED E+H+LPFE RPN  HSRN T
Sbjct: 301 LVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFEGRPNANHSRNPT 360

Query: 366 ASTNTVYTLRRTTSTN-RADSFSSNAEFSQKSSGISSLAQ--SFTQSNKDYYYNRSRNLE 422
           AST T  TL+RT  TN R +SFSSN EF+QK +  +SL    S T S+K+  +N   N +
Sbjct: 361 ASTITFGTLKRTIYTNPRPESFSSNTEFAQKPNANTSLPSEPSITHSSKNSEFNHENN-K 419

Query: 423 SNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRC 482
               RTLPTR  LFDLYRSL+QGQT+K+WYK N+  IR+N+IDVRR I FGVF +LIYRC
Sbjct: 420 GILNRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRC 479

Query: 483 YSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPF 542
           YSYPVAKSIGTL++LKRFDY S  +NF+    +  NNVFST+DI VDF   S+ R   P 
Sbjct: 480 YSYPVAKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRK-KPL 538

Query: 543 LNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTT 602
           + ++D A+EVLR+ Y+KLS+ + L + +D I +  +   +N+A+    +RK S ST  T 
Sbjct: 539 VPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGTA 598

Query: 603 RITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNK 662
           ++ FD+++R  +KD E+R+Q        LK+KR Q+FLLL+S+K+VDSFDKIA++LE+NK
Sbjct: 599 KVLFDMKDRLSNKDFEYRDQNAASTE--LKRKRQQQFLLLKSIKNVDSFDKIAIKLEINK 656

Query: 663 HEVERLLKGTGEYNIVNS 680
            EVE LLK TGEYNI+NS
Sbjct: 657 QEVEELLKATGEYNIINS 674

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/723 (52%), Positives = 485/723 (67%), Gaps = 63/723 (8%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M + FDGFVPIH +FY++FHPTEGTKVR+QFP  +LE + I FDTIKNYVIPK QLCNKL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+G YRL CYPVN+ A YYARNSF+FN VFVFPY+ ATSPYEPA+ARL KM RVLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 128 QSQMLSKVERDPVYYQLK-----------------TGETKAAEQKTEESDSKAKTHNLDK 170
           QSQ+LSK E DPVY+ LK                 +   K  EQ T  ++S+        
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQ--G 178

Query: 171 KSRAQHNATTKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLF 230
           K   Q  A  KYHEIM  +   +K L IEDLITKLY+DLNNYSEC IP+DSGN++DIKLF
Sbjct: 179 KIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLF 238

Query: 231 PLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVEL 290
           PLL PPNSCLSFEDVPI+ VNL  L+DVNWDPTMLKIVPFING+NSIAKI+K S S  +L
Sbjct: 239 PLLAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDL 298

Query: 291 VMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRL 350
           V+EC+KHL+YY+CV L D+FQFSNIYA T+L+ +FL D  L  ECQ YV SS D E++RL
Sbjct: 299 VIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSS-DLELYRL 357

Query: 351 PFESRPN--GGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSL------ 402
           PFESRPN    HS  +  S++T++T+    S NR +S    +E S + +  SS       
Sbjct: 358 PFESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLM 417

Query: 403 ------AQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANY 456
                  QS T S  D         E   +  LPT+  LFDLYRSL QG+T+KEWYK N+
Sbjct: 418 RVRDRSGQSTTGSAVD---------EQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINF 468

Query: 457 SAIRENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNF-----IP 511
             IR+N IDVRR I FG+   LIYRCY+YPV K++G LE+LK     S + +        
Sbjct: 469 EIIRDNHIDVRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFR 528

Query: 512 TGTSAGNNVFSTSDIRVDFDGSSRSRNIPPF----LNSSDVAEEVLRETYQKLSIKDILN 567
              +  NNVFST+DI+VD + S        F     ++ D+AEEVL++ Y+KLSI + ++
Sbjct: 529 EKKNFTNNVFSTADIKVDLEHSPGGAPAEIFNRKHTSNVDMAEEVLKDAYKKLSIIESMD 588

Query: 568 DSI----DPIAKGYQAPSDNEAAMKGT---SRKQSMSTLNT---TRITFDIRNRHVSKDN 617
           D++    +P+++ Y   S  E++ KG+   SRK S ST+ +   +++ F+        + 
Sbjct: 589 DNLYHVHNPMSRLYGHDS-GESSTKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEE 647

Query: 618 EHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNI 677
           + ++++ E++  LLK+KR +EFLLL+SVKSVD+FDKI +RLE ++ EVE+LLK  G YNI
Sbjct: 648 DEKKERTEEVSNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNI 707

Query: 678 VNS 680
           +NS
Sbjct: 708 INS 710

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/706 (48%), Positives = 452/706 (64%), Gaps = 52/706 (7%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M   FDGFVP+HCI Y +FHPTEGTKVR QFP   LE S I FDTIKNYVIPK QLCNKL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+GS+RLVCYPVN+ APYYARNSFSF+ VFVFPYD ATSPYE AIARL KM  VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKT---HNLDKKSRAQHNATTKYHE 184
           QSQ+LSK E   VY+QLKT ++     +   +D++ +    +N   +S +   A  KYHE
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 185 IMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFED 244
           I+K +N   K + +EDLITK+Y DLNNYSECLIP+DSGNA+DIKLFPLL+PP+SCLSFED
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLSFED 240

Query: 245 VPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCV 304
           VP+  VNL  L+DVNWDPTMLKIVP+ING NSIAK++K SDS   LV+ECI+HL+YY+CV
Sbjct: 241 VPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCV 300

Query: 305 ALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQ 364
            L D+FQF NIYAPT+ L  FL +  L  ECQ+YV   E   I  LPFE +P        
Sbjct: 301 ILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKP-------- 352

Query: 365 TASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESN 424
           + +T     +R ++ST   D      E S K    SS      QS ++ Y  +S      
Sbjct: 353 SRTTYNNIPVRNSSST--LDVQRKGREMSIKE---SSFTAGIDQSGRNQYTPQSHTSSIQ 407

Query: 425 C-----------------KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVR 467
           C                 K    ++  LFD+YRSL+QGQT+KEWYK ++  IR  +IDVR
Sbjct: 408 CHNVSDASLGNSEGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVR 467

Query: 468 RLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDY----VSTTDNFIPTGTSAGNNVFST 523
           R I FGV H L+YRCYS+P+ K++G LE++K         ST   ++   +   NNV S 
Sbjct: 468 RFITFGVIHGLLYRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSA 527

Query: 524 SDIRVDFDGSS---RSRNIPPFLNSSDVAEEVLRETYQKLSIK----DILNDSIDPIAKG 576
           ++IR+  + SS   R R    F N +D AE++L + Y+KL++     +  + S +P+ + 
Sbjct: 528 AEIRIGLESSSSKLRERRFNHFSN-ADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRM 586

Query: 577 YQAPSDNEAAMKGTSRKQSMSTLNT-TR--ITFDIRNRHVSKDNEHREQQNEDIPLLLKK 633
           +   SD+ +    TS K  +ST  + TR  + FD+R    S   E R++   ++  L + 
Sbjct: 587 FGNCSDDSSGE--TSVKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKG--EVMRLEED 642

Query: 634 KRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679
           KR  E LLL+SV+ V++FDKI  RL  ++ EVE++L+  G YN+V+
Sbjct: 643 KRKDELLLLKSVRDVENFDKICTRLGRDREEVEKMLEDLGPYNVVH 688

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/702 (49%), Positives = 455/702 (64%), Gaps = 41/702 (5%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M   FDGFVP+H IFY++FHPTEGTKVR QFPS  LE S I FDTIKNYVIPK QLCNKL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+G +RLVCYPVN+ APYYARNSFSF+ VFVFPYD ATSPYEPAI RL KM  VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHN----ATTKYH 183
           QSQ+LSK E   VY+QLK   T+     TE +    +  +LD    AQ      A+ KY+
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQK-HGNTETAKGTEQPSSLDIGEIAQPENQGYASAKYY 179

Query: 184 EIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFE 243
           EI+K +    K + I DLITK+Y DLN+YSECLIP+DSGNA+DIKLFPLL+PP+SC S E
Sbjct: 180 EILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFSIE 239

Query: 244 DVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDC 303
           DVPI+ VNL  L+DVNWDPTMLKIVP INGINSIAK++K SDS V LV+ECIKHL+YY+C
Sbjct: 240 DVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNC 299

Query: 304 VALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFE---SRPNGGH 360
           V L D+FQFSNIYA TN L  FL +  L  ECQ+YV  +E   +  LPFE   SR   G+
Sbjct: 300 VILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQGN 359

Query: 361 SRNQTASTNTVYTLRRTTSTN-RADSFSSNAEFSQKSSGISSLAQSFTQSNKDY--YYNR 417
            R+++ S  T+  LR+   T  R +SF+S  +F      +S+  Q   QS      Y+N 
Sbjct: 360 IRDRS-SNGTLDILRKGKQTPLRENSFNSGMDF------LSNKHQHTPQSRSSSIPYHNT 412

Query: 418 S----RNLESNCKRTL---PTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLI 470
           S     N ++  K  L    ++  LFDLYRSLTQGQT++EWYK ++  IR  +IDVRR I
Sbjct: 413 SDASFGNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFI 472

Query: 471 IFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTT-----DNFIPTGTSAGNNVFSTSD 525
            FGV H LIYR YSYPV ++IG  E ++     + +      + + T     NNV S +D
Sbjct: 473 TFGVLHGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPL-NNVLSAAD 531

Query: 526 IRVDFDGS---SRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSI----DPIAKGYQ 578
           IR+  + +   +RS  +    +++D AEEVL + Y+KL++ D   D +    +PI+K + 
Sbjct: 532 IRIGLENAGFKARSEKLKQH-STADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKVFG 590

Query: 579 APSDNEAAMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQE 638
             S++   +       SM +    ++ FD+R    +   +  E++  +I   +++KR +E
Sbjct: 591 RNSEDSTDISTRESANSMGSDIKNKVAFDVRKTLATSSAD--ERRRSEILRSIEEKRNEE 648

Query: 639 FLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680
            +LL+SV+SV +FDKI   L  ++  VE +L   G YN+++S
Sbjct: 649 LILLKSVRSVHNFDKICTLLGKDRERVESMLSELGPYNVLHS 690

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/675 (49%), Positives = 464/675 (68%), Gaps = 17/675 (2%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M + FDGFVPIH +FY LFHPTEG+KVRFQFP +SLE   I FDTIKNY+IPK QLCNKL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+G YR+VCYPVN+ A YYARNSF+FN VFVFPYD ATSPYEPAIARL KM +VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187
           QSQ+LSK E++PVY+QLK+ ++ AA+Q TE        H  D KS        KY EI+K
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHT-DIKSTGDDGE--KYLEIIK 177

Query: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVPI 247
            +  ++K+L IEDL+ KL+ DLNNYSECLIP+D GN+IDIKLFP+ TPP+S +S EDVPI
Sbjct: 178 ELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNISVEDVPI 237

Query: 248 AKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALV 307
           A VNL +++DVNWDPTM+KIVP+INGINS+A+I+  + S VELV ECIKHL+YY+CV L 
Sbjct: 238 AVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILS 297

Query: 308 DMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGH-SRNQTA 366
           D+FQFSNIYAPT+ + +FL +  + + CQ++ V  +  +   LPFE RPN  + +  + A
Sbjct: 298 DIFQFSNIYAPTSEIHNFLTNPAVAKACQLF-VQGDSLKQSLLPFEGRPNNIYPTGRKQA 356

Query: 367 STNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCK 426
           ST+TV++ RR ++       +S+   + ++   SS   S+ +++     + +   E+  K
Sbjct: 357 STSTVHSRRRDSNDTATTGSTSSVRDTHRNYLSSSSTSSYFRAHASENTSLATG-ENQMK 415

Query: 427 RTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYP 486
           R LPTR  LFDLY+SL+QG+T+K+WYK N+  IR+N+IDVR+LI+FG+  RLIYR  SYP
Sbjct: 416 RILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYP 475

Query: 487 VAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNSS 546
           + K++GT ++LK         ++   G+ +  N+FS +DI+V       +++     +  
Sbjct: 476 IVKNVGTWDILKSLVSKEPKTHY---GSGSSKNIFSAADIKVVDTKEEGNQS-----DKL 527

Query: 547 DVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRITF 606
           D A+E+L+  YQKLS+K  + +++   A+ Y     N A  + TSRK S  +    +++F
Sbjct: 528 DAADELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGS--HQKVSF 585

Query: 607 DIRNRHVSKD-NEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEV 665
           D       K   E  +  + +   + KKK+ +E +LL+S+ + ++FDK+  +L+ ++HEV
Sbjct: 586 DFGTAGQQKTVTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEV 645

Query: 666 ERLLKGTGEYNIVNS 680
           E LLK  G YNIVNS
Sbjct: 646 ELLLKDLGHYNIVNS 660

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/696 (47%), Positives = 462/696 (66%), Gaps = 40/696 (5%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M ++F+GF+PIH IFYA+FHPTEGTKVR++FP  +LE   I FD IKNY+IPK QLC+KL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +T K+ +YR+  YPV + +P YARN FSFN VFVFPYD  TSPYEPAIARL KM +VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAK----THNLDKKSRAQHNATTKYH 183
           Q+ +LSK E+DP++Y  K  E K      ++ D+K+K    +HNL   S++Q  A+ KYH
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIK------DDQDAKSKPEKGSHNL---SKSQAYASEKYH 171

Query: 184 EIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFE 243
           +IM  I S +    ++DL+ ++Y+DLNNYSECLIP+D GNA+DIK+FP++TPPNS +S E
Sbjct: 172 KIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNISIE 231

Query: 244 DVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDC 303
           DVP++ VNL  ++DVNWDPTMLKIVP+ING+NSI+KI+K S S   LV+ECIKHL+YY+C
Sbjct: 232 DVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNC 291

Query: 304 VALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRN 363
           V L D+FQFSNIYAPT+ LR FL D +L  ECQ YVV  ED  + RLPF+ R N  HS  
Sbjct: 292 VLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFK-RVN--HSAT 348

Query: 364 QTASTNTVYTLR-RTTSTNRADSFSSNAEFSQKSSG-----IS--SLAQSFTQSNKDYYY 415
           ++       + R + TS +R  S SSN +F   S+      IS  SL ++   S   +  
Sbjct: 349 ESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSS 408

Query: 416 NRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVF 475
           N + N  +   R LPT+  LFDLYRSL+QG +L+EWY  +Y  IR N+IDVRR I FGV 
Sbjct: 409 NNT-NPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVI 467

Query: 476 HRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIP--TGTSAGNNVFSTSDIRVDFDGS 533
           + LIYRCYSYP+ K++   +L KR      +++ +      +   N+FSTSDI+   +  
Sbjct: 468 NGLIYRCYSYPIMKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVE-Y 526

Query: 534 SRSRNIPPFLNSSDVAEEVLRETYQKLSI---KDILNDSIDPIAKGYQAPSDNEAAMKGT 590
            R RN      + D+A+EVLR  Y+KLS+    D   +S DPIA+ Y+  S    A   T
Sbjct: 527 ERQRNKHHKALNLDIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGST 586

Query: 591 SRKQSMSTLN-TTRITFDIRNR--HVSK---DNEHREQQNEDIPLLLKKKRLQEFLLLQS 644
           +    +   +  ++++FD +    H+SK    +  + + +E+  L   ++R ++ +LL+S
Sbjct: 587 NNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKL---ERRERDLILLES 643

Query: 645 VKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680
           V++ DS D I V+LEM++++VE L++  GEY I+NS
Sbjct: 644 VEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/693 (44%), Positives = 437/693 (63%), Gaps = 44/693 (6%)

Query: 7   KMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNK 66
           +M ++F+GFVPIH +FYA+FHPT+GT+VR+++P  +LE + I FD IKNY+IPK QLC+K
Sbjct: 14  RMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHK 73

Query: 67  LVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLE 126
           L+T K+  YR+VCYPV + +PYYARN FSFN VFVFPYD  TS YEPAIARL KM RVLE
Sbjct: 74  LLTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLE 133

Query: 127 EQSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIM 186
           EQ+Q+LSK E DP+Y+  K      A+  TE+        +    +++Q  A  KY+EIM
Sbjct: 134 EQNQILSKAENDPIYFDFKL-----ADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIM 188

Query: 187 KHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVP 246
           K + S++ +  ++DL+ ++++DLNNYSECLIP+D GNA+DIK+FPL TPPNSC+S EDVP
Sbjct: 189 KDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCISIEDVP 248

Query: 247 IAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVAL 306
           I+ VNL  ++DVNWDPTMLKIVP+I+G+NSI+KI+K SDS V LV+EC+KHLVYY+CV L
Sbjct: 249 ISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVIL 308

Query: 307 VDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFE-----SRPNGGHS 361
            D+FQFSNIYAPT+L+R FL D  L  ECQ +V  +    +  +PFE        +   S
Sbjct: 309 ADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFERLRKFDLDDMDQS 368

Query: 362 RNQTASTNTVYTLRRTTSTNRADSFSSNA----EFSQKSSGISSLAQSFTQSNKDYYYNR 417
           +NQ + + T     ++ S ++   F S       F+Q+S        SF+ +N       
Sbjct: 369 KNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQS------SFSSTNT------ 416

Query: 418 SRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHR 477
             N+  +  R LPT+  LFDLYR+L+QG T++EWY  NY  I++N IDVRR I FGV   
Sbjct: 417 --NVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKG 474

Query: 478 LIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGN-----NVFSTSDIRVDFDG 532
           LIYRC+S+PV K +   +L  +       +     G    N      VFSTSD+++  +G
Sbjct: 475 LIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDMKLG-EG 533

Query: 533 SSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSID-PIAKGYQAPSD-NEAAMKGT 590
           S   +N      S D+A+EVLR  Y+KLS  +      D P+++ Y+  S  + +A+ G 
Sbjct: 534 SKMHQNF-----SVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGD 588

Query: 591 SRKQSMSTLNTTRITFDIRNRH---VSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKS 647
           +          +++ FD+        S   +  + +  +   L + K  Q+ +LL+S+ +
Sbjct: 589 NVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAA 648

Query: 648 VDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680
            D  DKI V+LE  +HEVE LL   G+Y I+NS
Sbjct: 649 ADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/724 (43%), Positives = 432/724 (59%), Gaps = 87/724 (12%)

Query: 12  FDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVTFK 71
           FDGF PIH IFY++FHPTEG KV +QFP ++L+   I FD+I++YVIPK QLCNKL+T K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 72  FGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQSQM 131
           +G+YR++ YP+ I    YARN+FSFNLVFVFPY+  TSPYE  I +L KM RVLEEQSQ 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 132 LSKVERDPVYYQLKT-------GETKAAEQKTEESDSKAKTHNLDKKSRAQHNAT----- 179
           LSK E+D  Y+  K         ++K   +K    ++   ++N +       NAT     
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 180 -----TKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLT 234
                 KY EI + +++DE +  I+D I +LY+DLNNYSECLIP+D+GNA+DIKLFPLL 
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 235 PPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMEC 294
           PP + +S EDVPI++VNL  ++DVNWDPTMLKIVP I+G+NSIAKI+K SDS   LV+EC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 295 IKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFES 354
           IKH +YY CV + D+FQFSNIYAPT+LLR+FL D ++  ECQ YV   E   +H+LP ES
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 355 ------RPNGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQ-SFT 407
                   +G  S+N   S N +         +RA SF S       S G SS  + S  
Sbjct: 364 LSKLKLDSDGSDSQNLRKSKNGI--------DSRAASFVS-------SRGASSHNENSSL 408

Query: 408 QSNKDYYYNRSR-----------NLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANY 456
            S  D Y NR R           +L  N K+ LPTR  LFDLYRSL+QG TLKEWYK N+
Sbjct: 409 YSRSDLYLNRHRSESSISSQNTNDLNGNVKQ-LPTRSTLFDLYRSLSQGVTLKEWYKENF 467

Query: 457 SAIRENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVS----TTDNFIPT 512
             IR N ID+R+ IIFG+ + L+YRC S+PV  +   +  +K+F  +     T  + +  
Sbjct: 468 FEIRNNGIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQK 527

Query: 513 GTSAGNNVFSTSDIRVDFDG-SSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSID 571
             S   ++FSTSDI+V  D  S R+R I       D+A+ VL+  Y+KL++         
Sbjct: 528 QLS--QDIFSTSDIKVGEDLISGRNRRIQTL--DLDIADSVLKNVYKKLTL--------- 574

Query: 572 PIAKGYQAPSDNEAAMKGTSRKQSMSTL---------------NTTRITFDIRNRHVSKD 616
              K  +  S N A       K+S+ +L                 ++++F   +      
Sbjct: 575 ---KTEEENSSNRALNSQELEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSA 631

Query: 617 NEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYN 676
           +     +NEDI  L K ++  E +LL++++S ++ DKI V LE  + EVE +LK   ++ 
Sbjct: 632 SSGDVTENEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFK 691

Query: 677 IVNS 680
           ++NS
Sbjct: 692 VINS 695

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  481 bits (1237), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 251/507 (49%), Positives = 349/507 (68%), Gaps = 28/507 (5%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+G+YR+VCYPV I +P YARN FSFN VFVFPYD  TSPYEPAI RL KM +VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 128 QSQMLSKVERDPVYYQLK-------TGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATT 180
           Q+Q+LSK E+D V++ LK       T  T  A   +  S +   T+    K  A+   ++
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKD-AKDLRSS 179

Query: 181 KYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCL 240
           +Y+++ K +   E +  I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C+
Sbjct: 180 RYNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCV 239

Query: 241 SFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVY 300
           S EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S S   LV+ECI+HL+Y
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299

Query: 301 YDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGH 360
           Y CV L D+FQFSNIYAP++L+R FL D ++  +CQ YV   E  ++  LP     +   
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSAD 359

Query: 361 SRNQTASTNTVYTLRRTTST-------NRADSFSSNAEF---SQKSSGISSLAQSFTQSN 410
                  + +++  R++ S+       +R  SFSSN++    S  +S  SS+ + + QS 
Sbjct: 360 -----RDSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQ 414

Query: 411 KDYYYNRSRNLESNCKRT--LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRR 468
                  S NL +N  R   LPTR  LFDLYRSL+QG+TLK WY++ ++ ++EN IDVRR
Sbjct: 415 TSL---SSSNLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRR 471

Query: 469 LIIFGVFHRLIYRCYSYPVAKSIGTLE 495
            I FG+  R+IYRCYS+PV  ++ + E
Sbjct: 472 FITFGLERRIIYRCYSFPVMLNVDSRE 498

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  474 bits (1221), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/497 (49%), Positives = 342/497 (68%), Gaps = 16/497 (3%)

Query: 12  FDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVTFK 71
           F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+T KNY+IPK  LC+KL+TFK
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLITFK 64

Query: 72  FGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQSQM 131
           +G+YR+VCYPV I +P YARN FSFN VFVFPYD  TSPYEPAI RL KM +VLEEQ+Q+
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 132 LSKVERDPVYYQLK-------TGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHE 184
           LSK ERDPV++ LK       T  T         S +   TH   +K   +   +++Y +
Sbjct: 125 LSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKD-TKDMRSSRYSD 183

Query: 185 IMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFED 244
           ++K +   +    I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C+S ED
Sbjct: 184 LIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVSLED 243

Query: 245 VPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCV 304
           VP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S+S   LV+ECI+HL+YY CV
Sbjct: 244 VPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCV 303

Query: 305 ALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQ 364
            L D+FQFSNIYAP++L+R+FL D ++  +CQ YV   E  +I  LP     + G     
Sbjct: 304 TLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNK--SLGSGDQD 361

Query: 365 TASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESN 424
           + S +     + ++  +  DS +++   + + S  SSL  SF+   KD+  +++    SN
Sbjct: 362 SPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSSN 421

Query: 425 C------KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRL 478
                   R LPTR  LFDLYRSL+QGQTLK WY++ Y  ++EN ID+RR I FG+  R+
Sbjct: 422 IHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRI 481

Query: 479 IYRCYSYPVAKSIGTLE 495
           IYRCYS+PV  + G+ E
Sbjct: 482 IYRCYSFPVMINAGSRE 498

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%)

Query: 637 QEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680
           +E +L +S+++ ++FDKI V L   K EVE  L   GE+ ++NS
Sbjct: 572 EEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS 615

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  470 bits (1209), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 251/503 (49%), Positives = 342/503 (67%), Gaps = 19/503 (3%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+G+YR+VCYPV I +P YARN FSFN VFVFPYD  TSPYEPAI RL KM +VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 128 QSQMLSKVERDPVYYQLK-------TGETKAAEQKTEESDSKAKTHNLDKKS----RAQH 176
           Q+Q+LSK ERDPV++ LK       T  T      +  S +   TH    K     R+  
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 177 NATTKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPP 236
               KY++I+K +   E    I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 237 NSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIK 296
            +C+S EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S S   LV+ECI+
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 297 HLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRP 356
           HL+YY CV L D+FQFSNIYAP++L+R+FL D ++  +CQ YV   E  ++  LP     
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNK-- 358

Query: 357 NGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYN 416
           N         S +     + ++  +  +S +++   + K S  SSL  SF+  +KD+  +
Sbjct: 359 NFDSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQS 418

Query: 417 R----SRNLESNCKRT--LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLI 470
           +    S N  +  KR   LPTR  LFDLYRSL+QGQTLK WY+  ++ ++EN ID+RR I
Sbjct: 419 QTSCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFI 478

Query: 471 IFGVFHRLIYRCYSYPVAKSIGT 493
            FG+   +IYRCYS+PV   +G+
Sbjct: 479 TFGLERSIIYRCYSFPVMIHVGS 501

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 61/118 (51%), Gaps = 12/118 (10%)

Query: 570 IDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRIT-FDIRNRHVSKDNEHREQQNE--- 625
           + P+A   + PS+ + ++K      S+S   +   T  ++++   SK +   ++ N    
Sbjct: 507 MTPVAT--KEPSNEDNSLKKRDYNHSLSVTGSKSTTQTNVKSERPSKVSFEMQRANSLAT 564

Query: 626 ---DIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680
               IP L  +++    +L +S++S ++FDKI V L  +K EVE  L   GE+ ++NS
Sbjct: 565 GKNKIPKLSDEEKK---ILEKSIRSAENFDKICVLLGKSKQEVENYLSELGEFKVINS 619

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  469 bits (1207), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 249/498 (50%), Positives = 341/498 (68%), Gaps = 18/498 (3%)

Query: 12  FDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVTFK 71
           F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL+TFK
Sbjct: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLITFK 64

Query: 72  FGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQSQM 131
           +G+YR+VCYPV I +P YARN FSFN VFVFPYD  TSPYEPAI RL KM +VLEEQ+Q+
Sbjct: 65  YGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEEQNQL 124

Query: 132 LSKVERDPVYYQLKTGE-------TKAAEQKTEESDSKAKTH-NLDKKSRAQHNATTKYH 183
           LSK E+DPV++ LK  E       T      +  S +   TH   DK ++   N+  +Y+
Sbjct: 125 LSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNS--RYN 182

Query: 184 EIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFE 243
           +++K     E    I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C+S E
Sbjct: 183 DLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVSLE 242

Query: 244 DVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDC 303
           DVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S+S   LV+ECI+HL+YY C
Sbjct: 243 DVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYYKC 302

Query: 304 VALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRN 363
           V L D+FQFSNIYAP++ +R+FL D ++  +CQ YV   E  +I  LP       G   +
Sbjct: 303 VTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDLDS 362

Query: 364 QTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSR---- 419
            + S           S     S +++   + K S  SS+  SF+ + +D+  +++     
Sbjct: 363 PSFSVRRKSKSSSIPS--NPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 420 --NLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHR 477
             ++ +N  R LPTR  LFDLYRSL+QGQTLK WY++ Y  I++N ID+RR I FG+  R
Sbjct: 421 NIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480

Query: 478 LIYRCYSYPVAKSIGTLE 495
           +IYR YSYPV  S+G  E
Sbjct: 481 IIYRSYSYPVMLSVGPRE 498

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 637 QEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680
           +E +L +SV+S ++FDKI V L   K EVE  L   GE+ I+NS
Sbjct: 572 EERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  471 bits (1212), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 297/700 (42%), Positives = 406/700 (58%), Gaps = 54/700 (7%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M N FDGFVPIH IFY++FHPTEGTKV ++FP  +L KSGI FD IKNYVIPK QLC+KL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +T K+ +YR+V YP+ I +  YARN+FSFNLVFVFPY+  TSPYEP + RL KM   LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTE-ESDSK--AKTH--------NLD---KKSR 173
           Q Q LSK E+D  Y+  K       + K+  E D+   +KT+        N+D     + 
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 174 AQHNATTK--------YHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAI 225
            Q  A +K        Y+ I  +I +D+  L + D++ ++++DLN+YSEC IP+D GNAI
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 226 DIKLFPLLTPPNSCLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSD 285
           DIKLFP L PP   +S EDVPI  VNL  ++DVNWDPTMLKIVP+I+G+NSI KI+  S+
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 286 SAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDC 345
           S   LV+ECI+H VYY CV L D+FQFSNIYAPT+ + DFL D  L  ECQ+YV S ED 
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 346 EIHRLPFESRPNGGHSRNQT--ASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGI---S 400
            +  LPF+       +R     AS  T  +  R    ++A SF S+       +      
Sbjct: 361 LLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNHD 420

Query: 401 SLAQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIR 460
           S+ ++  +S   +    +  +  N +  LPT+  LFDLYRSL+QG  L+EWY+ N+++IR
Sbjct: 421 SIYENRRRSESSFSSGNNDEMHQN-RNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIR 479

Query: 461 ENQIDVRRLIIFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGT-SAGNN 519
           +N ID+RR IIFG+  R+IYRC+SYP+ K+      L     +      +   + S   N
Sbjct: 480 DNFIDIRRFIIFGIIKRIIYRCHSYPLPKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYN 539

Query: 520 VFSTSDIRVDFDGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQA 579
           +FSTSDI+   D  + ++     L+  DVA+ VL   Y+KLS       SI+   +G Q 
Sbjct: 540 IFSTSDIKFGVDLYTDTKKKLHTLD-VDVADRVLNNVYKKLSTNGRPTTSIN--GQG-QH 595

Query: 580 PSDNEAAMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEF 639
           PS  + A K  S    +  L        + N  +      RE    D           + 
Sbjct: 596 PS--KVAFKNQSYDNDLPGL--------MNNLGIEATKFSREININD-----------KI 634

Query: 640 LLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679
            LL +++S ++ D I   LE+++ EVE LL    EY I+N
Sbjct: 635 YLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  465 bits (1196), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/694 (39%), Positives = 382/694 (55%), Gaps = 123/694 (17%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M +KF+GFVPIH +FY +FHPTEG+KV +QFP  +L+   I FD IKNY+IPK QLC++L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +T K+G+YR+V YPV +++  YARN F FN VFVFPY+ ATSPYEPAI RL KM RVLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 128 QSQMLSKVERDPVYYQ-----LKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKY 182
           QSQ+LS+ ERD   ++           K     T    SK K+ + DKK+          
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEG-------- 172

Query: 183 HEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC-LS 241
                    D   + ++DLI ++Y+DLNNYSECLIP+D GNAIDIK+FPL+ PP S  LS
Sbjct: 173 ---------DIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLS 223

Query: 242 FEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYY 301
            EDVP+  V L  ++D+NWDPTM+ I+PFING+NSI  I++ SDS  ELV+ECIKHL+YY
Sbjct: 224 IEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYY 283

Query: 302 DCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFE-----SRP 356
            CV + D+FQFSNIYAP++L+ +FL D  +  +CQ YV   +   +  +P +     SR 
Sbjct: 284 KCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRN 343

Query: 357 NGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDY--Y 414
           N     N  +ST  +     +  +N +  F S +   +  S +SS        + D+  Y
Sbjct: 344 NKHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIY 403

Query: 415 YNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGV 474
           Y              PTR VLFDLYRSL+QG TL++WY  N++ IR N IDVR+ I FG 
Sbjct: 404 Y--------------PTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGT 449

Query: 475 FHRLIYRCYSYPV---------AKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSD 525
             ++IYR  SYPV         AK +G  ++ ++                + N  FSTSD
Sbjct: 450 IKKIIYRVLSYPVLEKRRNSIIAKQMGKSKMAEK-------------APHSKNAFFSTSD 496

Query: 526 IRVDFDGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEA 585
           I+ D DG     ++  +   S V+ E  RE  ++               K + A      
Sbjct: 497 IKFD-DGDRLFNSL--YARFSKVSFEKRRENARE--------------RKSFDAVGGTNG 539

Query: 586 AMKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSV 645
           A K T                                      +L K+++LQ   LL ++
Sbjct: 540 ADKETM-------------------------------------ILTKEEKLQ---LLGAL 559

Query: 646 KSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679
            +++SFDKI V+L  ++ E+  L+   GEY ++N
Sbjct: 560 DNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  458 bits (1179), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 295/706 (41%), Positives = 399/706 (56%), Gaps = 95/706 (13%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M ++F+GFV IH IFY+ FHPTEG+KV+F FP  SLE SGI FD+IKNYVIPK  LC++L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +TFK+G+YR+ CYPV + +  YARN FSFN VFVFP++  TSPYEPAI RL KM RVLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKY---HE 184
           Q+Q+LSK E D + + LK+    A +    ++DS       D  S        KY   + 
Sbjct: 121 QNQILSKSENDTIMFNLKS----ADKNFNIDNDSSNYILGDDISSIMTTQQKDKYERLNN 176

Query: 185 IMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFED 244
           I+ +I     N  I DL+ +LY+DLN YSECLIP+D GNA+DIKLFPLLTPP   +S E 
Sbjct: 177 IISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYISIEH 236

Query: 245 VPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCV 304
           VPI+ VNL  +VDVNWDP ML I+P+INGIN+I +IS+ S +   LV+ECI+HLVYY C+
Sbjct: 237 VPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCI 296

Query: 305 ALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNG----GH 360
            L D+F+FSN+YAPT+ LR FL D  +  ECQ YV+         LP  S+ N      H
Sbjct: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVM---------LPINSKMNDLSLYPH 347

Query: 361 SRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRN 420
               +A    + +   + ST+    +S N   S+  S  SS+ QS T    ++Y N+ ++
Sbjct: 348 HGKHSAFNGDIGSRNNSVSTSL---YSFNGNDSRPQSRSSSVDQSQT----NFYKNKKQS 400

Query: 421 LES----------NCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLI 470
             S          N  + LPTR +LFDLYRSL+QG TLKEWY  N+  IR+N+IDVRR I
Sbjct: 401 ESSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFI 460

Query: 471 IFGVFHRLIYRCYSYPVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDF 530
            FGV  R+IYRC +Y V  S   L+ L + + +               N  S  +I    
Sbjct: 461 TFGVLRRIIYRCETYSVINSTDHLQNLWKLNELE--------------NPISMENI---- 502

Query: 531 DGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGT 590
               +S +I      S  A+E L   Y+KLS+K                PS  + A+K  
Sbjct: 503 -SKLQSNHI-----DSLAADEALMNAYKKLSLK---------------VPS--KGALKSH 539

Query: 591 SRKQSMSTLNTTRITFD----IRNRHVSK---------DNEHREQQNEDIPL----LLKK 633
           +   S  +L  T    +     RN+ +SK          N  R   N   P+      K 
Sbjct: 540 NTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGFRWGSNIKTPIQETTWKKL 599

Query: 634 KRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679
            ++Q  ++L+++   ++ DKI V LEM +  V  +L   GE  ++N
Sbjct: 600 SKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLIN 645

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  440 bits (1132), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 285/743 (38%), Positives = 405/743 (54%), Gaps = 105/743 (14%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M + F+GFVPIH +FY++FHPTEGTKVR++FP  +L+   I FDTIKNY+IPK QLC+KL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +T K+G YRLV YPV I +  YARN FSFN VFVFP +  TSPYEP IARL KM RVLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187
           Q+Q+LS+ E D VY+        + +      D         +K  +     T       
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180

Query: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLSFEDVPI 247
             N    N  ++DLI ++++DLNNYSECLIP+D GN++DIK+FP + PP+  +S+EDVP+
Sbjct: 181 PDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSISISYEDVPV 240

Query: 248 AKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALV 307
           A V+L +++DVNWDPTMLKIVPFI+ INSI++I+  S+S V+ V+ECI+HLVYY  V L 
Sbjct: 241 AMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILS 300

Query: 308 DMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQTAS 367
           D+FQF+NIYAPT+ LRDFL D  L  +CQ YV   ++    +LP E             S
Sbjct: 301 DIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLE------------KS 348

Query: 368 TNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYY--YNRSRN----- 420
            NT                    E+S   S I    +     ++  +  Y + RN     
Sbjct: 349 INTDLD-----------------EYSNSGSAIYPNNEILENDDRLRWPMYYKPRNSQSSL 391

Query: 421 ---LESNCKRT---LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGV 474
              + S  +RT   LPT+  LFDLYRSL+QG  L +WY  +YS I  N+ID+RR I FG+
Sbjct: 392 SSGISSGNERTSNYLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGL 451

Query: 475 FHRLIYRCYSYPVAKSIGTLELLKRFD-------YVSTTDNFIPTGTSAGNNVFST---- 523
              L+YRCY+ P+ K+ G  ++L           Y S  D+   T ++A     ++    
Sbjct: 452 VRGLLYRCYAIPIMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDS 511

Query: 524 --SDIRVDFDGSSRSRNIPP-------FLNSSD--------------------------- 547
              D++ D   +S S  I P       F+N  D                           
Sbjct: 512 DIHDLKDDEINNSGSCGIKPSFDVNKLFINGDDHSETTTVKHNSSRDASEHLFSPPPKRQ 571

Query: 548 -----VAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNT- 601
                +A++VL + ++KL+  D    S  PI K  +   D        S      + NT 
Sbjct: 572 ILNSGIADKVLSDIHRKLAKFDDTPRS--PIVKRKE---DTFRDFSNGSNIVGYGSSNTG 626

Query: 602 TRITFDI-RNRHVSKDN-EHRE---QQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAV 656
            +++F++ R+   +++N +H       ++DI    ++K     LLL+S++  D+ DKI +
Sbjct: 627 NKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICI 686

Query: 657 RLEMNKHEVERLLKGTGEYNIVN 679
           +L+  + EVE LL   G+Y I+N
Sbjct: 687 KLQKPRKEVEELLSEIGDYVIIN 709

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  436 bits (1122), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 274/673 (40%), Positives = 391/673 (58%), Gaps = 76/673 (11%)

Query: 10  NKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVT 69
           N F+GF+PIH IFY++FHPTEGTKV ++FP  +L    I FDTIKNY+IPK+QLCN+L+T
Sbjct: 10  NHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLLT 69

Query: 70  FKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQS 129
           FK+ +YR+V YP+ I APYYARN FSFN VFVFPY+  TSPYEP+IARL KM ++LEEQS
Sbjct: 70  FKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQS 129

Query: 130 QMLSKVERDPVYYQ---LKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIM 186
           Q+LSK E DP+Y++   + T  T     +   S    + ++ +  +      T  + E  
Sbjct: 130 QILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEEE 189

Query: 187 KHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLT-PPNSCLSFEDV 245
             +        ++DLI ++Y+DLNNYSECLIP+D GN I+IK+FPLL  PPN  +S EDV
Sbjct: 190 DGVTK----FSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDV 245

Query: 246 PIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVA 305
           P++ +NL N++DVNWDPTML IVP+ING+N I+KI+K + +   LV+ECIKHLVYY+CV 
Sbjct: 246 PMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVI 305

Query: 306 LVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHSRNQT 365
           + D+FQFSN+YAPT+L+  FL D  +  +CQ YVV     ++  LPFE   N G+ +  T
Sbjct: 306 ITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFE---NNGNKQPST 362

Query: 366 ASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNC 425
              +   +L  + S +      S  +  QKS   +SL+ S T  N  ++           
Sbjct: 363 PKHSRTTSLSSSMSGSVNSHEHSYMDTIQKSE--TSLSLSSTDPNNPHFE---------- 410

Query: 426 KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSY 485
              LPT+  LFDLYRSL+ G TL+ WY++N + I EN +DVR+ I FG+   LIYRC+SY
Sbjct: 411 LAHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSY 470

Query: 486 PVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDIRVDFDGSSRSRNIPPFLNS 545
           P+ +     E ++R + ++  D       S+G+   S S        S  S N+      
Sbjct: 471 PIPQRPSN-EGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINV------ 523

Query: 546 SDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTRIT 605
            D A+E+L+  Y+KL                      ++ +     + +SM T       
Sbjct: 524 -DGADELLKNVYKKLE-------------------RHSKVSFMDKEKNESMKT------- 556

Query: 606 FDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKHEV 665
            D + R  +   E R                   +LL+S++S+++ DKI V+L  ++ +V
Sbjct: 557 -DEKGRPSTMTKEERS------------------VLLKSIESLENLDKICVKLGKSRQQV 597

Query: 666 ERLLKGTGEYNIV 678
           ER L   G Y I+
Sbjct: 598 ERWLDELGNYKII 610

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  423 bits (1087), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 239/513 (46%), Positives = 324/513 (63%), Gaps = 45/513 (8%)

Query: 10  NKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKLVT 69
           N F+GF+PIH IFY++FHPTEGTKVR++FP  +L  S I FD IKNY+IPK QLCNKL+T
Sbjct: 11  NHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLLT 70

Query: 70  FKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEEQS 129
           FK+ +YR+V YP+ I + +YARN FSFN VFVFPYD  TSPYEPAIARL KM +VLEEQ+
Sbjct: 71  FKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQN 130

Query: 130 QMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTH-NLDKK------SRAQHNATTK- 181
           Q+LSK E DP+Y++      +        +D+  K +  L KK      +R Q + + + 
Sbjct: 131 QILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNRI 190

Query: 182 -----------------------YHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIP 218
                                  Y+ I +++N++ + + ++DLI ++Y+DLNNYSECLIP
Sbjct: 191 LEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSR-ISVQDLIMRIYQDLNNYSECLIP 249

Query: 219 MDSGNAIDIKLFPLLTPPNS-CLSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSI 277
           +D GN +DIK+FPLL PP +  LS EDVP++ V+L  + DVNWDPTMLK++PFINGIN I
Sbjct: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309

Query: 278 AKISKCSDSAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQV 337
           +KISK S+S+  LV+ECIKHL+YY+CV + D+FQFSN Y+ T+L+  FL D  +   CQ 
Sbjct: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369

Query: 338 YVVSSEDCEIHRLPFESRPNGGHSRNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSS 397
           YVV     ++ RLPF       H   +T+  ++           +  SF S+   +   S
Sbjct: 370 YVVLPLGSKLTRLPF-------HIETETSVQSSSAYRHHHNRHEKTPSFGSSITSNNGRS 422

Query: 398 GISS--LAQSFTQSNKDYYYNRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKAN 455
             S+    QS T  N     + S  + +     LPT+  LF+LYRSL Q   LK WYK N
Sbjct: 423 SFSADDRKQSETSLNSSNDPSNSNLIST---AHLPTKMSLFELYRSLNQRTDLKNWYKLN 479

Query: 456 YSAIRENQIDVRRLIIFGVFHRLIYRCYSYPVA 488
           Y+ I EN ID+R+ I FG+   LIYRC+SYP+ 
Sbjct: 480 YTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV 512

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 637 QEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679
           Q  +LL S+ ++D+ DKI V+L   + ++E  L   G+Y ++N
Sbjct: 623 QRNILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  399 bits (1024), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 253/677 (37%), Positives = 362/677 (53%), Gaps = 141/677 (20%)

Query: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67
           M  +F+GF PIH IF+++FHPTEG+KV +QFP ++L+   I FD+IKN+VIPK QLC++L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127
           +T ++ +YRLV YPVN+ +  YARN FSFN VF+F YD  T PYEPAI RL KM + LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKYHEIMK 187
           QSQ+LSK +R   ++  K GE        +  D+K                         
Sbjct: 121 QSQILSKSQRTSAFF--KDGE------DVDFVDTK------------------------- 147

Query: 188 HINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC-LSFEDVP 246
                     I+DL+ +LY+DLNNYSECLIP+D GN I+IK+FP+L PP S  +S EDVP
Sbjct: 148 --------FSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVP 199

Query: 247 IAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVAL 306
           ++ VNL  +VD+NWDPTML I+PFI+G+NSI  IS  SDS   LV+ECIKHL+YY+CV +
Sbjct: 200 LSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVII 259

Query: 307 VDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGG-HSRNQT 365
            D+FQFSNIYAP++L+ +FL D ++   CQ YVV     +I+ LP  S  +   ++ + T
Sbjct: 260 TDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMT 319

Query: 366 ASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNC 425
               +      ++  +   +++  +E +      S+L+ S  Q +               
Sbjct: 320 QKALSSSRSSFSSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQDN-----------PRQ 368

Query: 426 KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSY 485
            + LP++  LFDLYRSL  G T++ WYK N+S I+EN IDVR+ I FGV +++IYR + Y
Sbjct: 369 GQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQY 428

Query: 486 PVAKSIGTLELLKRFDYVSTTDNFIPTGTSAGNN--VFSTSDIRVDFDGSSRSRNIPPFL 543
           P+ +        K F          P  +   N+  V STSDI+                
Sbjct: 429 PIMEH-------KTFKS--------PLLSDRQNDKIVLSTSDIKF--------------- 458

Query: 544 NSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMSTLNTTR 603
              DV + +L   Y KLS                                         +
Sbjct: 459 ---DVGDRILNSIYNKLS-----------------------------------------K 474

Query: 604 ITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDKIAVRLEMNKH 663
           +TFD   +  SK    R                ++ +L  +++  +SFD+I  +L  +K+
Sbjct: 475 VTFDRDKKLESKIGNSRNLGES-----------EKNILFNALERHESFDRICSKLGKSKN 523

Query: 664 EVERLLKGTGEYNIVNS 680
           EVE ++   GEY  +NS
Sbjct: 524 EVESIISEIGEYMTINS 540

>TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON}
           Anc_1.324 YJL057C
          Length = 825

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 70/166 (42%), Gaps = 31/166 (18%)

Query: 331 LPRECQVYVVSSEDCEIHRLP--FESRPNGGHSRNQTASTN-------TVYTLRRTTSTN 381
           L  E   Y+  +   EIHR     +S P  G+S N T   N         + L  ++   
Sbjct: 86  LGGESMNYICPTCGSEIHRKESIIDSSPISGNSNNLTTKLNLQNFPNANYFKLLESSHKR 145

Query: 382 RADSFSSN---------AEFSQKSSGISSLAQSFTQSNKDYYYNRSRNLESNCKRTLPTR 432
             ++ SSN          E    SS I+S+  S T  N D  YN  RN  S+  +++P  
Sbjct: 146 SEENTSSNINNHIRSSIVELQDLSSNINSVVNSLT--NSDTEYNDIRNTSSSSNQSMP-- 201

Query: 433 RVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRL 478
            +  DL+   TQG   K+++K +    R       R +++ V HRL
Sbjct: 202 NIPQDLF---TQGY-FKKFFKIDSLLGRG-----ARGVVYKVIHRL 238

>Smik_2.207 Chr2 (368052..370991) [2940 bp, 979 aa] {ON} YBR074W
           (REAL)
          Length = 979

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 14/104 (13%)

Query: 109 SPYEPAIARLAKMLRVLE---------EQSQMLSKVERDPVYYQLKTGETKAAEQKTEES 159
           SPYEP IA L  +L V E         ++SQ  S V    VY + K     A   KT +S
Sbjct: 819 SPYEPIIAEL--LLEVKENRACTLSFNDKSQAKSPVREITVYQEKKFPAEPANVTKTIKS 876

Query: 160 DS---KAKTHNLDKKSRAQHNATTKYHEIMKHINSDEKNLYIED 200
            +   + + H LD    A H A   + +I+   + D+ NL ++D
Sbjct: 877 STGINELQLHKLDFDQDAYHIAVQWFPKILTDGDLDDDNLSLKD 920

>KLTH0C04642g Chr3 (402533..404860) [2328 bp, 775 aa] {ON} weakly
           similar to uniprot|P08468 Saccharomyces cerevisiae
           YMR257C PET111 Specific translational activator for the
           COX2 mRNA located in the mitochondrial inner membrane
          Length = 775

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 539 IPPFLNSSDVAEEVLRETYQKLSIK-DILNDSIDPIAKGYQAPSDNEAAMKGTSRKQSMS 597
           +P +++S+ + ++++RETY+++ +K DIL    + + +  ++   N +   G   KQ  +
Sbjct: 542 MPDYIDSAKLVDQIMRETYREIPLKIDILWLKHNAL-EATKSIRTNASTPAG---KQQAA 597

Query: 598 TLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVKSVDSFDK 653
            +  T+I  D  N+H  + N     Q   + L+L+  R    LL +  K ++S +K
Sbjct: 598 LVAATKIK-DFENQHSGRLNFQNYMQLSSLFLVLRDARNASHLLEKGKKLINSSNK 652

>Ecym_3006 Chr3 complement(11788..13965) [2178 bp, 725 aa] {ON}
           similar to Ashbya gossypii ACR023W
          Length = 725

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 3/94 (3%)

Query: 535 RSRNIPPFLNSSDVAEEVLRETYQKL--SIKDILNDSIDPIAKGYQAPSDNEAAMKGTSR 592
           +  NI P L SSD  E+ +  T  K   S    L      +     AP DNE+ M  T+R
Sbjct: 436 KKMNIKPILTSSDDDEKSVFNTVHKRKSSQAQELQSKTQNLESKNPAPKDNESTMTSTNR 495

Query: 593 KQSMSTLNTTRITFDIRNRHVSKDNEHREQQNED 626
           K S+  L + +I   I +   + D   +++Q +D
Sbjct: 496 KDSIE-LESAKIIPSIHSSVPTDDFRIKDEQTQD 528

>KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}
           Anc_1.45 YCL030C
          Length = 780

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 288 VELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLL 322
           VE+V +CI H     C +  + F  SN YAP +L+
Sbjct: 637 VEIVRKCISHSTIIKCDSYEEAFDMSNQYAPEHLI 671

>Ecym_8241 Chr8 complement(495524..499450) [3927 bp, 1308 aa] {ON}
            similar to Ashbya gossypii ACR059W
          Length = 1308

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 150  KAAEQKTEESDSKAKTHNLDK--KSRAQHNATTKYHEIMKHINSDEKNLYIEDLI----- 202
            +A EQ  EE +   +T  L K  K  A+H  TT   E +K I+       ++DLI     
Sbjct: 1160 QAQEQTKEEGELFKRTRGLIKELKKSAEHRGTTVNTESLKKISDKYDCEQLKDLIFHLDV 1219

Query: 203  TKLYEDLNNYSECLIPMDS 221
             KL E L+      IP+DS
Sbjct: 1220 NKLLESLDTLEARGIPVDS 1238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,647,129
Number of extensions: 3361400
Number of successful extensions: 15784
Number of sequences better than 10.0: 105
Number of HSP's gapped: 16454
Number of HSP's successfully gapped: 115
Length of query: 680
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 564
Effective length of database: 40,180,143
Effective search space: 22661600652
Effective search space used: 22661600652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)