Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR008W6.18ON98198151950.0
Kwal_56.224146.18ON96394520910.0
NCAS0D026506.18ON95094220830.0
KLTH0C11286g6.18ON95196920760.0
Suva_15.1806.18ON94894220750.0
Smik_15.1746.18ON94594420540.0
YOR005C (DNL4)6.18ON94494820520.0
KNAG0F028706.18ON95495320470.0
Kpol_1032.76.18ON96594620470.0
KAFR0A050506.18ON94894620290.0
NDAI0I022606.18ON96797320250.0
ZYRO0C07854g6.18ON94494920200.0
TDEL0G045106.18ON96997420220.0
TPHA0M002606.18ON96698919780.0
KLLA0D01089g6.18ON90794119670.0
Skud_15.1666.18ON94795619540.0
CAGL0E02695g6.18ON94696019380.0
TBLA0G010406.18ON97295719160.0
TPHA0D045707.343ON7364283112e-28
SAKL0F10912g7.343ON6934032834e-25
Kwal_56.246167.343ON7154162819e-25
Suva_4.827.343ON7554182773e-24
YDL164C (CDC9)7.343ON7554052764e-24
Smik_4.747.343ON8454042749e-24
NDAI0A019407.343ON7654042721e-23
CAGL0I03410g7.343ON7244052702e-23
Skud_4.937.343ON7554052693e-23
TDEL0C020407.343ON7054072674e-23
TBLA0E020507.343ON7204002665e-23
ACL155W7.343ON6974082603e-22
ZYRO0F11572g7.343ON7314162603e-22
KLTH0H01408g7.343ON7234162585e-22
Kpol_2001.717.343ON7264082551e-21
NCAS0A141107.343ON7534052506e-21
KNAG0C037407.343ON7274042489e-21
KLLA0D12496g7.343ON7004092424e-20
KAFR0B008307.343ON7104182424e-20
Ecym_63411.276ON767931076e-04
NCAS0A094201.276ON78499950.014
TPHA0B013201.276ON753128950.014
ZYRO0G15180g1.276ON68850920.035
AFR095C1.276ON67089900.056
AFL107W6.228ON463219840.28
KAFR0C051907.46ON89664840.33
KAFR0A014701.276ON71647820.45
KNAG0C028105.576ON330080820.49
KNAG0M011006.51ON799104810.71
Suva_8.4007.46ON98583800.78
TDEL0E053706.228ON457105790.94
TBLA0E005703.447ON596108791.0
ZYRO0E07150g6.228ON449105762.2
TDEL0D014401.276ON60332762.5
Kpol_359.63.447ON58880752.9
Kpol_367.97.46ON88069753.5
KNAG0F019006.228ON457104735.1
KNAG0B018301.276ON75241735.3
Kwal_56.241136.228ON469105735.4
KLLA0B02200g6.228ON466105725.9
Skud_10.1241.276ON76537736.4
NDAI0E039307.46ON102863727.2
YGR103W (NOP7)3.447ON605101718.8
Ecym_21886.228ON461105719.0
AAR094W3.447ON59680719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR008W
         (981 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...  2005   0.0  
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   810   0.0  
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   806   0.0  
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...   804   0.0  
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   803   0.0  
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   795   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   795   0.0  
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   793   0.0  
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...   793   0.0  
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...   786   0.0  
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...   784   0.0  
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   782   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   783   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   766   0.0  
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...   762   0.0  
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   757   0.0  
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   751   0.0  
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   742   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   124   2e-28
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   113   4e-25
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   112   9e-25
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   111   3e-24
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   110   4e-24
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   110   9e-24
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   109   1e-23
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   108   2e-23
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   108   3e-23
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   107   4e-23
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   107   5e-23
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   104   3e-22
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   104   3e-22
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   103   5e-22
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   102   1e-21
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   100   6e-21
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   100   9e-21
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...    98   4e-20
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...    98   4e-20
Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar t...    46   6e-04
NCAS0A09420 Chr1 (1869312..1871666) [2355 bp, 784 aa] {ON} Anc_1...    41   0.014
TPHA0B01320 Chr2 complement(293509..295770) [2262 bp, 753 aa] {O...    41   0.014
ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} simi...    40   0.035
AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON} S...    39   0.056
AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic ho...    37   0.28 
KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7...    37   0.33 
KAFR0A01470 Chr1 complement(291119..293269) [2151 bp, 716 aa] {O...    36   0.45 
KNAG0C02810 Chr3 (548689..558591) [9903 bp, 3300 aa] {ON} Anc_5....    36   0.49 
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....    36   0.71 
Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W ...    35   0.78 
TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {O...    35   0.94 
TBLA0E00570 Chr5 complement(110459..112249) [1791 bp, 596 aa] {O...    35   1.0  
ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {...    34   2.2  
TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {O...    34   2.5  
Kpol_359.6 s359 complement(5679..7445) [1767 bp, 588 aa] {ON} co...    33   2.9  
Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON} ...    33   3.5  
KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.2...    33   5.1  
KNAG0B01830 Chr2 complement(341951..344209) [2259 bp, 752 aa] {O...    33   5.3  
Kwal_56.24113 s56 complement(855380..856789) [1410 bp, 469 aa] {...    33   5.4  
KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly...    32   5.9  
Skud_10.124 Chr10 complement(230827..233124) [2298 bp, 765 aa] {...    33   6.4  
NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7....    32   7.2  
YGR103W Chr7 (695417..697234) [1818 bp, 605 aa] {ON}  NOP7Compon...    32   8.8  
Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar t...    32   9.0  
AAR094W Chr1 (513366..515156) [1791 bp, 596 aa] {ON} Syntenic ho...    32   9.9  

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 2005 bits (5195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 968/981 (98%), Positives = 968/981 (98%)

Query: 1   MVIYPWLKNTTELTIALPKKPIIHANMDVLGSPRGGTPTGEHEINAQDGSPINFSPSPDF 60
           MVIYPWLKNTTELTIALPKKPIIHANMDVLGSPRGGTPTGEHEINAQDGSPINFSPSPDF
Sbjct: 1   MVIYPWLKNTTELTIALPKKPIIHANMDVLGSPRGGTPTGEHEINAQDGSPINFSPSPDF 60

Query: 61  CWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPALVLSLPYND 120
           CWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPALVLSLPYND
Sbjct: 61  CWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPALVLSLPYND 120

Query: 121 RRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEELQKRRREPV 180
           RRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEELQKRRREPV
Sbjct: 121 RRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEELQKRRREPV 180

Query: 181 VPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELRFFFDIVLKVP 240
           VPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELRFFFDIVLKVP
Sbjct: 181 VPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELRFFFDIVLKVP 240

Query: 241 IVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRIGYAFAPHMAQ 300
           IVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRIGYAFAPHMAQ
Sbjct: 241 IVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRIGYAFAPHMAQ 300

Query: 301 RVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYTYLYGENSSKG 360
           RVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYTYLYGENSSKG
Sbjct: 301 RVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYTYLYGENSSKG 360

Query: 361 SISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETTGHTEPTYRPL 420
           SISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETTGHTEPTYRPL
Sbjct: 361 SISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETTGHTEPTYRPL 420

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEAITAALGAAVA 480
           YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEAITAALGAAVA
Sbjct: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEAITAALGAAVA 480

Query: 481 HGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGRKDSFICALAV 540
           HGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGRKDSFICALAV
Sbjct: 481 HGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGRKDSFICALAV 540

Query: 541 TDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNW 600
           TDDSEKNNP             EPIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNW
Sbjct: 541 TDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNW 600

Query: 601 FPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYC 660
           FPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYC
Sbjct: 601 FPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYC 660

Query: 661 KRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDIDVTKP 720
           KRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDIDVTKP
Sbjct: 661 KRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDIDVTKP 720

Query: 721 SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGC 780
           SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGC
Sbjct: 721 SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGC 780

Query: 781 KDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGES 840
           KDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGES
Sbjct: 781 KDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGES 840

Query: 841 YQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDI 900
           YQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDI
Sbjct: 841 YQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDI 900

Query: 901 VKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTS 960
           VKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTS
Sbjct: 901 VKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTS 960

Query: 961 EWVEACMEAQYLVDEDEYAAI 981
           EWVEACMEAQYLVDEDEYAAI
Sbjct: 961 EWVEACMEAQYLVDEDEYAAI 981

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/945 (43%), Positives = 595/945 (62%), Gaps = 31/945 (3%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYP 110
           P NF+PSPDF WLCDELF KLEE+   ++ LGK   V+ +E+   F+ LWR TVG++IYP
Sbjct: 36  PQNFAPSPDFRWLCDELFSKLEEITEDRQKLGKAVTVKRVEVIMYFIKLWRTTVGDNIYP 95

Query: 111 ALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVE 170
            L L LPY D R+Y +KD TLVKA+C+ + LP++S TE+RLL+WKQ APRG  LS FCVE
Sbjct: 96  VLRLILPYRDSRAYNIKDYTLVKAVCRSLNLPKDSLTEKRLLNWKQYAPRGTSLSKFCVE 155

Query: 171 ELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELR 230
           E+ KRR+EP   +R++ID +N  LD+L  E++  KW +  L++SP+F  CL++MS+ E R
Sbjct: 156 EIMKRRKEPQGSQRLTIDALNKCLDELSKEASAKKWGFNGLSKSPSFQNCLQNMSFSEQR 215

Query: 231 FFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRI 290
           +FFDI+LK  ++ GLE   L+CWHPDA+ Y  VVSDL++++ TL++P  RL KN+LS+ I
Sbjct: 216 YFFDIILKTRVIGGLEHKFLNCWHPDAQDYLGVVSDLKVLSETLWNPTMRLGKNELSINI 275

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           G AFAPH+A+R+ + YE+V  KL  DF +EEKMDG+RIQ+HY++ G  I + SR G ++T
Sbjct: 276 GRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERIQLHYIERGAKIRFLSRRGTDFT 335

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
           +LYG++   G IS HLKF   V++C+LDGEMVS+DKE   +LPFG+ KS A  ++    T
Sbjct: 336 HLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDT 395

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
                 YRPLY +FDL+YLNG  LT   +  RK YL  IL P  N+V +LS  R S+  A
Sbjct: 396 KVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRSILSPVANIVEILSDVRASEPNA 455

Query: 471 ITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGR 530
           I  +L  A+  GSEGI+LK+  S Y +G R+DSWIKIKPEY E  GE MDLVVIGRD G+
Sbjct: 456 IKVSLERAIEMGSEGIILKQFSSPYEIGARNDSWIKIKPEYFEELGETMDLVVIGRDPGK 515

Query: 531 KDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGISNEEFK 590
           KDS +C L + D+++ ++              +P+  + +  K ISFC+IANG+S+ EFK
Sbjct: 516 KDSLMCGLILADETDGSS-------VNLASQDDPLRPKQRNPKVISFCNIANGVSDAEFK 568

Query: 591 EIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYK 650
           EI+R TRG W       PP+  +EFGTK P EWIDP++S+VLEVKARS+D +E  S  YK
Sbjct: 569 EIERKTRGLWNLTTACPPPSGLLEFGTKLPTEWIDPRSSLVLEVKARSVDTDELSSKKYK 628

Query: 651 TGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRRTFH 710
           TGSTL  AYC+ +R +K+WST +TV +Y+ A+ A +Y       K    + SPRK+R   
Sbjct: 629 TGSTLRGAYCRALRFNKDWSTCATVQQYEQAKRAHNY----HKGKRKSHQISPRKQRKLA 684

Query: 711 LVGDI-----DVTKPS--KADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI 763
            V ++     D ++ S  +++  +G  FY+ S Y D Q KK  +  +IG  V    G  +
Sbjct: 685 NVSELYPLLADDSRESIFESNIFQGLQFYILSDYIDSQ-KKRYEKDQIGTLVRKNSGHVL 743

Query: 764 HNLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSA 822
           HN  + R    +L I+  K+T E + L E+GYDIIHP W+ DC+ YG+++++EP++ +  
Sbjct: 744 HNNFVRREEFSRLRIISGKNTVECRSLTEKGYDIIHPSWIFDCLNYGSLVKLEPRHCFRT 803

Query: 823 SEELMKQARNQEDKYGESYQLPVTEDTLKALANKQ--VEEGYASEMGTDAVSEYERLLIF 880
           S +L++ +R + D++G+S+  P++      L N Q  V    ++    D +     L +F
Sbjct: 804 SRKLLENSRQRVDRFGDSFCRPLSYTEFDELVNGQSVVSPHLSAPEELDGIP----LFLF 859

Query: 881 KGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSL----QA 936
           + +  Y            + ++  +   GGE +  L+   +VV       Q  L    + 
Sbjct: 860 QNFKIY-FARVGNDPDQEEYLEKTLRLFGGERSLTLDCCNLVVVRVSFKEQKKLFKLVEG 918

Query: 937 VRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
           +R  I +    S     IP +V+S W+EAC+  Q LV E+++  +
Sbjct: 919 LRKRIASTAYSSEVDHRIPHLVSSNWLEACINEQCLVPEEDFPPL 963

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/942 (44%), Positives = 579/942 (61%), Gaps = 17/942 (1%)

Query: 50  SPINFSPSPDFCWLCDELFIKLEEVALKK--KDLGKPRKVRNLEITSNFVSLWRKTVGND 107
           +P NFSPSP F WLCDELF+KLE++  K+  K++GKP  VR  E+ ++F++LWRKTVGND
Sbjct: 16  TPCNFSPSPAFQWLCDELFVKLEDIQSKRDPKNIGKPVTVRYYEVINHFIALWRKTVGND 75

Query: 108 IYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTF 167
           I+PAL+L LPY DRR + ++D TL+KA+C ++KLPRNS TE+RLL WK  A +GVKLS F
Sbjct: 76  IFPALILILPYRDRRLFNIRDYTLIKAICAYLKLPRNSFTEKRLLSWKARAGKGVKLSQF 135

Query: 168 CVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYV 227
           CV E++KR+ EP     ++ID +N  LDKL  E N     +  LA+SP F +CLE+MS++
Sbjct: 136 CVNEIKKRKSEPKDKIEITIDRLNECLDKLAEERNSKGRGFKKLADSPTFKFCLENMSFI 195

Query: 228 ELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLS 287
           EL+FFFDI+LK  ++ G E   L+ WHPDA+ Y  VVSDLR V   L+DP  RL+ NDL 
Sbjct: 196 ELQFFFDILLKNRVIGGQEHKFLNAWHPDAQDYLSVVSDLRTVTTRLWDPEIRLQNNDLV 255

Query: 288 VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI 347
           +  G+AFAP +A+++ I YEK+  KL NDF +EEKMDG+RIQ+HY DYG  + +FSR G 
Sbjct: 256 INPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRGT 315

Query: 348 NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF 407
           +YTYLYGE+   G I  HLK  + VK+CILDGEM++YDK    ILPFGL KS A   +  
Sbjct: 316 DYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT- 374

Query: 408 ETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467
              G     Y+PL+ VFDL+++NG  L N  +  RKEYL  I  P  +++ LLS     +
Sbjct: 375 -KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433

Query: 468 AEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
            ++I  +L  A++ GSEGIVLK+  S+Y+V  R+D WIK+KPEYLE FGENMDL+VIGRD
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMDLIVIGRD 493

Query: 528 KGRKDSFICALAVTDDSEK---NNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGI 584
            G+KDS +C LAV ++ EK   N                P+  +  I KF+SFC IANG+
Sbjct: 494 PGKKDSLMCGLAVVEEDEKADLNENNDDNVIILDDDEDAPVEQERTIHKFVSFCVIANGL 553

Query: 585 SNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEES 644
           S EEFK+IDR TRG W   DE  PP   ++FGT+ P EWIDPK SVV+EVKARSID  ES
Sbjct: 554 SQEEFKQIDRKTRGLWNRSDEIPPPDTLLQFGTRLPIEWIDPKKSVVIEVKARSIDAAES 613

Query: 645 KSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPR 704
               + TG TLY  YC+ IR DK+W T  T++E+   +  +S  N S     G  R   +
Sbjct: 614 NGRKFATGCTLYGGYCRGIREDKDWQTCYTLSEFLRTKNVKSRRNGSDQVIHGVKRQK-K 672

Query: 705 KRRTFHLVGDIDVTKP--SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTY 762
            RR + L   ++          F +  YFYV S  FD      I+   + + +   GGT 
Sbjct: 673 NRRKYILDQSLEEEGGLLKNTAFFRNLYFYVISDVFDDVLGTRIEKERMYKYIQEGGGTL 732

Query: 763 IHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYS 821
           IHN+  +      L I+  K T E   LIERGYD+I+P+W++DCV+  ++L++EPKY ++
Sbjct: 733 IHNIISKQFGTRNLRIISGKLTNECSALIERGYDVINPQWIVDCVQSKSLLKLEPKYCFN 792

Query: 822 ASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFK 881
            S EL K    + D +G+SY++P+TE+ L  L   + E       G       E L+   
Sbjct: 793 VSTELKKLTEKRVDTFGDSYEVPITEEQLSTLL--ETELNLVRVQGLVTPYADEELIKIP 850

Query: 882 GWLFY--ILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAVRN 939
            +LF   I+      S     ++  I+  GG++T D+    +++      +Q  LQ  R+
Sbjct: 851 LFLFQDRIMLFPNTESKTISFLQEKIKLYGGKLTTDIGKCNLIILPNG--NQQLLQRTRD 908

Query: 940 NIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
            +   I  S +V  IP IV   W+E  +E    V E++Y  I
Sbjct: 909 LLTKNIMNSGEVPTIPYIVNPLWIERSIEENSQVPEEDYPVI 950

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score =  804 bits (2076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/969 (42%), Positives = 608/969 (62%), Gaps = 44/969 (4%)

Query: 35  GGTPTGEHEINAQDGSPINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITS 94
           G  P+        +  P NF+PSPDF WLC+ELF +L+ +   +++LGK   V+ +EI +
Sbjct: 5   GKCPSETDTSKISENEPHNFAPSPDFRWLCEELFHRLDAINEHRQELGKAVTVKRVEIIT 64

Query: 95  NFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHW 154
            F+ LWR TVG+D +PAL L  PY D R+Y +KD TL+KA+CK + L R+S TERRLL+W
Sbjct: 65  CFIKLWRTTVGDDFFPALRLMFPYRDPRAYHIKDFTLIKAVCKALNLSRDSLTERRLLNW 124

Query: 155 KQNAPRGVKLSTFCVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGK-WSYISLAE 213
           KQ A RG  LS FCV+E+ KRR+EP+  ++++ID +N  LD+L  E++  K W    L+E
Sbjct: 125 KQYAGRGTSLSKFCVQEISKRRKEPLPERQLTIDGLNEKLDELAKEASGKKAWGTTGLSE 184

Query: 214 SPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHT 273
           S +F +CL+++S++ELR+FFDIVLK  ++ GLE   L+CWHPDA+ Y  VV+DL+I++  
Sbjct: 185 SHSFQFCLKNLSFLELRYFFDIVLKNRVIGGLEHKFLACWHPDAQIYLGVVTDLKILSKK 244

Query: 274 LYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYM 333
           L++P+ RL+K DLS+ IG+AFAPH+A+R+ + YE++ +KL +DF +EEKMDG+RIQ+HY+
Sbjct: 245 LWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYV 304

Query: 334 DYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILP 393
           + G+ + + SR GI++++LYG+  ++G IS +LK    V++C+LDGEMVSYDK+ + ILP
Sbjct: 305 NGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILP 364

Query: 394 FGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPS 453
           FG+ KS A  ++     G+    YRPLY VFDL+YLNG  LT   +  RKEYL++IL P 
Sbjct: 365 FGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPV 424

Query: 454 KNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLE 513
            +VV +L G R  DA+AI   +  A+  GSEG+++K+A S Y VG R+D W+KIKPEY E
Sbjct: 425 PDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVKQASSTYEVGARNDHWVKIKPEYFE 484

Query: 514 NFGENMDLVVIGRDKGRKDSFICALAVTDDS---EKNNPXXXXXXXXXXXXXEPIIVQPK 570
           + GE MDLVVIGRD G+KDS +C L V+D     E   P             +PII    
Sbjct: 485 DLGETMDLVVIGRDPGKKDSLMCGLLVSDSEHILENFGP------IEHGKEGDPII---- 534

Query: 571 IEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSV 630
             K +SFC++ANG+S+EEFKEI+R TRG+W  Y E+ PP   +EFG+K P EWIDPKNSV
Sbjct: 535 --KCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKIPVEWIDPKNSV 592

Query: 631 VLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNV 690
           V+EVKARS++N E  S  Y+ GSTL++AYC+RIR+DK+W+T ++VA+Y  A+ A +Y   
Sbjct: 593 VIEVKARSVENSEYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVAQYQQAKAAHNYHRY 652

Query: 691 SQNAKFGKDRSSPRKRRTFHLV---------GDIDVTKPSKADFLKGYYFYVTSGYFDLQ 741
            +       + SPR++R  H +          ++D    S     +G +FY+ S Y   Q
Sbjct: 653 KRKVH----QVSPRRKRNVHEIFEYCAGEAKSELDTEGSS---IFEGLHFYILSDYVTSQ 705

Query: 742 SKKNIDASEIGEAVVSCGGTYIHNLRIRAS-LDKLYILGCKDTRELKMLIERGYDIIHPE 800
            ++  +   +   VV  GG  + N+ +R   L  L I+  K T E + L+ RGYDII P 
Sbjct: 706 -RRRYERGMVAAKVVKHGGLIVKNIDMRPEHLSYLRIVSGKTTIECRNLVNRGYDIIDPC 764

Query: 801 WLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKAL-----AN 855
           W+ DC+  G  L IEPK+ +  S  L+  +R + D+YG+S+  P+     + L     ++
Sbjct: 765 WIFDCISAGFQLGIEPKHCFQTSRRLLDNSRQRVDQYGDSFSRPLDTTEFQQLFKFFCSS 824

Query: 856 KQVEEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTND 915
                   S M  D + E   L + + +  Y+L        +S I++  IE  GG V+  
Sbjct: 825 PSDFSSRISSMLQDDLDEAP-LFLLQRFKIYVLAADLIPQQFS-ILRRKIELYGGVVSET 882

Query: 916 LELATIVV---AVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYL 972
           LE A +V+   A+    +   +Q +R  I       N    IP IV SEW++ C   Q L
Sbjct: 883 LEGANLVLVPSALSTARTAYYVQELRQKIAGNAFAGNTNTRIPHIVRSEWLDTCTTEQCL 942

Query: 973 VDEDEYAAI 981
           V E+++++I
Sbjct: 943 VPEEDFSSI 951

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/942 (44%), Positives = 584/942 (61%), Gaps = 23/942 (2%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALK-KKDLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109
           P NF+PSPDF WLC+ELF K+EEV +      GK    R  EI SNF  LWRKTVGN+IY
Sbjct: 11  PHNFAPSPDFRWLCEELFAKVEEVLINGTAGTGKSVSFRYYEIISNFTELWRKTVGNNIY 70

Query: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169
           PAL+L+LPY DRR Y +KD  L++ +C ++KLP+NS TE+RL  WKQ   +G  LS+  V
Sbjct: 71  PALILALPYRDRRIYNIKDYVLIRTVCSYLKLPKNSPTEQRLKDWKQRVGKGRSLSSLLV 130

Query: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229
           EE+ KRR EP   K +++D VN  LD+L  E N     + +L +S  F +CLE+M++VEL
Sbjct: 131 EEISKRRTEPT-RKSITVDSVNFYLDELSKEMNASGRGFKNLVKSKPFLHCLENMTFVEL 189

Query: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289
           +FFFDI+LK  ++ G E  LL+CWHPDA+ Y  VVSDLR+V   LYDP+ RL+ +DLS++
Sbjct: 190 KFFFDILLKNRVIGGQEHKLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIK 249

Query: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349
           +G+AFAP +A++V + YEK+   L NDF+VEEKMDG+RIQVHYM+YG SI +FSR GI+Y
Sbjct: 250 VGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDY 309

Query: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409
           TYLYG N   G+IS +LKF + VKEC+LDGEMV++D   + ILPFGL K  A   ++F  
Sbjct: 310 TYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFND 369

Query: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469
             + +  + PLY VFDLLYLNG  LT   + +RKEYL  ILIPSK+VV ++   RC DAE
Sbjct: 370 INNND--FHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAE 427

Query: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529
           ++  +L  A++ GSEG+VLK   S Y+V  R+++WIK+KPEYLE FGEN+DL++IGRD G
Sbjct: 428 SVKKSLEVAISLGSEGVVLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIIIGRDSG 487

Query: 530 RKDSFICALAVTDDSEKNNPXXXX-XXXXXXXXXEPIIVQPK--IEKFISFCSIANGISN 586
           +KDSF+  L V D+ E                  E     PK  + K +SFCSIANGIS 
Sbjct: 488 KKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSIANGISQ 547

Query: 587 EEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKS 646
           EEFKEIDR TRG+W       PP   +EFG+K P EWI+P  S+VLE+K+RS+DN E+  
Sbjct: 548 EEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLDNTETNM 607

Query: 647 DLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKR 706
             Y T  TLY  YC+RIR+DK+W+   T+ E    R  +S  N S   +  + +  P+KR
Sbjct: 608 QKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKS--NPSHQVENLQLQLVPKKR 665

Query: 707 RTFHLVGDIDVTKPSK--ADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIH 764
           +   +      ++  K  +    G +FYV S Y +  +   I  SE+ + +V  GG  IH
Sbjct: 666 KRALVSDPFQQSREQKPISGVFAGLFFYVLSDYINSVTGVRITRSELNDVIVKHGGKLIH 725

Query: 765 NLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSAS 823
           N+ + R  +  + ++GCK TRE + LI+RGYDI+HP W+MDC  Y  +L IEP Y +S S
Sbjct: 726 NVILKRHCIGDVRLIGCKLTRECRALIDRGYDILHPRWIMDCTAYNKLLPIEPSYCFSVS 785

Query: 824 EELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGW 883
            +L   AR + D +G+S++  ++E  L +L   Q +     +       +   L +F   
Sbjct: 786 GKLRAVARRRVDCFGDSFENDISESKLSSLQKSQPDLLSTRQADKSFELQIIPLFLFSNR 845

Query: 884 LFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAV-------KDCFSQLSLQA 936
           + YI            +++  I   GG++T+   L+ +++          DC  ++  Q 
Sbjct: 846 IVYIPRS-KIGPKDEMLLEMKIRLFGGKITDQQSLSNLIIIPYADPIWRGDCLEEVHSQI 904

Query: 937 VRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEY 978
              N   + + S+ V  IP+IVT EWV+  +     V E+++
Sbjct: 905 ---NEHVKASNSDTVPRIPRIVTPEWVDHSISENCQVPEEDF 943

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/944 (43%), Positives = 582/944 (61%), Gaps = 24/944 (2%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALKKK-DLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109
           P NF+PSPDF WLC+ELF K++EV +K     GK R  +  E+ SNFV +WRKTVGN+IY
Sbjct: 11  PQNFAPSPDFKWLCEELFSKIDEVQVKGTIGTGKSRSFKYYEVLSNFVEMWRKTVGNNIY 70

Query: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169
           PAL+L+LPY DRR Y +KD  L++ +C ++KLP+NS TE RL  WKQ   +G  LS+  V
Sbjct: 71  PALILALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEGRLKDWKQRVGKGKNLSSLLV 130

Query: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229
           EE+ KRR EP   K ++ID +N  LD+L  + +     + +L +S  F +CLE MS+VEL
Sbjct: 131 EEIAKRRSEPN-GKAITIDGINSTLDELSKDRSTSGRGFKNLVKSSPFLHCLESMSFVEL 189

Query: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289
           ++FFDI+LK  ++ G E   LSCWHPDA+ Y  VVSDL++VA  LYDP  RL+ +DL+++
Sbjct: 190 KYFFDILLKSRVIGGQEHKFLSCWHPDAQDYLSVVSDLKVVASKLYDPRVRLKNDDLTIK 249

Query: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349
           +G+AFAP +A++V +PYEK+   L NDF VEEKMDG+RIQVHYM+YG S+ ++SR GI+Y
Sbjct: 250 VGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDY 309

Query: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409
           TYLYG + S G+IS+HL F + V+EC+LDGEMV++D   + ILPFGL K  A   ++F +
Sbjct: 310 TYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNS 369

Query: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469
             + +  + PLY VFDLLYLNG  LT   + +RKEYLE IL P KNVV ++   RC + E
Sbjct: 370 INNVD--FHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVE 427

Query: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529
           +I  +L  A++ GSEG+VLK   S Y+V  R+++WIK+KPEYLE FGEN+DLV+IGRD G
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLVIIGRDPG 487

Query: 530 RKDSFICALAVTDDSE--KNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGISNE 587
           +KDSF+  L + ++ E  K +                +  Q K++K +SFCS+ANGIS E
Sbjct: 488 KKDSFMLGLLLLNEKEMDKRDQEVSSGIANNSKNENILYSQKKVKKILSFCSVANGISQE 547

Query: 588 EFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSD 647
           EFKEIDR TRG W    E  PP    EFG+K P EWI+P  S+VLE+K+RS+DN E+   
Sbjct: 548 EFKEIDRKTRGCWKKTSEVAPPASIFEFGSKIPAEWIEPNESIVLEIKSRSLDNTETNMQ 607

Query: 648 LYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRR 707
            Y T  TLY  YCKRIR DK+W+   T+ E   +R AR  FN S  A+    +   +KRR
Sbjct: 608 KYATSCTLYGGYCKRIRFDKDWTDCFTLNELYDSRSAR--FNPSYQAEKSHLKLVRKKRR 665

Query: 708 TFHLVGDID--VTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHN 765
                   D    +   +    G YFYV S Y    S+  I   E+  A+V  GG  I+N
Sbjct: 666 EVLTSNTFDQKTEQIPTSIIFAGLYFYVLSDYVTNASEVRITRGELENAIVRHGGRLIYN 725

Query: 766 LRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASE 824
           + + R  +  + ++ CK+T E + LI RGYDI+HP W++DCV Y  ++ IEP Y ++ S+
Sbjct: 726 IILKRHYIGDVRLISCKNTTECRALINRGYDILHPSWVIDCVAYKKLIPIEPCYCFNVSQ 785

Query: 825 ELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKGWL 884
           ++   A  + D  G+S++  ++E  L  L   Q       E+  DA  +   L +F   +
Sbjct: 786 KMRAVAEKRVDCLGDSFENDISETKLSLLYKSQHNLPPPEEVERDAEVQVFPLFLFSNRI 845

Query: 885 FYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAV-------KDCFSQLSLQAV 937
            YI         +   ++  I   GG++T+   L  +V+         KDC  +++ Q  
Sbjct: 846 VYI-PPRKIGMKYEKTLEMKIRLFGGKITDRQSLCNLVIIPYGDPTWRKDCIKEVNEQ-- 902

Query: 938 RNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
              I  ++   + +  IP+IV  EWV+  +     V E+++  +
Sbjct: 903 ---IKEQVKALDTIPKIPRIVAPEWVDHSIYGNCQVPEEDFPVV 943

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/948 (43%), Positives = 587/948 (61%), Gaps = 33/948 (3%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALK-KKDLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109
           P NF+PSPDF WLC+ELF+K+ EV +      GK R  +  EI SNFV +WRKTVGN+IY
Sbjct: 11  PQNFAPSPDFKWLCEELFVKIHEVQINGTAGTGKSRSFKYYEIISNFVEMWRKTVGNNIY 70

Query: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169
           PALVL+LPY DRR Y +KD  L++ +C ++KLP+NS TE+RL  WKQ   +G  LS+  V
Sbjct: 71  PALVLALPYRDRRIYNIKDYVLIRTICSYLKLPKNSATEQRLKDWKQRVGKGGNLSSLLV 130

Query: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229
           EE+ KRR EP   K ++ID VN  LD L  +       + SL +S  F +C+E+MS+VEL
Sbjct: 131 EEIAKRRAEPS-SKAITIDNVNHYLDSLSGDRFASGRGFKSLVKSKPFLHCVENMSFVEL 189

Query: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289
           ++FFDIVLK  ++ G E  LL+CWHPDA+ Y  V+SDL++V   LYDP  RL+ +DLS++
Sbjct: 190 KYFFDIVLKNRVIGGQEHKLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIK 249

Query: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349
           +G+AFAP +A++V + YEK+   L +DF VEEKMDG+RIQVHYM+YG SI +FSR GI+Y
Sbjct: 250 VGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDY 309

Query: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409
           TYLYG + S G+IS HL+F + VKEC+LDGEMV++D + + ILPFGL K  A   ++F +
Sbjct: 310 TYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNS 369

Query: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469
             + +  + PLY VFDLLYLNG  LT   + +RK+YL  IL P KN+V ++   RC   E
Sbjct: 370 INNVD--FHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVE 427

Query: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529
           +I  +L  A++ GSEG+VLK   S Y+V  R+++WIK+KPEYLE FGEN+DL+VIGRD G
Sbjct: 428 SIKKSLEVAISLGSEGVVLKYYNSSYNVASRNNNWIKVKPEYLEEFGENLDLIVIGRDSG 487

Query: 530 RKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPII--VQPKIEKFISFCSIANGISNE 587
           +KDSF+  L V D+ E                 E  I   + +++K +SFCSIANGIS E
Sbjct: 488 KKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQE 547

Query: 588 EFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSD 647
           EFKEIDR TRG+W    E  PP   +EFG+K P EWIDP  S+VLE+K+RS+DN E+   
Sbjct: 548 EFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNTETNMQ 607

Query: 648 LYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSS---PR 704
            Y T  TLY  YCKRIR+DK W+   T+ +   +R  +S      N  +  +RS     R
Sbjct: 608 KYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKS------NPSYQAERSQLGLIR 661

Query: 705 KRRTFHLVGDI---DVTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGT 761
           K+R   L+ D    +  +   ++   G  FYV S Y    +   I  +E+ + +V  GG 
Sbjct: 662 KKRKRVLISDSFHQNRKQLPISNIFAGLLFYVLSDYVTEDTGIRITRAELEKTIVEHGGK 721

Query: 762 YIHNLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVY 820
            I+N+ + R S+  + ++ CK T E K LI+RGYDI+HP W++DC+ Y  ++ IEP Y +
Sbjct: 722 LIYNVILKRHSIGDVRLISCKTTTECKALIDRGYDILHPNWVLDCIAYKRLILIEPNYCF 781

Query: 821 SASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIF 880
           + S+++   A  + D  G+S++  ++E  L +L   Q+      E+  D+      L +F
Sbjct: 782 NVSQKMRAVAEKRVDCLGDSFENDISETKLSSLYKSQLSLPPMGELEIDSEVRRFPLFLF 841

Query: 881 KGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVA-------VKDCFSQLS 933
              + Y+       S+  DI++  I+  GG++T+   L  +++         KDC ++  
Sbjct: 842 SNRIAYVPRRKI--STEDDIIEMKIKLFGGKITDQQSLCNLIIIPYTDPILRKDCMNE-- 897

Query: 934 LQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
              V   I  +I  S+ +  I ++V  EWV+  +     V E+++  +
Sbjct: 898 ---VHEKIKEQIKASDTIPKIARVVAPEWVDHSINENCQVPEEDFPVV 942

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/953 (43%), Positives = 607/953 (63%), Gaps = 30/953 (3%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLG-KPRKVRNLEITSNFVSLWRKTVGNDIY 109
           P NF+PSPDF WLCDELF+K + VA + + +  KP  VR  E+ SNFV LWRKTVGN+ Y
Sbjct: 9   PTNFAPSPDFQWLCDELFVKFDLVATQDRRINLKPITVRYYEVVSNFVQLWRKTVGNNFY 68

Query: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169
           P L+L+LPY DRR+Y +KDVTL+KA+C ++ LP+ S TE++LL+WKQ A R  +LS+FCV
Sbjct: 69  PVLILALPYRDRRTYNIKDVTLIKAICLYLDLPKRSSTEKKLLNWKQRASRNERLSSFCV 128

Query: 170 EELQKRRREPVVPKRMSI--DEVNGMLDKLEH-ESNVGKWSYISLAESPAFNYCLEHMSY 226
            E++KR+  P   KR +I  D++N +LD L + +S+ G+ S  +LA+S  F +CLE+MS+
Sbjct: 129 AEIRKRKSGPDPSKRQAITLDKLNSILDDLANGKSSRGQGSR-TLADSSHFKFCLENMSF 187

Query: 227 VELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDL 286
           +EL++FFDI+LKV I+ G E  LL+ WHPDA  YF VVSDL  V   LY+P+ RL   DL
Sbjct: 188 IELKYFFDILLKVRIIGGHEHKLLNAWHPDAVDYFSVVSDLSSVTKKLYEPSVRLRNEDL 247

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           +++IG AFAPH+A+R+ I YEK+  KLG+DF +EEKMDG+RIQ+HYMDYGN I + SR G
Sbjct: 248 TLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGERIQIHYMDYGNEIKFLSRRG 307

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            +YTYLYG ++S G+I+ +LK  E VKECILDGEMV+YD+E Q ILPFGL KS A + ++
Sbjct: 308 TDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQEKQMILPFGLVKSSAKNFLS 367

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
            E+  +   +Y PL+  FDL+YLNG  L +  + +RK+YL KIL      V ++S  RC+
Sbjct: 368 KESISNG--SYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSKILTKCNGFVDIVSFARCN 425

Query: 467 DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGR 526
           + E+IT +L AA++ GSEGI+LKK  S+Y V  R+DSWIKIKP+YL+ FGENMDL++IGR
Sbjct: 426 NLESITKSLAAAISVGSEGIILKKLNSRYMVASRNDSWIKIKPQYLKQFGENMDLIIIGR 485

Query: 527 DKGRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQP------KIEKFISFCSI 580
           D G+KD+F+CAL VT D  +  P             +    +P      +I KF+SFC+I
Sbjct: 486 DPGKKDAFMCALGVTIDDPQ--PRVLQQEENVNLDLDTEDSEPETPKASRIVKFVSFCTI 543

Query: 581 ANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640
           ANGISN EFKEID+ TRG W  +D+ KPP+++++FGTK P EWIDPK S+VLEVK+RS+D
Sbjct: 544 ANGISNAEFKEIDQKTRGLWRRFDQVKPPSEYLQFGTKKPVEWIDPKESLVLEVKSRSLD 603

Query: 641 NEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDR 700
           N ES    Y+ G TL+  YC+ +R+DK+W+T  TV+E++  R+ +    V+         
Sbjct: 604 NTESNVKKYRAGVTLFGGYCRAVRYDKDWTTCYTVSEFERDRQYK-LPKVNAGESITTSN 662

Query: 701 SSPRKRRTFHLVGDIDVTKP-----SKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAV 755
              +KR T  ++G I   K        +D  +  +F V S Y D  +   ID + + + +
Sbjct: 663 KGRKKRNTTSILGVISPRKKRTPEGEHSDIFQNLHFCVLSDYLDPYTGNRIDRNTLTQLI 722

Query: 756 VSCGGTYIHNLRIRASLDKLYILGCKD-TRELKMLIERGYDIIHPEWLMDCVKYGTMLQI 814
           +  GG  I+N+  +   + +  + C     E   LI+RGYDI+ P W++DC++   +L++
Sbjct: 723 IDYGGKVIYNVLAKEGEEGMLRIICDGFNMECNALIKRGYDILSPSWVLDCIESARLLKL 782

Query: 815 EPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEY 874
           E  + ++ S+ELM+ +  + D+Y +S++  ++   L  L +  +    +     + + ++
Sbjct: 783 ERNHCFNVSKELMELSSTRVDEYDDSFENEISTTRLDRLIDVHLHNMPSGSFSGENL-DF 841

Query: 875 ERLLIFKGWLFYILDDYAYHSSWSDIVKWNIES----CGGEVTNDLELATIVVA--VKDC 928
           E L      LF+    +   +  SD +   I S     GG+VT+ +E   +++     D 
Sbjct: 842 E-LRGLPPLLFFDRSVFIAETKLSDRIYAKISSETKLFGGQVTHTIEDCNLIIIPNTDDE 900

Query: 929 FSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
                LQ +R  + + I   N  + IP IV+ EW+   ++    V E+ Y+ +
Sbjct: 901 DKIQVLQKIRGKLASMIQKLNSTERIPPIVSEEWLYQSIKENIQVPEENYSVL 953

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/946 (42%), Positives = 591/946 (62%), Gaps = 26/946 (2%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLG--KPRKVRNLEITSNFVSLWRKTVGNDI 108
           P NFSPSPDF WLCDELF+KL+++  + K+L   KP+ +   +I +NF+ +WR+TVGNDI
Sbjct: 31  PHNFSPSPDFKWLCDELFVKLDQIQFRPKELNGSKPKYIEYYDIINNFIDIWRRTVGNDI 90

Query: 109 YPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFC 168
           YPAL+L++PY DRR Y +K+  L++ +C ++KLP+NSETERRL+ WK  A R V+LSTFC
Sbjct: 91  YPALILTIPYRDRRMYNIKESKLIRIVCDYLKLPKNSETERRLMRWKHRADRNVRLSTFC 150

Query: 169 VEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVE 228
           VEE++KR+ EP    +++ID++N  LD L  E          ++ES  F +C E+M+YVE
Sbjct: 151 VEEIKKRKGEPREKIKITIDKLNECLDNLVLERGYKGSKSQKISESETFKFCFENMTYVE 210

Query: 229 LRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSV 288
           L++FFDI+LK  IV GLE   L+CWHPDA+ Y  VVSDL+IV+  L++P  RL+ +DL++
Sbjct: 211 LKYFFDILLKDKIVGGLEHKFLNCWHPDAQDYLSVVSDLKIVSSKLWNPEFRLKYDDLTI 270

Query: 289 RIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGIN 348
            I +AF P  A+R+   Y+ ++ +L NDF++EEKMDG+RIQ+HYM+YG  + + SR G++
Sbjct: 271 NIDHAFTPETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLD 330

Query: 349 YTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFE 408
           Y+YLYG+N + G+I  +L F + VKECILDGEMV+YD    CILPFGL KS A   +   
Sbjct: 331 YSYLYGDNRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSL--- 387

Query: 409 TTGHTEPT-YRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467
           +    EP  Y PLY  FDL+YLNG  L+   + +RK YL+K+LIP  + V +L    C+D
Sbjct: 388 SVSDIEPDGYHPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCND 447

Query: 468 AEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
           +  I ++L  A+  GSEGI+LK+  S+Y V KR D WIKIKPEYLE FGENMDL+VIGRD
Sbjct: 448 SSLIKSSLEKAIELGSEGIILKRFDSQYLVAKRSDDWIKIKPEYLEQFGENMDLIVIGRD 507

Query: 528 KGRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGISNE 587
            G+KDS +C L +T D+E   P                 ++P   K ISFC+IANGIS +
Sbjct: 508 PGKKDSLMCGLILTGDNE---PEEITSLDSNPTDTAESFLKPDKRKIISFCNIANGISQK 564

Query: 588 EFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSD 647
           EF++IDR T G+W  +D+  PP D  EFGTK P EWI P++SVVLE+KARS++  ES   
Sbjct: 565 EFRDIDRYTFGHWIKFDDELPPQDLFEFGTKHPIEWIYPEHSVVLEIKARSLETNESARI 624

Query: 648 LYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREAR-SYFNVSQNAKFGKDRSSPRKR 706
            Y TGSTL+  YC++IR+DK+W +  T  E+  +R  + +  N   N      +  P+KR
Sbjct: 625 KYGTGSTLFGGYCRQIRYDKDWVSCFTYNEFMESRNLKNALVNYPDNKNLIGRKKRPKKR 684

Query: 707 RTFHLVGDIDVTK--PSKADFL-KGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI 763
               L    + TK  P +++ + +G +FYV S Y D      +  S++   V+   G  +
Sbjct: 685 MFNSLTEIFENTKDAPDESNVIFRGLHFYVISDYIDETDGSRLSKSDLCNLVLEHNGKLV 744

Query: 764 HNLRIRAS-LDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSA 822
           HN   R   L++L I+  K TRE   LIERGYDIIHP+W++DC+    ++++ P + ++ 
Sbjct: 745 HNPISRIDILNRLRIISMKYTRETTSLIERGYDIIHPQWILDCISNRKLVRLLPSHCFNV 804

Query: 823 SEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYER-----L 877
           S  LM+  + + D+YG+SY+  +TE   + L N+QV     SE     ++E E      +
Sbjct: 805 SSSLMEVTKTRVDRYGDSYETSLTEKDFEILINRQV---LKSESADKRITEGENHLKIPI 861

Query: 878 LIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLS--LQ 935
           L+F    F+I +       +   +K  +E  GG++ N +    ++V            ++
Sbjct: 862 LLFCNRRFFIPETLPSTPIYE--LKSKVELYGGKLVNKISDCNVIVFTNTHTENRKEVMK 919

Query: 936 AVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
            +R  +      S  V  +P+IV + W++AC+     V E++Y A+
Sbjct: 920 KIRRALVCLDPNSMQVPVLPRIVDANWIDACISECVQVPEEDYPAV 965

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/946 (43%), Positives = 595/946 (62%), Gaps = 23/946 (2%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYP 110
           P NF+PSP F WLC+ELF KLEEV  ++    K   +R  EI +NFV+LWR TVG+DIYP
Sbjct: 11  PRNFAPSPQFKWLCEELFSKLEEVPNQRHLTTKRITLRYYEIITNFVNLWRTTVGDDIYP 70

Query: 111 ALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVE 170
           AL+L+LPY DRR Y VKD TL+KA+C ++KLP+NS TE+RLL+WKQ A R VKLS  CV 
Sbjct: 71  ALILALPYRDRRMYNVKDYTLIKAICTYLKLPKNSFTEKRLLNWKQRADRSVKLSVSCVN 130

Query: 171 ELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELR 230
           E++KR+ EPV    +++DE+N +LD L  + N+    Y +L+ES  F YC+E MS++ELR
Sbjct: 131 EMRKRKSEPVEKSPITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELR 190

Query: 231 FFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRI 290
           +FFDI+LK  ++   E  LL+ WHPDAE Y  VVSDL+ V   L++PN RL  ++LS+ I
Sbjct: 191 YFFDIILKARVIGPHEHKLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINI 250

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           GYAFAPH+A+++ I Y+K+  KL NDF++EEKMDG+RIQ+HYMDYGN I + SR G++YT
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYT 310

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
           YLYGEN S G+I+ +LK    VKEC+LDGEMV+YD++   +LPFG+ KS A + +  E  
Sbjct: 311 YLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEI 370

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
              +  Y PL  VFDL++LNG  L    + +RK+YL  +L P +  V +++  RCS+   
Sbjct: 371 SGQD--YHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428

Query: 471 ITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGR 530
           I  +L  A++ GSEGIVLK   S+Y +G R+DSWIKIKPEYLE FGENMDL+VIGRD  +
Sbjct: 429 IRKSLEHAISVGSEGIVLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAK 488

Query: 531 KDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPK----IEKFISFCSIANGISN 586
           KDSF C L V D+ E+                E     P+    I+K +SFC IANGIS 
Sbjct: 489 KDSFYCGLTVLDEEEEKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQ 548

Query: 587 EEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKS 646
            E+KEI R TRG W   +E  PP + +EFGT+ P EWI+P++SVVLE+KARS+DN ES  
Sbjct: 549 NEYKEIYRKTRGFWKKTEEVPPPPELIEFGTQVPMEWIEPEHSVVLEIKARSLDNTESSC 608

Query: 647 DLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKR 706
             +K G TLY  YC+RIR D +W ++ ++AE    R  + Y   S+     K +   +K+
Sbjct: 609 KRFKAGCTLYGGYCRRIRDDVDWKSSFSLAELRRDRRIKHYPGTSEKDTLLKSKKRRKKQ 668

Query: 707 RTFHLVGDI---DVTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI 763
               L  ++   D+   SK     G +FY+ S YFD      I   ++ + ++  GG   
Sbjct: 669 LLTPLNQNLNPRDIQTTSK--IFDGLFFYILSDYFDTNENVRISKDDLQKLLLENGGKIS 726

Query: 764 HNL-RIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSA 822
           HN+   R S   L IL  K T E  +LI+RGYDI+ P+W++DCV+   +++IEP + +S 
Sbjct: 727 HNIVSKRESKSNLRILCGKYTAECNVLIKRGYDILSPQWVIDCVENKKIVKIEPSHCFSV 786

Query: 823 SEELMKQARNQEDKYGESYQ--LPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIF 880
           S++LM  A  + DKYG+SY+  L V+  +    ++K +     S        ++E++  F
Sbjct: 787 SDDLMALAMRRVDKYGDSYESLLSVSRLSYILRSSKDISPDLLSPANMSL--DFEKVPYF 844

Query: 881 KGW---LFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQL--SLQ 935
             W    F +  ++   S    I+K  I+  GG+V  ++    IV+  K   + +  S++
Sbjct: 845 LFWRRKAFVMEHNFDKSSIRETILK--IQLYGGKVVKNISECNIVIFPKAEITVIRESMK 902

Query: 936 AVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
            +RN +   ++ S ++  +P+IV+ EW++A +E    V E++Y  +
Sbjct: 903 FIRNTLAKTVSTSVELPMLPRIVSFEWIDASIEKNVQVPEEDYVPM 948

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/973 (42%), Positives = 600/973 (61%), Gaps = 40/973 (4%)

Query: 37  TPTGEHEINAQDGSPINFSPSPDFCWLCDELFIKLEEV-----ALKKKDLGKPRKVRNLE 91
           TPT +++   +  +P NF+PSP F WLCDELF+KLE +     +   K+  KP  V+  E
Sbjct: 7   TPTLDND--TRPATPHNFAPSPSFRWLCDELFVKLERIQQASTSKASKEFQKPINVQYYE 64

Query: 92  ITSNFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRL 151
           +  +F++LWRKTVGNDIYPAL+L LPY DRR Y V+D TL+KA+C ++KLP+NS TE+RL
Sbjct: 65  VIQHFINLWRKTVGNDIYPALILILPYRDRRIYNVRDYTLIKAICSYLKLPKNSFTEKRL 124

Query: 152 LHWKQNAPRGVKLSTFCVEELQKRRREPVVPKR--MSIDEVNGMLDKLEHESNV-GKWSY 208
           L WKQ A R V+LS+F V E++KR+ EP V  R  ++ID++N  LD L  E N  G   Y
Sbjct: 125 LSWKQRAGRSVRLSSFIVSEIKKRKSEPQVGTREEITIDKLNQCLDSLSEERNSKGSMGY 184

Query: 209 ISLAESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLR 268
             L++SP F +CLE+M++VEL+FFFDI+LK  ++ G E   L+ WHPDA+ Y  VVSDL+
Sbjct: 185 RGLSDSPTFVFCLENMTFVELQFFFDIILKSRVIGGHEHKFLNVWHPDAQDYLSVVSDLK 244

Query: 269 IVAHTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRI 328
            VA+ L+DP   L+ +DL++ +G  FAP  A+++ I YEK+  KL +DF++EEKMDG+RI
Sbjct: 245 TVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERI 304

Query: 329 QVHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEM 388
           Q+HY DYGN +++ SR G +YTYLYGE+   G++S +L     V+ C+LDGEMV++DKE 
Sbjct: 305 QLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKER 364

Query: 389 QCILPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEK 448
             +LPFGL KS A   +  E  G     YRPL  VFDL+YLNG  L N  + +RK YLEK
Sbjct: 365 NALLPFGLVKSSARSIITQE--GVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEK 422

Query: 449 ILIPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIK 508
           I  P +++V LL   RCSD  +I  AL  A++ GSEG+VLK   S+Y+V  R+D WIK+K
Sbjct: 423 IFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYNSRYTVASRNDDWIKVK 482

Query: 509 PEYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEK----------NNPXXXXXXXXX 558
           PEYLE FGENMDL+VIG+D G+KDS +C LAV ++ E           N           
Sbjct: 483 PEYLEQFGENMDLIVIGKDPGKKDSLMCGLAVVEEDEPEIDEDGNEIVNLDSQDSIGEGE 542

Query: 559 XXXXEPIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTK 618
                 I  +  I++F+SFCSIANGIS EEFK I R+T+G W   DE  PP+D +EFG++
Sbjct: 543 DKEGNEIEREKTIKRFVSFCSIANGISQEEFKYIGRITKGCWKKSDEIPPPSDLLEFGSR 602

Query: 619 TPREWIDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEY 678
            P EWIDPK+S+V+EVKARS++N+E  +  +KTG TLY  YC++IR DK+W T  T++E 
Sbjct: 603 VPAEWIDPKDSIVIEVKARSLNNDEEATKKFKTGITLYGGYCRQIREDKDWKTCYTLSEL 662

Query: 679 DTAREARSYFNVSQN--AKFGKDRSSPRKRRT----FHLVGDIDVTKPSKADFLKGYYFY 732
              +  +   N   N  A    D S  RK R     F    +   T   ++    G YFY
Sbjct: 663 RRMKRFKLGSNKRANNDATHALDSSKRRKARRIDYGFEKYFEQTPTTLDQSRIFDGLYFY 722

Query: 733 VTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIR-ASLDKLYILGCKDTRELKMLIE 791
           V S   D    + +   E+ + +++ GG  +HN+  +    ++  IL  K T E + LI+
Sbjct: 723 VISDVVDATGSR-VSREELYDKILNRGGVIVHNVIAKHHGENQFRILCGKYTAECQSLID 781

Query: 792 RGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLK 851
           RGYDII P+W++DC+K   +L++EPKY ++ SEELMK A+ + D +G+S++  ++ED+  
Sbjct: 782 RGYDIIEPQWVLDCIKDDMLLKLEPKYCFNVSEELMKIAKRRVDGFGDSFEAQISEDSFS 841

Query: 852 ALANKQVE--EGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCG 909
            L  + V         +  D V      L +   +   + D A  +     +K  I   G
Sbjct: 842 RLIERNVRSLRNAPPSIQYDMVDTVPLFLFYGRTILLRIKDKALFTK----LKVQIRLYG 897

Query: 910 GEVTNDLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPI-PKIVTSEWVEACME 968
           G+ T DL    +VV  ++  +    + VR+++  ++T   D  P+ P IVT EW+++ + 
Sbjct: 898 GKTTGDLASCNLVVIQQNEIA--VAKDVRSSL-LKLTSDTDKPPVLPYIVTPEWIDSSIS 954

Query: 969 AQYLVDEDEYAAI 981
               V E+++  +
Sbjct: 955 EGCQVPEEDHPVV 967

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/949 (43%), Positives = 594/949 (62%), Gaps = 33/949 (3%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALKKKDLG--KPRKVRNLEITSNFVSLWRKTVGNDI 108
           P NF+PSPDF WLCDELF+K++ V  + +D G  K   V+  EI S FV LWRKTVG++I
Sbjct: 11  PHNFAPSPDFKWLCDELFVKIDNVQKQTRDHGAFKSLTVKYFEIISFFVKLWRKTVGDNI 70

Query: 109 YPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFC 168
           YPAL+L LPY DRR + +KD TL+KA+C  ++LP NS TE+RLL WK+ A RG+KLS FC
Sbjct: 71  YPALILILPYRDRRIFNIKDYTLIKAICSFLRLPANSVTEKRLLRWKRRAGRGIKLSDFC 130

Query: 169 VEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVE 228
           VEE+++RR EP+  +R++ID++N  LD+L  E N     + SLA+S  F YCLE+MS+ E
Sbjct: 131 VEEIRRRRSEPLNGERITIDKLNECLDQLAEERNTKGRGFKSLADSSVFKYCLENMSFTE 190

Query: 229 LRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSV 288
           ++++FDI+LK  ++ G E   L+CWHPDA  Y  VVSDL+ VA  L+DP+ RL+ +DL V
Sbjct: 191 MKYYFDIILKSRVIGGQEHKFLNCWHPDARDYLSVVSDLKTVADKLWDPSHRLKNDDLGV 250

Query: 289 RIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGIN 348
            +G  FAP +A+R+ I Y+KV+ +L +DFY+EEKMDG+RIQ+HYMDYG  + +FSR G +
Sbjct: 251 NLGLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGND 310

Query: 349 YTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFE 408
           YTYLYGE+   G+++ +L+    V+EC+LDGEM+S+D E   +LPFGL KS A   +  E
Sbjct: 311 YTYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAE 370

Query: 409 TTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDA 468
             G     YRPLY V D LYLNG  L N  +  RK+YL  IL P  + V ++    C D 
Sbjct: 371 --GILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDD 428

Query: 469 EAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDK 528
            +I ++L  A+  GSEGI+LK  +SKY +G R D+WIKIKPEYLE FGEN+DL+VIGRD 
Sbjct: 429 TSIKSSLEKAIMMGSEGIILKHFKSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488

Query: 529 GRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPK--IEKFISFCSIANGISN 586
           G+KDS +C LAV +  E+                E    +P+  ++KFISFC+IANGIS 
Sbjct: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEE---EPRKAVKKFISFCTIANGISQ 545

Query: 587 EEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKS 646
           EEFK+I+R T G W   ++ KPP   +EFG+K P EWI P++SVVLEVKARS+DN ES  
Sbjct: 546 EEFKQIERKTAGKWKNTEDHKPPK-ILEFGSKLPEEWIYPEDSVVLEVKARSLDNTESSG 604

Query: 647 DLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKR 706
             +K G TL+  YC+RIR DKNW+   T+  Y+  +E R    +S+++   K   S + R
Sbjct: 605 RKFKVGCTLHGGYCRRIREDKNWTECYTL--YELWQERRKKVPLSEDSNNQKPMKSKKIR 662

Query: 707 RTFHLVGDIDVT-----KPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGT 761
           R   +V  ++ T     +   +    G  FYV S Y   Q  + I   ++ + +   GG 
Sbjct: 663 RP-RIVSRLNQTLSCDDEAKTSSIFDGLIFYVISDYMASQDSERISKEQLCDLISGNGGK 721

Query: 762 YIHNL----RIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPK 817
              N+    R++     L I+  K T E K LIERGYDI+ P+WLMDCV  G ++ IEP+
Sbjct: 722 LTFNVISDHRVKGG---LRIISGKYTLECKALIERGYDILSPQWLMDCVNTGFLVTIEPR 778

Query: 818 YVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYER- 876
           + +S SE++ K AR + D +G+SY + +TED L+ +   +  +   S    D +S+ E  
Sbjct: 779 HCFSVSEDMEKIARTRVDHFGDSYDVEITEDRLRDILTSKEFDSDFSTGSLDVISDVEDI 838

Query: 877 -LLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQ 935
            L +F   + +I + ++Y    + ++K  +   GG++T+++    +++ V D    L  +
Sbjct: 839 PLFLFSRRIVFIPEGFSYLD--TQLLKHKVRLYGGQLTDNVNQCNLII-VPDGKINLRGR 895

Query: 936 AVRN--NIGARITGSNDVQP-IPKIVTSEWVEACMEAQYLVDEDEYAAI 981
            + +   + +      ++ P IP IV   W++  +E    V E+++ A+
Sbjct: 896 IISDLRRLLSTFAAMTELPPAIPWIVIPAWIDRSIEENIQVPEEDFLAV 944

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/974 (43%), Positives = 596/974 (61%), Gaps = 45/974 (4%)

Query: 39  TGEHEINAQ-------DGSPINFSPSPDFCWLCDELFIKLEEVALKKKD-LG-KPRKVRN 89
           T  HE++ +       + +P NF+PSPDF WLC+ELF+KLE+V  + ++ LG KP  VR 
Sbjct: 8   TSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGNKPLSVRY 67

Query: 90  LEITSNFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETER 149
            E+ S+F+ LWRKTVGN+I+PALVLSLPY DRR Y +KD TLVKA+C ++ LP+ S TE+
Sbjct: 68  YEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALPKQSATEK 127

Query: 150 RLLHWKQNAPRGVKLSTFCVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYI 209
           RLL WK+ A RGV+LS FCVEE++KR+ EP   +R++ID++N  LD L  E N  K  + 
Sbjct: 128 RLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN-AKGGFK 186

Query: 210 SLAESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRI 269
            L++SP FN+CL++MS++ELRFFFDIVLK  ++ G E  LL+CWHPDA  Y  VVSDL  
Sbjct: 187 GLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSVVSDLET 246

Query: 270 VAHTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQ 329
           VA  L+DP  RL ++DLS+ +GYAF P +A+++ I YEK+ TKL NDF +EEKMDG+RIQ
Sbjct: 247 VASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQ 306

Query: 330 VHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQ 389
           VHYMDYG  I + SR G++YT LYGEN   G+++N+L F   V++C+LDGEM+++D +  
Sbjct: 307 VHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRN 366

Query: 390 CILPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKI 449
            +LPFG+ KS A   ++  T G     +RP+  V DL+YLNG  L    + +RKE+L ++
Sbjct: 367 VVLPFGMVKSSARQALS--TEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRV 424

Query: 450 LIPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKP 509
           L P  + V +L   RCS+  AI  +L  +++ GSEGIVLK  +++Y +G R+D WIK+KP
Sbjct: 425 LKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWIKVKP 484

Query: 510 EYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEKNNPXXXXXXXXXXX------XXE 563
           EYLE FGEN+DLV+IGR  G+KDS +C LAV +  E  N                    +
Sbjct: 485 EYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEGDELD 544

Query: 564 PIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREW 623
               +  I+ FISFC IANGIS +EFKEIDR TRG W   D+R P  D + FG+K P EW
Sbjct: 545 DTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEW 604

Query: 624 IDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTARE 683
           IDPKNS++LEVKARS+DN ES    +  G TL+  YC+RIR DK+W+   + +E    R 
Sbjct: 605 IDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELWQERL 664

Query: 684 ARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDI----DVTKPSKADFLKGYYFYVTSGYFD 739
            +S   V    K    +   +KR+     G      DV   +  +  KG  FYV S Y D
Sbjct: 665 HKSSTGVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDST--NIFKGLQFYVLSDYID 722

Query: 740 LQSKKNIDASEIGEAVVSCGGTYIHNLRIR-ASLDKLYILGCKDTRELKMLIERGYDIIH 798
           +     I  SE  + ++   G  + NL  +  S  +  I+  K T E + LIERGYDI+ 
Sbjct: 723 VSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDILS 782

Query: 799 PEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALAN--- 855
           P+W++DC++   ++++EP++ ++ S ELM     + D+YG+S+  P+TE  L  L +   
Sbjct: 783 PQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDTNM 842

Query: 856 KQVEEGYASEMGT--DAVSEY---ERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGG 910
           KQ E     E  +  D V  +    R +     +F  +D Y   S      K+ +   GG
Sbjct: 843 KQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTS------KFKLH--GG 894

Query: 911 EVTNDLELATIVVAVKDC--FSQLSLQAVRNNIGARITGSNDVQP-IPKIVTSEWVEACM 967
            + +D+    +++   +       SL  +R ++  +  G ND  P IP IVT +WVE  +
Sbjct: 895 SIASDIPSCNLIIMPNENQRLGTQSLVEMRQSV-LQAMGRNDSTPSIPYIVTPDWVEKSI 953

Query: 968 EAQYLVDEDEYAAI 981
           E    V E+++  +
Sbjct: 954 EENCQVPEEDFTPV 967

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/989 (42%), Positives = 604/989 (61%), Gaps = 69/989 (6%)

Query: 37  TPTGEHEINAQDGSPINFSPSPDFCWLCDELFIKLEEVALKKKDLG-KPRKVRNLEITSN 95
           T      I+  +  P NFSPSPDF WLC+ELF+KL+EV LK K +  +P+ ++   + +N
Sbjct: 2   TSVPNMNIDTSEREPRNFSPSPDFKWLCNELFVKLDEVRLKPKSVDTRPKNIQYDIVINN 61

Query: 96  FVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWK 155
           F+ LWR TVGNDIYPAL L LPY DRR+Y +++ TL++ +C ++KL +NS TE+RL  WK
Sbjct: 62  FIHLWRVTVGNDIYPALRLILPYRDRRNYYIREHTLIRIVCDYLKLQKNSVTEQRLRRWK 121

Query: 156 QNAPRGVKLSTFCVEELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYIS----L 211
           Q A R + LS+FC++E++KR  EPV  ++++ID++N +LD L  E +  K +  S    L
Sbjct: 122 QKARRSINLSSFCIQEIKKRLSEPVSKEKITIDKLNSILDSLSMERSSSKITNGSSGKKL 181

Query: 212 AESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVA 271
           ++  +  YC E+MS++EL +FFDI++K  ++ GLE   L+ WHPDA  Y  VVS+L IV 
Sbjct: 182 SQLESIKYCFENMSFIELEYFFDILIKARLIGGLEHKFLNAWHPDANDYLSVVSELNIVT 241

Query: 272 HTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVH 331
             L++PN RL   DL++ +  AF P +A++V + YE +S ++ N F +EEKMDG+RIQ+H
Sbjct: 242 EKLWNPNFRLNSKDLTIALHNAFEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIH 301

Query: 332 YMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCI 391
           YMDYG+ I YFSR G +YTYLYG++ S  +IS +L+  E VKECILDGEMVSYDK   CI
Sbjct: 302 YMDYGHQIKYFSRRGNDYTYLYGKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCI 361

Query: 392 LPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILI 451
           LPFG+ KSGA++ +  +  G       PL+ VFD+L+LNG  LTN  + +RKEYL  IL 
Sbjct: 362 LPFGMVKSGAANSLKID--GLENDLCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILT 419

Query: 452 PSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEY 511
           P K+ + +L      D+E+I +AL AA++ GSEGIVLKK  S YSVG R++ WIK+KPEY
Sbjct: 420 PKKSHIEILKFSIAHDSESIRSALQAAISVGSEGIVLKKYDSLYSVGDRNNDWIKVKPEY 479

Query: 512 LENFGENMDLVVIGRDKGRKDSFICALAVT---------------------DDSEKNNPX 550
           LE FGEN+DL+VIGRD G+KDS +C +AV                      DDS+ N P 
Sbjct: 480 LEQFGENLDLIVIGRDPGKKDSLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIP- 538

Query: 551 XXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPT 610
                       +PI  + +I KFISFC IANGISNEEFKEIDR T G W  + +  PPT
Sbjct: 539 ----------EDKPIRTK-RITKFISFCVIANGISNEEFKEIDRKTFGCWKKFSDEAPPT 587

Query: 611 DWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWS 670
           D++EFGT+ P EWI+P +SVVLEVKARS++N E+  D +KTG TLY AYC+RIR DK+++
Sbjct: 588 DYLEFGTRLPVEWINPHDSVVLEVKARSLENNEALRDKFKTGYTLYGAYCRRIRTDKDFN 647

Query: 671 TASTVAEYDTAREARSYFNVSQNAKFGKDRSSPRKRRTFHLVGDIDVTKPSKAD------ 724
              T ++   A   +     S +  +G      +KR     V  ++ T   + D      
Sbjct: 648 DCYTFSDLVIATNKKR----SSSELYGNHSHIKKKRSRTSKVNMLNQTLSIQDDDTGFTS 703

Query: 725 -FLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLY--ILGCK 781
               G  F+V S Y D  S   +   E+   +   GG  I NL +  +L++ Y  I+ CK
Sbjct: 704 KIFDGLSFFVISDYVDSNSSFRLRIDELINIIKVNGGQLIFNL-VSQNLNEKYVRIMSCK 762

Query: 782 DTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESY 841
            T E   LI+RGYDIIHP+W++DC+    +L  EP + ++ S+ L   ++ + D  G+SY
Sbjct: 763 KTFECNELIKRGYDIIHPKWILDCIANDKLLDFEPSHCFNVSQSLSTISKQRVDLLGDSY 822

Query: 842 QLPVTEDTLKALANKQV--EEGYASEMGTDAVSEYERLLIFKGWLFYILDDYAYHSSWSD 899
           Q  +TE+ L+ L + +   E+ Y++ +  D   + E++ IF   LF     Y     +S+
Sbjct: 823 QKYITEEELELLISSKTPKEQLYSNPLQFD--QQIEKIPIF---LFSNKKAYTPKQCFSE 877

Query: 900 IV----KWNIESCGGEVTNDLELATIVVAVKDCFSQLS---LQAVRNNIGARITGSNDVQ 952
            +       I+  GG   N++    +++ + D  S+ S   + ++R  +      SN+V 
Sbjct: 878 KLLKETNLYIKLYGGTSVNNINDCNVII-IGDEHSKSSNEKISSIRKELSIHAVSSNNVI 936

Query: 953 PIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
           PIP+IV+ +W+E  +     V E+++  I
Sbjct: 937 PIPRIVSYKWIEKSIAQGTQVVEEDFPII 965

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/941 (42%), Positives = 585/941 (62%), Gaps = 51/941 (5%)

Query: 53  NFSPSPDFCWLCDELFIKLEEVALKKKDLGKPRKVRNLEITSNFVSLWRKTVGNDIYPAL 112
           NFSPSP+F WLCDEL  K+ E + KK  +GKP  VR LEI +NF+ LWR TVGN IYPAL
Sbjct: 6   NFSPSPEFKWLCDELLGKIYETSSKKHLIGKPVTVRYLEIITNFIKLWRSTVGNYIYPAL 65

Query: 113 VLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCVEEL 172
            L +P+ DRR Y VK+ TL+KALC++++LP++SETE RLL WKQ A RGVKLS FCVEE+
Sbjct: 66  RLIVPFRDRRIYNVKENTLIKALCRYLRLPKSSETENRLLRWKQRAARGVKLSDFCVEEI 125

Query: 173 QKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVELRFF 232
           +KR+++     R++IDE+NG LD++  E N  +  Y++L +S AFNYCL HM+++E++FF
Sbjct: 126 RKRQKDYEGANRITIDELNGYLDEVSQEGNGKRMGYMALTDSRAFNYCLNHMTFMEMKFF 185

Query: 233 FDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVRIGY 292
           FDI+LK  ++SGLE++ L+ WHPDA  Y  VVSDL +++  LY+PNERL + DLS+ I +
Sbjct: 186 FDIILKTRVLSGLENMFLTAWHPDATDYLSVVSDLDVLSQRLYNPNERLRQTDLSITISH 245

Query: 293 AFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYTYL 352
           AF P +A+R  + YE+V++KL +DF +EEKMDG+R+Q+HY++YG  I Y SR G++++YL
Sbjct: 246 AFEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYL 305

Query: 353 YGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETTGH 412
           YGENSS G IS  LK    VK+CILDGEM++YD E   +LPFGL KS A +Q+  E  G 
Sbjct: 306 YGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAG- 364

Query: 413 TEPT--YRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
             PT  Y+PL+  FDL+YLNG+ LTN  + +RK+YL KIL P +  V ++   +  +AEA
Sbjct: 365 IAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEA 424

Query: 471 ITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKGR 530
           I  +L  A++ GSEGIVLK   SKY VG R+  WIKIKPEYLE FGENMDL++IGR++G+
Sbjct: 425 IKDSLEQAISMGSEGIVLKHLHSKYFVGSRNTDWIKIKPEYLEQFGENMDLLIIGREQGK 484

Query: 531 KDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIANGISNEEFK 590
           KDSF C L+++D +E                   +  +P   +FISFC+IANG+SNEEFK
Sbjct: 485 KDSFFCGLSISDPNE-------------------VAEKP---RFISFCTIANGLSNEEFK 522

Query: 591 EIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDNEESKSDLYK 650
           +I+R T G W  + E  P  + + FGTK P EWI P++SVVLEVKAR+ID +ES+   Y+
Sbjct: 523 DIERKTWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTKESEKRKYR 582

Query: 651 TGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFN--VSQNAKFGKDRSSPRKRRT 708
           +G TL+  YCK+IR+DK+W T ++ +E++  ++AR+++N   S     GK R+S R +  
Sbjct: 583 SGCTLHFGYCKQIRYDKDWKTVASFSEFEDMKDARNFYNKRKSHQVTDGKKRASKRAK-- 640

Query: 709 FHLVGDIDVTKPSK-----ADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI 763
              +G ++ ++P+      ++      F V S YFD   ++ I   ++   ++  GG  +
Sbjct: 641 ---IGIVNSSEPTALVAPVSNTFSNCRFRVISDYFDSTKRRRISQEDLCSVILEHGGEIV 697

Query: 764 HNL-RIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSA 822
           +         D LYI+G K TRE K+L+     II P W+  C++ G         ++  
Sbjct: 698 YTSDENNLPQDNLYIIGEKLTRECKILLNAKNLIIRPSWIFSCIEEGYKTPFTESDIFRG 757

Query: 823 SEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVSEYERLLIFKG 882
             E           +  +    + E   + + N            +D +     L +F  
Sbjct: 758 ELESSMDCSQFYTDFNTASLNHLLETANRGIKNPD----------SDLLLPEVPLFLFSN 807

Query: 883 WLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAVRNNIG 942
               +L+      +    V++ I+  GGE+ + +E A+I++   D  S+  L ++R  I 
Sbjct: 808 LKLAVLNSENVLDTSILEVEFAIKCHGGELVH-IENASIIIVFNDFISREDLFSLRQKIA 866

Query: 943 AR-ITGSNDVQP-IPKIVTSEWVEACMEAQYLVDEDEYAAI 981
           ++ +  S +  P IP++V   W    ++  Y+ + + Y  +
Sbjct: 867 SKAVKESTESTPRIPRMVDISWALDSIKDNYIAETEHYQCL 907

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/956 (41%), Positives = 577/956 (60%), Gaps = 47/956 (4%)

Query: 51  PINFSPSPDFCWLCDELFIKLEEVALK-KKDLGKPRKVRNLEITSNFVSLWRKTVGNDIY 109
           P NF+PSPDF WLC+ELF++++ V +      GK    +  EI SNFV  WRK VGN+IY
Sbjct: 11  PQNFAPSPDFKWLCEELFVRIDNVRINGTAGTGKSASFKYYEIISNFVESWRKGVGNNIY 70

Query: 110 PALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVKLSTFCV 169
           PALVL+LPY DRR Y +KD  L++ +C ++KLPRNS TE+RL  WKQ   R   LS+  V
Sbjct: 71  PALVLALPYRDRRIYNIKDYILIRTICSYLKLPRNSVTEQRLKSWKQRVSRARNLSSLLV 130

Query: 170 EELQKRRREPVVPKRMSIDEVNGMLDKLEHESNVGKWSYISLAESPAFNYCLEHMSYVEL 229
           EE+ KRR EP   K ++ID VN  LD+L  E ++    +  L  S  F  CLE MS+VEL
Sbjct: 131 EEIAKRRPEPN-GKSITIDGVNDYLDELSKERSISGRGFKDLVNSKPFLSCLESMSFVEL 189

Query: 230 RFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNERLEKNDLSVR 289
           ++FFDIVLK  ++ G E   L+CWHPDA+ Y  VVSDL++V   LYDP  RL+ +DLS++
Sbjct: 190 KYFFDIVLKNRVIGGQEHRFLNCWHPDAQDYLSVVSDLKVVTSKLYDPRVRLKNDDLSIK 249

Query: 290 IGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINY 349
           +G+AFAP +A++V +PYEK+   L NDF +EEKMDG+RIQVHYM+YG SI +FSR GI+Y
Sbjct: 250 VGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDY 309

Query: 350 TYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFET 409
           TYLYG + S G+IS +LK    VKEC+LDGEMV++D   + ILPFGL K  A   ++   
Sbjct: 310 TYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSD 369

Query: 410 TGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAE 469
             +++  +RPLY VFDLLYLN   L    + +RK+YL  IL P KNVV ++   RC D +
Sbjct: 370 INNSD--FRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQ 427

Query: 470 AITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRDKG 529
           ++  +L  A++ GSEG+VLK   S Y++  R+ +WIK+KPEYLE FGEN+DL++IGRD G
Sbjct: 428 SVKNSLEVAISLGSEGVVLKYYNSSYNIASRNYNWIKVKPEYLEEFGENLDLIIIGRDSG 487

Query: 530 RKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEK-----------FISFC 578
           +KDSF+  L V D+ E                   ++   KIE+            +SFC
Sbjct: 488 KKDSFMLGLLVIDEREMEE-------RDQELSSSEVVNDSKIEQDVINSKKKVKKVLSFC 540

Query: 579 SIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARS 638
           S+ANGIS+EEFKEI+R TRG+W    +  PP+  ++FG++ P EWI+P +S+VLE+K+RS
Sbjct: 541 SVANGISHEEFKEINRRTRGHWKRTSDFSPPS-ILQFGSRIPAEWIEPSDSIVLEIKSRS 599

Query: 639 IDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAKFGK 698
           +DN E+    Y T  TLY  YC+RIR+DK+W+   T+A+    R  +S  N  Q+  F  
Sbjct: 600 LDNTETSIRRYATSCTLYGGYCRRIRYDKDWTDCYTLAQLYEDRPIKSKPN-QQDENFQL 658

Query: 699 DRSSPRKRRT-----FHLVGDIDVTKPSKADFLKGYYFYVTSGYFDLQSKKNIDASEIGE 753
             +  +++R      FH + +  +     +    G +FYV S Y    +   I  + + +
Sbjct: 659 QLAHKKRKRALISDPFHQIREQKLI----SSIFAGLFFYVLSDYVTKDTGVRITRAGLED 714

Query: 754 AVVSCGGTYIHNLRI-RASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTML 812
           A+V  GG  IHN+ + R  +  + ++ CK T E ++LI+RGYDI+HP W+MDC+ Y  ++
Sbjct: 715 AIVKHGGKLIHNVILKRHCIGDVRLISCKTTIECRILIDRGYDIVHPSWVMDCIAYKQLI 774

Query: 813 QIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVS 872
            IEP Y +S S +L + A  + D  G+S++  ++E  L  L   + +     E+G D+ +
Sbjct: 775 FIEPSYCFSVSHKLREVAEKRVDCLGDSFENNISERKLSLLFKSRQDLSSIGEIGIDSEA 834

Query: 873 EYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVA-------V 925
           +   L +F   + YI            +++  I   GGE+T    L  +++         
Sbjct: 835 QVIPLFLFSNRIVYIPRTKTGLRE-EKLLEMKIRLFGGEITGQQSLCNLIIIPYVDSSRR 893

Query: 926 KDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
           KDC     ++ V   I  ++  S+ V  + +IV+  WV+  +     V E+++  +
Sbjct: 894 KDC-----IEKVNEQIKEQMKASHTVPKVARIVSPGWVDHSINENCQVPEEDFPVV 944

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/960 (39%), Positives = 590/960 (61%), Gaps = 37/960 (3%)

Query: 35  GGTPTGEH-EINAQDGSPINFSPSPDFCWLCDELFIKLEEVALKKKD--LGKPRKVRNLE 91
           GG  TG H E+   +   +NF+PSPDF WLC++LF K++ V  ++ +  L KP   R  E
Sbjct: 5   GGLETGAHDELKGTEEQAVNFAPSPDFLWLCEQLFAKIDHVQFERANNLLTKPVTARYYE 64

Query: 92  ITSNFVSLWRKTVGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRL 151
           + SNF +LWR TVGN+IYPAL L LPY DRR + +KD TL+KA+C  +KLP++S TE++L
Sbjct: 65  VISNFTTLWRTTVGNNIYPALRLILPYRDRRVFNIKDYTLIKAICAFLKLPKDSSTEKKL 124

Query: 152 LHWKQNAPRGVKLSTFCVEELQKRRREPVVPK--RMSIDEVNGMLDKLEHESNVGKWSYI 209
           ++WKQ+A R V+LS FCVEE++KRR EP + +  R++ID++NG LD+L  E      S+ 
Sbjct: 125 INWKQDAGRSVRLSKFCVEEIKKRRSEPQIDRNERITIDDLNGYLDQLAIERTEQGRSFK 184

Query: 210 SLAESPAFNYCLEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRI 269
           +LA S   N CL  M+++E+++FFDI+LK   + G E  LL+CWHPDA+ Y  VVSDL  
Sbjct: 185 NLANSDIMNKCLTSMTFLEMQYFFDILLKNRPLGGHEHKLLNCWHPDAQDYLSVVSDLET 244

Query: 270 VAHTLYDPNERLEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQ 329
           VA  L+DP++RL   DL + IG AFAP +A ++ + Y+K+  KLG DF++EEKMDG+RIQ
Sbjct: 245 VAKRLWDPSQRLGNQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQ 304

Query: 330 VHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQ 389
           +HY ++G+ I ++SR   +YTYLYG N   G+++N +   + VK+C+LD E+V++D   +
Sbjct: 305 MHYTNFGSDIKFYSRRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNK 364

Query: 390 CILPFGLTKSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKI 449
            +LPFG+ KS A + ++    G     + PL  VFD+LYLNG  L +    KR+EYL++I
Sbjct: 365 IVLPFGMVKSSAKNMLS--QDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQI 422

Query: 450 LIPSKNVVHLLSGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKP 509
           L P+ + + ++   R +D + I  +L  A++ GSEGI+LK+  S+Y +  R D WIKIKP
Sbjct: 423 LTPTAHRIEIIKSIRANDEQMIKKSLEKALSVGSEGIILKRYDSRYVIASRSDDWIKIKP 482

Query: 510 EYLENFGENMDLVVIGRDKGRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQP 569
           EYLE FGENMDLV++GRD  +KDS +  L   ++  +++P                    
Sbjct: 483 EYLEQFGENMDLVLMGRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQ------- 535

Query: 570 KIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNS 629
           +   F+S C IANGISNEE+KEIDR T+G W    E+ PP ++++FG+K PR+WIDPK S
Sbjct: 536 RFRGFVSLCIIANGISNEEYKEIDRKTKGLWND-SEKIPPLEYMKFGSKVPRQWIDPKKS 594

Query: 630 VVLEVKARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFN 689
           ++LE+KARS+DN  S    +  G TL+  YC++IR DKNW T  T+ E++ A+   ++  
Sbjct: 595 LILEIKARSLDNTRSSERKFAAGCTLFGGYCRQIREDKNWKTCYTLQEFERAKSGNNW-- 652

Query: 690 VSQNAKFGKDRSSPRKRRTFHLVGDID------VTKPSKADFLKGYYFYVTSGYFDLQSK 743
             +     K +    K+R ++++  ++           ++D   G YFYV S YFD   +
Sbjct: 653 --RKRGSSKPQKVISKKRRYNIISSVNKALEDFAELEHRSDIFDGMYFYVLSDYFDGVKR 710

Query: 744 KNIDASEIGEAVVSCGGTYIHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWL 802
           K I  SEI + +V+ GG  + N+  R  +L+ L I+  ++T E   LI RGYDII P+W+
Sbjct: 711 KRIKKSEIQKVIVANGGQLVQNVITRNYNLNDLRIISSRNTVECNSLIVRGYDIISPKWV 770

Query: 803 MDCVKYGTMLQIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGY 862
            DC+  G ++++EP + ++ S++LM  A  + D+YG+ Y+  + +    +L ++++    
Sbjct: 771 FDCLLSGKIMKLEPSHCFNFSKQLMDYAYKRIDQYGDPYERDINKYEWSSLTSEKI--CT 828

Query: 863 ASEMGTDAVSEYERL----LIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLEL 918
            ++   D   +   +     +F G + ++L D       S +V    ++ GG+VTN+L  
Sbjct: 829 TAKQQPDVQFDNSLMDVPHFLFHGRIVFLLSDNNNIQKESFMV----DAYGGKVTNELSS 884

Query: 919 ATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEY 978
           A +V+ V    +Q  +  +R  I + +   +    IP +V+  W+  C++    V ED Y
Sbjct: 885 ANLVIVV-GAVTQRRINDIRKQISSEVIKQDHPPRIPDMVSEGWLYDCIKQNTQVAEDNY 943

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/957 (40%), Positives = 588/957 (61%), Gaps = 31/957 (3%)

Query: 50  SPINFSPSPDFCWLCDELFIKLEEVALKKKD------LGKPRKVRNLEITSNFVSLWRKT 103
           +P NF+PSPDF WLCDELF+K++++  + K+        KP   R  +  ++F+ LWR T
Sbjct: 22  TPKNFAPSPDFKWLCDELFVKIDKIREQIKNKTANTISNKPISTRYFDTITHFIKLWRTT 81

Query: 104 VGNDIYPALVLSLPYNDRRSYRVKDVTLVKALCKHMKLPRNSETERRLLHWKQNAPRGVK 163
           +G+DI+PAL L LPY DRR Y +KD+TL++A+C ++KLP+NS  ERRL+ WK  A R   
Sbjct: 82  IGDDIFPALRLILPYRDRRVYNIKDLTLIRAICSYLKLPKNSVVERRLIRWKYKADRYET 141

Query: 164 LSTFCVEELQKRRREPVVPK--RMSIDEVNGMLDKLE-HESNVGKWSYISLAESPAFNYC 220
           L+TFC+ E+ KR+ EP V +  R+SID++N +LD L  +  N       +L +   F +C
Sbjct: 142 LATFCIHEISKRKNEPQVTQVERISIDKLNEILDDLVVNRQNWNNKKRSNLLQVETFKFC 201

Query: 221 LEHMSYVELRFFFDIVLKVPIVSGLESLLLSCWHPDAESYFKVVSDLRIVAHTLYDPNER 280
           LE+M+++EL++FFDI++K  I+  LE++ L  WHPD++ Y  VVSDLR +++ L++P+ +
Sbjct: 202 LENMTFIELKYFFDIIVKNKILGSLENMFLKIWHPDSKEYLSVVSDLRTLSNKLWNPSIK 261

Query: 281 LEKNDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIA 340
           +  +DLS+++GY FAP +A+R+ + Y+ +S +L NDF++EEKMDG+RIQ+HYM+YG ++ 
Sbjct: 262 INNSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVK 321

Query: 341 YFSRNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSG 400
           +FSR+G +YTYLYG + S G+I+  L+  + VKEC+LDGEMV++D   + +LPFGL KS 
Sbjct: 322 FFSRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSS 381

Query: 401 ASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLL 460
           AS Q+N +   +   ++ PL+ VFD+LYLNG  L +  + KRKE+L  +L P K+ V +L
Sbjct: 382 ASSQLNKKDIDND--SFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEIL 439

Query: 461 SGPRCSDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPEYLENFGENMD 520
           S  RC+D+  I   L AA++ GSEGIVLK+  SKY    R ++WIK+KPEYLE FGENMD
Sbjct: 440 SSIRCTDSIQIKKGLDAAISVGSEGIVLKQYISKYIPNARHNNWIKVKPEYLEEFGENMD 499

Query: 521 LVVIGRDKGRKDSFICALAVTDDSE---KNNPXXXXXXXXXXXXXEPIIVQPK--IEKFI 575
           L+VIGRD G+KD  IC + VT++ +   +N               + +  +P   I+K I
Sbjct: 500 LIVIGRDSGKKDCLICGILVTEEKQELSENMKRESEIEIISDSGDDDLDTKPSQGIKKVI 559

Query: 576 SFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVK 635
           SFC+IANG+S  E KEI+R+TRG W  Y+   PP D +EFGTK P EWI P++SVVLE+K
Sbjct: 560 SFCTIANGLSQNELKEINRITRGAWKNYNNETPPIDVLEFGTKKPVEWIYPQDSVVLEIK 619

Query: 636 ARSIDNEESKSDLYKTGSTLYNAYCKRIRHDKNWSTASTVAEYDTAREARSYFNVSQNAK 695
           ARS+D  +     Y TG TLY  YC++IR DK+W++  T+ +  T  E + +   ++N +
Sbjct: 620 ARSLDRTDQTQYKYATGCTLYGGYCRQIRQDKDWTSCYTLHDL-TYNEIKRHEKKNKNKQ 678

Query: 696 FGKDRSSPRKRRTFHLVGDIDVTKPSK--ADFLKGYYFYVTSGYFDLQSKKNIDASEIGE 753
                 S +K +     G +      +  +D   G YFY+ S Y      + ID  +I  
Sbjct: 679 TLIRSYSRKKSKIISPAGMLPNGTDLRLISDLFHGLYFYIISDYIPDSDAQRIDREDICS 738

Query: 754 AVVSCGGTYIHNLRIRA-SLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTML 812
            ++  GG  I+N+  +  ++ KL IL  K T E   L+ RGYD+I+  WL DC++ G +L
Sbjct: 739 LIIKNGGRVIYNVIAKTYTISKLRILSSKSTIECTDLVRRGYDVINLSWLFDCLQAGVIL 798

Query: 813 QIEPKYVYSASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMGTDAVS 872
            +EP +    S EL+  A ++ DK+G+SY+  + +  L  L +  + +   S      ++
Sbjct: 799 PLEPAHCLFVSNELLAIATDRIDKFGDSYEATLIDSKLLKLLDSNINKVNRSNSNLLLIN 858

Query: 873 EYER-----LLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKD 927
           + E      + +F    F+++ +        D + + I+  GG +   LE   I+V V  
Sbjct: 859 KDEGVDSIPIFLFTNRKFFLIKEDILLGD-RDTLIFQIKLYGGSLVTKLEDCNIIVGV-- 915

Query: 928 CFSQL---SLQAVRNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEYAAI 981
           C SQL    L  +R  +  +   +N  QPIP+ V   W+   ++A Y +  ++Y  +
Sbjct: 916 CGSQLVNKKLGDLRCKLVKQYVDANFPQPIPRAVNVSWITESIKAGYQLSPEDYPIL 972

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 112/428 (26%), Positives = 186/428 (43%), Gaps = 69/428 (16%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           ++R G    P +A+  K   E ++   G +F  E K DG+R QVH ++ G  +  +SRNG
Sbjct: 352 TLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLE-GGEMRIYSRNG 410

Query: 347 INYTYLYGENSSKG------SISNHLK---FVEGVKECILDGEMVSYDKEMQCILPFGLT 397
            N T  Y E   K       +I+N  +    ++ VK+ ILD E+V++D E + ILPF + 
Sbjct: 411 ENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQKKILPFQVL 470

Query: 398 KSGASHQVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVV 457
            +     V+ +     +   R     FDLLYLN + + N+ + +R+E L K+ +      
Sbjct: 471 TTRKRKNVDLK-----DVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVPGEF 525

Query: 458 HLLSGPRCSDAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLEN 514
              +    SD + +   L  AV +  EG+++K      S Y   KR  +W+K+K +YL+ 
Sbjct: 526 QYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDYLDG 585

Query: 515 FGENMDLVVI------GRDKGRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQ 568
            G+++DLVV+      G+  G    F+      D  E                       
Sbjct: 586 VGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQE----------------------- 622

Query: 569 PKIEKFISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKN 628
                F + C I  G S+E    +  L +    P +   PP  ++   +  P  W   K 
Sbjct: 623 -----FETCCKIGTGFSDEMLGNLHTLLQ----PTEIDNPPMTYIYDSSAEPDVWFQAK- 672

Query: 629 SVVLEVKARSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTA 681
            V+ EV    +    S S +YK G++ Y+           RIR DK+ +  +T  +    
Sbjct: 673 -VLFEVLTADL----SLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEF 727

Query: 682 REARSYFN 689
            E++S+  
Sbjct: 728 YESQSHIQ 735

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  113 bits (283), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 108/403 (26%), Positives = 167/403 (41%), Gaps = 64/403 (15%)

Query: 288 VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI 347
           ++ G    P +A+  K   E +    G  F  E K DG+R QVH +  G S+  +SRNG 
Sbjct: 323 LKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDG-SMNIYSRNGE 381

Query: 348 NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF 407
           N T  Y E      I ++L   E     ILD E V++D E   ILPF +  +     V  
Sbjct: 382 NMTERYPELH----IRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEA 437

Query: 408 ETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467
           +         R     FD+L  NGQ L N  +++R+EYL+++L P        +    S+
Sbjct: 438 KDV-----KVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSN 492

Query: 468 AEAITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI 524
            E +   L  +V    EG+   VL+   S Y   KR  +W+K+K +YL+  G+++DL V+
Sbjct: 493 LEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 552

Query: 525 GRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFC 578
           G   GR         F+      D  E                            F + C
Sbjct: 553 GAYYGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETCC 584

Query: 579 SIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARS 638
            I  G S+E    +    +    P    +P   +V   +  P  W +P  +++ EV    
Sbjct: 585 KIGTGFSDEMLVSLYEKLK----PSSLEQPKAFYVYDSSAEPDVWFEP--TMLFEV---- 634

Query: 639 IDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
           +  + S S +YK G++ Y            RIR DK+   A++
Sbjct: 635 LTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATS 677

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 112/416 (26%), Positives = 176/416 (42%), Gaps = 66/416 (15%)

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           G    P +A+  K   E +    G  F  E K DG+R QVH +  G S+  +SRNG N T
Sbjct: 349 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 407

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
             Y E +    IS+ +   +     ILD E V++DK+   ILPF +  +     V  E  
Sbjct: 408 ERYPEIN----ISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDV 463

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
                  R     FD+L  N + L N+ + +R+ YLE+IL P    + L S       + 
Sbjct: 464 -----KVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDE 518

Query: 471 ITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
           +   L  +V    EG+   VL    S Y   KR  +W+K+K +YL+  G+++DL V+G  
Sbjct: 519 MQLYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAY 578

Query: 528 KGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIA 581
            GR         F+      D  E                            F + C I 
Sbjct: 579 YGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETCCKIG 610

Query: 582 NGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640
            G S+E  + + ++L+     P +  +P   +V   +  P  W++P  S++ EV    + 
Sbjct: 611 TGFSDEMLQNLYEKLS-----PTEIPEPKAFYVYSESAQPDVWLEP--SMLFEV----LT 659

Query: 641 NEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSYFN 689
            + S S +YK G + Y            RIR DK+   A++  +     E++S+ N
Sbjct: 660 ADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHIN 715

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 109/418 (26%), Positives = 176/418 (42%), Gaps = 66/418 (15%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           +++ G    P +A+  K   E +    G  F  E K DG+R QVH +D G ++  +SRNG
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDG-TMRIYSRNG 442

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E      I++ ++ ++  K  ILD E V++DKE   ILPF +  +     V 
Sbjct: 443 ENMTERYPEIK----ITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVE 498

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
                 ++   R     FD+L  NG+ L N+ + +R+E L K+           +     
Sbjct: 499 L-----SDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTD 553

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 554 NLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      D  E                            F + 
Sbjct: 614 LGAYYGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETC 645

Query: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636
           C I  G S+E  +++ +RLT     P     P   +V   +  P  W +P  + + EV  
Sbjct: 646 CKIGTGFSDESLQQLHERLT-----PTIIDGPKATFVFDSSAEPDVWFEP--TTLFEV-- 696

Query: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSY 687
             +  + S S +YK GST +            RIR DK    A++  +     E +S+
Sbjct: 697 --LTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQIVELYENQSH 752

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 106/405 (26%), Positives = 171/405 (42%), Gaps = 66/405 (16%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           ++R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E +    I++ ++ ++  K  ILD E V++DK+   ILPF +  +     V 
Sbjct: 443 ENMTERYPEIN----ITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVE 498

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
                  +   +     FD+L  N + L N+ + +R+EYL K+           +    +
Sbjct: 499 L-----NDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTN 553

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V H  EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 554 NLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      D  E                            F + 
Sbjct: 614 LGAYYGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETC 645

Query: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636
           C I  G S+E  + + DRLT     P     P   +V   +  P  W +P  + + EV  
Sbjct: 646 CKIGTGFSDEMLQLLHDRLT-----PTIIDGPKATFVFDSSAEPDVWFEP--TTLFEVLT 698

Query: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
             +    S S +YK GS  ++           RIR DK    A++
Sbjct: 699 ADL----SLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATS 739

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  110 bits (274), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 105/404 (25%), Positives = 168/404 (41%), Gaps = 64/404 (15%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           ++R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E      I++ ++ ++  K  ILD E V++DK+   ILPF +  +     V 
Sbjct: 533 ENMTERYPEIK----ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
                  +   R     FD+L  N + L N  + +R+EYL K+           +    +
Sbjct: 589 L-----NDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITN 643

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V H  EG+++K    + S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 644 NLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 703

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      D  E                            F + 
Sbjct: 704 LGAYYGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETC 735

Query: 578 CSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637
           C I  G S+E  +    L      P     P   +V   +  P  W +P  + + EV   
Sbjct: 736 CKIGTGFSDEMLQ----LLHARLTPTIIDGPKATYVFDSSAEPDVWFEP--TTLFEV--- 786

Query: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
            +  + S S +YK GST ++           RIR DK    A++
Sbjct: 787 -LTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATS 829

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 105/404 (25%), Positives = 166/404 (41%), Gaps = 64/404 (15%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           S+R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 394 SLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDG-TMRIYSRNG 452

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E      I + +K     K  ILD E V++DKE Q ILPF +  +     V 
Sbjct: 453 ENMTERYPEIH----IGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVL 508

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
            +         R     FD+L  N   L N  + +R+E L ++  P+       +    S
Sbjct: 509 AKDV-----KVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTS 563

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 564 NLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 623

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      +  E                            F + 
Sbjct: 624 LGAYYGRGKRTGTYGGFLLGCYNDNTGE----------------------------FETC 655

Query: 578 CSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637
           C I  G S+E  +++    +          P   ++   +  P  W +P  S++ EV   
Sbjct: 656 CKIGTGFSDEMLQQLHEKLKATVID----GPKATYIYDSSAEPDVWFEP--SLLFEV--- 706

Query: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
            +  + S S +YK GS+ Y+           RIR DK    A++
Sbjct: 707 -LTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATS 749

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 107/405 (26%), Positives = 168/405 (41%), Gaps = 66/405 (16%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           +++ G    P +A+  K   E +    G  F  E K DG+R QVH +  G ++  +SRNG
Sbjct: 353 TIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDG-TMRIYSRNG 411

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E      I + L         ILD E V++DKE   ILPF +  +     VN
Sbjct: 412 ENMTERYPEIQ----IKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVN 467

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
                  E   R     FD+L  N   L N+ + KR+E L ++  P +      +    S
Sbjct: 468 I-----NEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTS 522

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V +  EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 523 NLDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 582

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      D                             E F + 
Sbjct: 583 LGAYFGRGKRTGTYGGFLLGCYNADS----------------------------EDFETC 614

Query: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636
           C I  G S E  + + ++L+     P     P   +V   +  P  W +P  +++ EV  
Sbjct: 615 CKIGTGFSEEMLQTLYEKLS-----PTVIDGPKGTYVFDSSAEPDVWFEP--TMLFEVLT 667

Query: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
             +    S S +YK GS++Y+           RIR DK+   A++
Sbjct: 668 ADL----SLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATS 708

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 107/405 (26%), Positives = 172/405 (42%), Gaps = 66/405 (16%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           ++R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 442

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E      I++ ++ +   K  ILD E V++DKE + ILPF +  +     V 
Sbjct: 443 ENMTERYPEIK----ITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVE 498

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
                H       L+A FD+L  N + L N+ + +R+E+L K+           +    +
Sbjct: 499 L----HDVKVKVCLFA-FDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITN 553

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V +  EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 554 NLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 613

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      D  E                            F + 
Sbjct: 614 LGAYYGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETC 645

Query: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636
           C I  G S+E  + + +RLT     P     P   +V   +  P  W +P  + + EV  
Sbjct: 646 CKIGTGFSDEMLQLLHERLT-----PTIIDGPKATFVFDASAEPDVWFEP--TTLFEVLT 698

Query: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
             +    S S +YK GS  ++           RIR DK    A++
Sbjct: 699 ADL----SLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATS 739

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 103/407 (25%), Positives = 172/407 (42%), Gaps = 66/407 (16%)

Query: 288 VRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGI 347
           +R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG 
Sbjct: 336 LRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDG-TMRIYSRNGE 394

Query: 348 NYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNF 407
           N T  Y E S +  +++    +E  K  ILD E V++DK  Q ILPF +  +     V  
Sbjct: 395 NMTERYPEISIRDFVAD----LEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450

Query: 408 ETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSD 467
           +     +   R     FD++  NG+   N+ + +R+E L ++  P             S 
Sbjct: 451 K-----DVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSS 505

Query: 468 AEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI 524
            E +   L  +V    EG+++K      S Y   KR  +W+K+K +YL+  G+++DL V+
Sbjct: 506 VEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVL 565

Query: 525 GRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFC 578
           G   GR         F+      D  E                            F + C
Sbjct: 566 GAYYGRGKRTGTYGGFLLGCYNQDSGE----------------------------FETCC 597

Query: 579 SIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637
            I  G S+E  +++ +R ++          P   +V   +  P  W +P  + + EV   
Sbjct: 598 KIGTGFSDEMLQQLYERFSKTTL-----DGPKATYVFDSSAEPDVWFEP--TTLFEV--- 647

Query: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAE 677
            +  + S S +YK G++ Y+           R+R DK+   A++ A+
Sbjct: 648 -LTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQ 693

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 104/400 (26%), Positives = 167/400 (41%), Gaps = 64/400 (16%)

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           G    P +A+  K   E + T     F  E K DG+R QVH +  G S+  +SRNG + T
Sbjct: 353 GIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDG-SMRIYSRNGEDMT 411

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
             Y E     +I ++L       + ILD E V++D E+Q ILPF +  +     V+ +  
Sbjct: 412 QRYPE----LNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLK-- 465

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
              +   R     FD+L  N   L N  + +R++ L  I  P        +    S+ + 
Sbjct: 466 ---DIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDE 522

Query: 471 ITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
           +   L  A+    EG+++K      S Y   KR  +W+K+K +YL+  G+++DL V+G  
Sbjct: 523 LQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAY 582

Query: 528 KGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIA 581
            GR         F+ A    D                             E+F + C I 
Sbjct: 583 YGRGKRTGTYGGFLLACYNQD----------------------------TEEFETCCKIG 614

Query: 582 NGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSIDN 641
            G S+E  + +    +          P  ++V   +  P  W +P  ++V EV    +  
Sbjct: 615 TGFSDEMLQTLYNGLKETAI----ESPRANFVFDSSAEPDVWFNP--TMVFEV----LTA 664

Query: 642 EESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
           + S S +YK GST+Y            RIR DK+ + A++
Sbjct: 665 DLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATS 704

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 104/408 (25%), Positives = 164/408 (40%), Gaps = 80/408 (19%)

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           G    P +A+  K   E +    G  F  E K DG+R QVH M+ G +I  +SRN  N T
Sbjct: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
             Y E      ++N     +  +  I+D E V++D E Q ILPF +  +     V  +  
Sbjct: 389 ERYPEIQFHQFLANP----QTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
                  R     FDLLYLNG+ L    +  R+++L  +L      +   +     +   
Sbjct: 445 -----KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSE 499

Query: 471 ITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
           +   L  +V+   EG+++K      S+Y   KR  +W+K+K +YLE  G+++DL V+G  
Sbjct: 500 LQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAY 559

Query: 528 KGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIA 581
            GR         F+                                 P +E+F + C I 
Sbjct: 560 YGRGKRTGTYGGFLLG----------------------------CYNPDLEEFETCCKIG 591

Query: 582 NGISNEEFKEID--------RLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLE 633
            G S E  + +            RG+   YD+  PP  W E              +++ E
Sbjct: 592 TGFSEEVLQSLHAQLKDTVIAAPRGD-VSYDDSSPPDVWFE-------------PAMLFE 637

Query: 634 VKARSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
           V    +  + S S +YK G  +Y            RIR DK+ + A++
Sbjct: 638 V----LTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATS 681

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 107/416 (25%), Positives = 173/416 (41%), Gaps = 67/416 (16%)

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           G    P +A+  K   E +    G  F  E K DG+R Q+H +  G ++  +SRNG N T
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDG-TMRIYSRNGENMT 424

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
             Y E   +  +S+        +  ILD E V++DKE   ILPF +  +     V+ +  
Sbjct: 425 ERYPEIDIRDFLSD-----PSTESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDV 479

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
                  R     FDLL  NG+ L N+ + +R++ L+K+  P        +    ++ E 
Sbjct: 480 -----KVRVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEE 534

Query: 471 ITAALGAAVAHGSEGIVLK---KARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
           +   L  +V    EG+++K      S Y   KR  +W+K+K +YL   G+++DL V+G  
Sbjct: 535 LQHFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAY 594

Query: 528 KGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIA 581
            GR         F+      D  E                            + + C I 
Sbjct: 595 YGRGKRTGTYGGFLLGCYNQDTGE----------------------------YETCCKIG 626

Query: 582 NGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640
            G S E  +++ DRL      P     P   +V    + P  W +P  +++ EV A  + 
Sbjct: 627 TGFSEELLQQLYDRLK-----PTAMEAPAAFYVYDSAQQPDVWFEP--TLLFEVLAADL- 678

Query: 641 NEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSYFN 689
              S S +YK GS  Y+           RIR DK+   A++  +     EA+++ +
Sbjct: 679 ---SLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHLS 731

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 108/416 (25%), Positives = 169/416 (40%), Gaps = 66/416 (15%)

Query: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350
           G    P +A+  K   E +    G  F  E K DG+R QVH +  G S+  +SRNG N T
Sbjct: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415

Query: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410
             Y E      IS+ +         ILD E V++DKE   ILPF +  +     V  E  
Sbjct: 416 ERYPEIR----ISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471

Query: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470
                  R     FD+L  N + L  + + +R+  LE+ L+P    + L S       + 
Sbjct: 472 -----KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDE 526

Query: 471 ITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVIGRD 527
           +   L  AV    EG+   +L+   S Y   KR  +W+K+K +YL+  G+++DL V+G  
Sbjct: 527 LQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAY 586

Query: 528 KGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISFCSIA 581
            GR         F+      D  E                            + + C I 
Sbjct: 587 YGRGKRTGTYGGFLLGCYNQDSGE----------------------------YETCCKIG 618

Query: 582 NGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640
            G S E  + + DRL+     P     P   +V   +  P  W +P  +++ EV    + 
Sbjct: 619 TGFSEEMLQTLFDRLS-----PTAIPTPKAFYVHSESAPPDVWFEP--TLLFEV----LT 667

Query: 641 NEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSYFN 689
            + S S +YK G++ Y            R+R DK    A++  +     E++S+ +
Sbjct: 668 ADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 102/408 (25%), Positives = 166/408 (40%), Gaps = 62/408 (15%)

Query: 284 NDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFS 343
           N+  +R G    P +A+  K   E +    G +F  E K DG+R QVH +  G  +  +S
Sbjct: 348 NNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIYS 406

Query: 344 RNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASH 403
           RNG N T  Y E   +  +       +     ILD E+V++D E   ILPF +  +    
Sbjct: 407 RNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRK 466

Query: 404 QVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGP 463
            V  +         R     FD+LY NG+ L  + + +R++ L ++           +  
Sbjct: 467 GVELKDV-----KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSL 521

Query: 464 RCSDAEAITAALGAAVAHGSEGIVLK---KARSKYSVGKRDDSWIKIKPEYLENFGENMD 520
             ++ + I   L  A+    EG+++K      S+Y   KR  +W+K+K +YL   G+++D
Sbjct: 522 ITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLD 581

Query: 521 LVVI------GRDKGRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKF 574
           L V+      G+  G    F+      D  E                            +
Sbjct: 582 LCVMGAYYGKGKRTGTYGGFLLGCYNQDSGE----------------------------Y 613

Query: 575 ISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKT-PREWIDPKNSVVLE 633
            + C I  G S+E   ++  L     F  +E + P  +  F +   P  W +PK  V+ E
Sbjct: 614 ETCCKIGTGFSDEMLTKLYEL-----FREEEIEVPKSFYNFDSSAEPDIWFEPK--VLFE 666

Query: 634 VKARSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
           V    +    S S +YK GS  Y+           RIR DK+   A++
Sbjct: 667 VLTADL----SLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATS 710

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 104/405 (25%), Positives = 166/405 (40%), Gaps = 66/405 (16%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           S+R G    P +A+  K   E +    G  F  E K DG+R QVH +  G ++  +SRNG
Sbjct: 383 SLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDG-TMRIYSRNG 441

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E   +  I++ L         ILD E V++D E   ILPF +  +     V+
Sbjct: 442 ENMTERYPEIHIRDFIADPLV----TSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVD 497

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
            +         +     FD+L  N + L N+ + +R++ L+++           +    S
Sbjct: 498 LKDV-----KVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSS 552

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 553 NLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCV 612

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           IG   GR         F+      D  E                            F + 
Sbjct: 613 IGAYYGRGKRTGMYGGFLLGCYNQDTGE----------------------------FETC 644

Query: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636
           C I  G S+E  +++  RLT     P     P   +V   +  P  W +P  +++ EV  
Sbjct: 645 CKIGTGFSDEMLQQLYTRLT-----PTVLDGPKATFVYDSSAEPDVWFEP--TLLFEVLT 697

Query: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
             +    S S +YK GS+ Y+           R R DK    A++
Sbjct: 698 ADL----SLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATS 738

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 98/404 (24%), Positives = 163/404 (40%), Gaps = 64/404 (15%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           S+R      P +A+  K   E         F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 356 SLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDG-TMRIYSRNG 414

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E   +  +++    +   K  ILD E V++DKE   ILPF +  +     V+
Sbjct: 415 ENMTERYPEIHIRDFVTD----LSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVD 470

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
                  E   R     FD+L  N + L N+ + +R++ L  I           +    +
Sbjct: 471 I-----NEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTT 525

Query: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + E + + L  +V +  EG+++K      S Y   KR  +W+K+K +YL   G+++DL V
Sbjct: 526 NLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCV 585

Query: 524 I------GRDKGRKDSFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +      G+  G    F+      D  E                            F + 
Sbjct: 586 LGAYFGRGKRTGNYGGFLLGCYNQDTGE----------------------------FETA 617

Query: 578 CSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637
           C I  G S+E  +++    +          P   +V   +  P  W +P  +++ EV   
Sbjct: 618 CKIGTGFSDEVLQQLHERLKSTVIDL----PKATYVFDPSAEPDVWFEP--TLLFEVLTA 671

Query: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674
            +    S S +YK GS+ Y+           R+R DK    A++
Sbjct: 672 DL----SLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATS 711

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 103/409 (25%), Positives = 172/409 (42%), Gaps = 72/409 (17%)

Query: 286 LSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRN 345
           + +R G    P +A+  K   E +    G  F  E K DG+R QVH    G S+  +SRN
Sbjct: 329 IKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDG-SMKIYSRN 387

Query: 346 GINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQV 405
           G + T  Y E   K    +++K +   K  I+D E V++D+E   ILPF +  +     V
Sbjct: 388 GEDMTERYPEIDVK----HYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGV 443

Query: 406 NFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRC 465
             +         R     FD+L LN + L N+   +R++ L      ++      +    
Sbjct: 444 ELKDV-----KVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTT 498

Query: 466 SDAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLV 522
           ++ + +   L  +V    EG+++K      S Y   KR  +W+K+K +YLE  G+++DLV
Sbjct: 499 TNFDELQKYLDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLV 558

Query: 523 VIGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFIS 576
           V+G   GR         F+      D                             E+F +
Sbjct: 559 VLGAYYGRGKRTGTYGGFLLGCYNLDS----------------------------EEFET 590

Query: 577 FCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPRE-WIDPKNSVVLEVK 635
            C I  G S+E  +++    +     +     P+  V + +  P + W +P  S++ EV 
Sbjct: 591 CCKIGTGFSDEMLQDLYTKLKDTTVEH-----PSTNVIYDSSAPADVWFEP--SMLFEV- 642

Query: 636 ARSIDNEESKSDLYKTGSTLYNAYCK----------RIRHDKNWSTAST 674
              +  + S S +YK G   + A+ K          RIR DKN + A++
Sbjct: 643 ---LTADLSLSPVYKAG---FEAFGKGISLRFPRFVRIRDDKNVTDATS 685

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 103/418 (24%), Positives = 173/418 (41%), Gaps = 66/418 (15%)

Query: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346
           S+R G    P +A+  K   E         F  E K DG+R QVH M+ G S+  +SRNG
Sbjct: 339 SLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGERAQVHLMNDG-SMRIYSRNG 397

Query: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406
            N T  Y E +    +++ +K +   K  I+D E V++D+E + ILPF +  +     V+
Sbjct: 398 ENMTERYPEIN----VTDFIKDLNLTKSLIIDCEAVAWDREEKKILPFQVLSTRKRKDVD 453

Query: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466
            +     +   R     FD+L  N + L N+ + +R+E L  +                +
Sbjct: 454 IK-----DIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGEFTYAKELSTN 508

Query: 467 DAEAITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523
           + + +   L  +V    EG+   VL    S Y   KR  +W+K+K +YL+  G+++DL V
Sbjct: 509 NLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLDGVGDSLDLCV 568

Query: 524 IGRDKGRKD------SFICALAVTDDSEKNNPXXXXXXXXXXXXXEPIIVQPKIEKFISF 577
           +G   GR         F+      D  E                            F + 
Sbjct: 569 LGAFYGRGKRTGTYGGFLLGCYNQDTGE----------------------------FETA 600

Query: 578 CSIANGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKA 636
           C I  G S+E  + + DRL            P   ++   +  P  W +P  +++ EV  
Sbjct: 601 CKIGTGFSDEVLQSLYDRLKSTTI-----DGPKATYIYDSSAQPDVWFEP--TLLFEV-- 651

Query: 637 RSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSY 687
             +  + S S +YK G++ Y+           R+R DK+   A++  +     E +S+
Sbjct: 652 --LTADLSMSPIYKAGASTYSKGISLRFPRFIRLREDKSVEEATSSEQIIELYENQSH 707

>Ecym_6341 Chr6 (656835..659138) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii AFR095C
          Length = 767

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 723 ADFLKGYYFYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGCKD 782
           A F + Y F       ++ + +     EIG +       +I +  I  S   ++I  C  
Sbjct: 107 APFTEFYMFIGRISAPEVSTGELQQLCEIGHSYRCLTNHFIKD--IECSAQSVFITDCAT 164

Query: 783 TRELKMLIERGYDIIHPEWLMDCVKYGTMLQIE 815
               K   E G  I+HP+W+MDC K G +L++E
Sbjct: 165 GARAKAAREEGVPIVHPKWVMDCTKRGAVLEME 197

>NCAS0A09420 Chr1 (1869312..1871666) [2355 bp, 784 aa] {ON}
           Anc_1.276 YJL090C
          Length = 784

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 723 ADFLKGYYFYVTSGYFDLQSKKNID--ASEIGEAVVSCGGTYIHNLRIRASLDKLYILGC 780
           AD LK +Y +V     DL S   I+  + E+G               +  S + ++I   
Sbjct: 115 ADPLKNFYLFVGRISSDLHSVNEIETISHELGCYKCEVSQFLKDAKSLNPSRNIVFITDS 174

Query: 781 KDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYV 819
                +    ++G  I+H +W++DC   G MLQ +P Y+
Sbjct: 175 ATGIRVNAARDQGIPIVHQKWIVDCQIRGAMLQFDPYYL 213

>TPHA0B01320 Chr2 complement(293509..295770) [2262 bp, 753 aa] {ON}
           Anc_1.276 YJL090C
          Length = 753

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 7/128 (5%)

Query: 754 AVVSCG-GTYIHNLRIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTML 812
            V SC    +I + R   S   ++I        +     +G  IIH +WL+DC+K   ML
Sbjct: 161 GVASCNSNNFIKDCRSTTSSPAVFITDNPQGARVDAARSQGLAIIHYKWLLDCLKRNAML 220

Query: 813 QIEPKYVY-----SASEELMKQARNQEDKYGESYQLPVTEDTLKALANKQVEEGYASEMG 867
           Q +P Y+      S  +++   A    DK G+ Y L  T +      NK  + G ++ + 
Sbjct: 221 QFDPYYLLDNVLNSLYDDIGSNACECWDKIGD-YNLMKTRNKDVDNINKDSDTGDSTIIT 279

Query: 868 TDAVSEYE 875
           +  +++++
Sbjct: 280 STMLNKFK 287

>ZYRO0G15180g Chr7 (1223984..1226050) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47027 Saccharomyces cerevisiae YJL090C DPB11
           Essential BRCT repeat protein required on the
           prereplicative complex at replication origins for
           loading DNA polymerases to initiate DNA synthesis also
           required for S/M checkpoint control
          Length = 688

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%)

Query: 775 LYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASE 824
           +++    D   +K  +E G  IIHP+W++DC K   +L+ +P Y+    E
Sbjct: 154 VFVSDSLDGIRVKAAMELGIPIIHPKWVLDCHKRNALLEFDPYYLLETIE 203

>AFR095C Chr6 complement(604687..606699) [2013 bp, 670 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL090C
           (DPB11)
          Length = 670

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 7/89 (7%)

Query: 731 FYVTSGYFDLQSKKNIDASEIGEAVVSCGGTYI---HNLRIRASLDK-LYILGCKDTREL 786
           FYV  G     +   + A+E+ +   S G   +   H +R  AS  + +++  C +    
Sbjct: 114 FYVFIGRV---AGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVFVTDCAEGARA 170

Query: 787 KMLIERGYDIIHPEWLMDCVKYGTMLQIE 815
               E+G  ++HP+W+ DCV+ G ++++E
Sbjct: 171 AAAREQGVAVVHPKWVTDCVRRGAVVEME 199

>AFL107W Chr6 (239635..241026) [1392 bp, 463 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL130W (CEG1)
          Length = 463

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 83/219 (37%), Gaps = 49/219 (22%)

Query: 313 LGNDFYVEEKMDGDR----IQVHYMDYGNSIAYFSRNGINYTYLYGENSSKGSISNHLKF 368
           L  D+YV EK DG R    I ++ +          R   NY  L G    +   +N  + 
Sbjct: 57  LAQDYYVCEKTDGLRALMLIIMNPVTKEQGCFLIDREN-NYYLLNGFRFPRLPRANRKEL 115

Query: 369 VEGVKE-CILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETTGHTEPTYRPL-YAVFDL 426
           +E +++  ++DGE+V                     Q N  T        R L Y +FD 
Sbjct: 116 LETLQDGTLVDGELVV--------------------QTNPATR------LRELRYLMFDC 149

Query: 427 LYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS---------------DAEAI 471
           L +NG+ L       R  +L K        +      RC+               D + +
Sbjct: 150 LAINGRALVQSPTSSRLAHLGKEFYKPYYDLRAYYPDRCATFPFKLSMKHMNFSFDLDRV 209

Query: 472 TAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
             +L   + H S+G++     + Y+VG +D + +K KPE
Sbjct: 210 AGSLDK-LPHVSDGLIFTAVDTPYTVGGKDSTLLKWKPE 247

>KAFR0C05190 Chr3 (1031636..1034326) [2691 bp, 896 aa] {ON} Anc_7.46
           YOR346W
          Length = 896

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 750 EIGEAVVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIE-RGYDIIHPEWLMDCVKY 808
           ++ E +V  GG ++H+L  + S+  +       T  LK  IE   Y ++ PEWL+D +K 
Sbjct: 127 QLHEMIVLNGGKFLHHLSAKRSVTHI----IASTLTLKKKIEFANYKVVKPEWLVDSIKV 182

Query: 809 GTML 812
             +L
Sbjct: 183 KKLL 186

>KAFR0A01470 Chr1 complement(291119..293269) [2151 bp, 716 aa] {ON}
           Anc_1.276 YJL090C
          Length = 716

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 773 DKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYGTMLQIEPKYV 819
           D ++I    D    K  IE    I+H +WL+DC K   +LQ +P Y+
Sbjct: 172 DIIFINDNLDGYRTKAAIELNIPIVHYKWLLDCQKRNAILQYDPYYL 218

>KNAG0C02810 Chr3 (548689..558591) [9903 bp, 3300 aa] {ON} Anc_5.576
            YDR457W
          Length = 3300

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 14/80 (17%)

Query: 908  CGGEVT-NDLELATIVVAVKDCFSQLSLQAVRNNIGARITGSNDVQP----------IPK 956
            CG +   +D+    +++  +    QLSL+ V N I  R  G+N VQP           P 
Sbjct: 2524 CGSKQNRSDIINILLMILTEGTNDQLSLEKVYNQIAVRAQGNNKVQPQISRQLPPDCTPL 2583

Query: 957  IVTSEWVEACMEAQYLVDED 976
            IV ++ +E     QYL+D D
Sbjct: 2584 IVANQAIEIL---QYLIDSD 2600

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 20/104 (19%)

Query: 763 IHNLRIRASLDKLYILGCKDT----------RELKMLIERGYDIIHPEWLMDCVKYG--- 809
           + N ++ ASL +L +    DT            L  LI +G D+ H EW+++ +  G   
Sbjct: 25  VKNKKVAASLSQLLLEASADTEWDKSNRALLHNLATLI-KGSDLPHHEWIVEGIVSGDLK 83

Query: 810 TMLQIEP--KYVYSASEELMKQARNQEDKYGESYQLPVTEDTLK 851
           T LQI+   KY+ SA +   K++   E   G    + VTED ++
Sbjct: 84  TNLQIDSAFKYLKSAGDNATKESLKSESGVG----VTVTEDQVR 123

>Suva_8.400 Chr8 (717697..720654) [2958 bp, 985 aa] {ON} YOR346W
           (REAL)
          Length = 985

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 750 EIGEAVVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIE-RGYDIIHPEWLMDCVKY 808
           ++ E +V  GG ++H+L  +  +  +          LK  IE   Y +++P+W+ DC+K 
Sbjct: 184 QLHEMIVLHGGKFLHHLSAKKRVTHI----VASNLPLKKRIEFANYKVVNPDWITDCIKE 239

Query: 809 GTMLQIEPKYVYSASEELMKQAR 831
             +L   P   YS + +L +Q +
Sbjct: 240 RRLL---PWQNYSLTAKLDEQQK 259

>TDEL0E05370 Chr5 complement(982429..983802) [1374 bp, 457 aa] {ON}
           Anc_6.228 YGL130W
          Length = 457

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 16/105 (15%)

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS-------------- 466
           Y +FD L +NG+ +T      R  +L K        +  L   +C               
Sbjct: 144 YLMFDCLAINGRCITPSPTSSRLAHLGKEFFKPYYDLRSLFAEQCVTFPFKLSMKHMNFS 203

Query: 467 -DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
            D   +  +L +++ H S+G++    +  YSVG +D   +K KPE
Sbjct: 204 YDLLKVANSL-SSLPHESDGLIFTPVKLPYSVGSKDSYLLKWKPE 247

>TBLA0E00570 Chr5 complement(110459..112249) [1791 bp, 596 aa] {ON}
           Anc_3.447 YGR103W
          Length = 596

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query: 872 SEYERLLIFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQ 931
           SE+E   +F  ++FY+  +        DI ++ I SCGG+V ++  L  I  + +   S 
Sbjct: 344 SEHESSSLFSDFIFYVGREVPI-----DIAEFLILSCGGKVISEAALDQIEKSNEIDLSN 398

Query: 932 LSLQAV-RNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEY 978
           ++   V R  +  +I G   VQP       +W+  C+    LV  + Y
Sbjct: 399 VTHHIVDRPVLKNKIAGRTYVQP-------QWIFDCINKGELVPANAY 439

>ZYRO0E07150g Chr5 complement(540507..541856) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|Q01159 Saccharomyces
           cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
           capping enzyme), alpha subunit
          Length = 449

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%), Gaps = 16/105 (15%)

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS-------------- 466
           Y +FD L +NG+ LT      R  +L K        + L+   +C               
Sbjct: 144 YLMFDCLAINGRCLTPSPTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSFS 203

Query: 467 -DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
            D   +  +L   + H S+G++    ++ Y VG +D   +K KPE
Sbjct: 204 YDLLKVANSL-EKLPHMSDGLIFTPVKTPYFVGGKDSLLLKWKPE 247

>TDEL0D01440 Chr4 complement(282138..283949) [1812 bp, 603 aa] {ON}
           Anc_1.276 YJL090C
          Length = 603

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 790 IERGYDIIHPEWLMDCVKYGTMLQIEPKYVYS 821
           IE+G  I+H +W++DC +    L+ +P Y+ S
Sbjct: 180 IEQGIPIVHYKWILDCQRRNATLEYDPYYLVS 211

>Kpol_359.6 s359 complement(5679..7445) [1767 bp, 588 aa] {ON}
           complement(5679..7445) [1767 nt, 589 aa]
          Length = 588

 Score = 33.5 bits (75), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 15/80 (18%)

Query: 755 VVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIER--------GYDIIHPEWLMDCV 806
           ++SCGG+ I      A+LDKL       ++    +++R        G   I P+W+ DC+
Sbjct: 369 ILSCGGSVIS----EAALDKLETKDIDFSKVTHQIVDRPVLKNKVAGRTYIQPQWIFDCL 424

Query: 807 KYGTMLQIEPKYVYSASEEL 826
               ++   P  +Y   E L
Sbjct: 425 NKAKLV---PANLYLPGETL 441

>Kpol_367.9 s367 complement(31451..34093) [2643 bp, 880 aa] {ON}
           complement(31451..34093) [2643 nt, 881 aa]
          Length = 880

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 745 NIDASEIGEAVVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIE-RGYDIIHPEWLM 803
           N D  ++ E +V  GG ++H L  + S    +I+  K    LK  +E   Y +++P+W+M
Sbjct: 107 NPDRLKLHELIVIHGGKFLHFLSAKGS--ATHIVASK--LPLKKKLEYANYKVVNPDWIM 162

Query: 804 DCVKYGTML 812
           + +  G +L
Sbjct: 163 NSINAGKLL 171

>KNAG0F01900 Chr6 (367193..368566) [1374 bp, 457 aa] {ON} Anc_6.228
           YGL130W
          Length = 457

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 39/104 (37%), Gaps = 14/104 (13%)

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS-------------D 467
           Y +FD L +NG+ L       R  +L K        +       CS              
Sbjct: 144 YLMFDCLAINGRSLIQSPTSSRLAHLGKEFFKPYYDLRSFYPDHCSTFPLKLSMKHMDFS 203

Query: 468 AEAITAALGA-AVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
            E +  A     + H S+G++    R+ Y VG +D   +K KPE
Sbjct: 204 YELVKVAQSLDKLPHMSDGLIFTPVRAPYQVGGKDSLLLKWKPE 247

>KNAG0B01830 Chr2 complement(341951..344209) [2259 bp, 752 aa] {ON}
           Anc_1.276 YJL090C
          Length = 752

 Score = 32.7 bits (73), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 7/41 (17%)

Query: 796 IIHPEWLMDCVKYGTMLQIEPKYVYSASEELMKQARNQEDK 836
           I+HP+W+MDC +    L+ +P Y       L K   NQ D+
Sbjct: 189 IVHPKWIMDCHRRHGTLEYDPFY-------LTKNVLNQSDE 222

>Kwal_56.24113 s56 complement(855380..856789) [1410 bp, 469 aa] {ON}
           YGL130W (CEG1) - mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit [contig 166] FULL
          Length = 469

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 42/105 (40%), Gaps = 16/105 (15%)

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRC--------------- 465
           Y +FD L +NG+ +       R  +L K        +  L   +C               
Sbjct: 144 YLMFDCLAINGRCIAQSPTSSRLAHLGKEFFKPYYDLRSLYPAQCATFPFKLSMKHMSFS 203

Query: 466 SDAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
           +D   +  +L   + H S+G++     + YS+G +D   +K KPE
Sbjct: 204 TDLAKVANSL-EHLPHVSDGLIFTPVTTAYSIGSKDSLLLKWKPE 247

>KLLA0B02200g Chr2 (196341..197741) [1401 bp, 466 aa] {ON} highly
           similar to uniprot|Q01159 Saccharomyces cerevisiae
           YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
           enzyme), alpha subunit
          Length = 466

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 41/105 (39%), Gaps = 16/105 (15%)

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS-------------- 466
           Y +FD L +NG+ L       R  +L K        +      RCS              
Sbjct: 145 YLMFDCLAVNGRSLVQSPTSSRLAHLGKEFFKPYYDLRSYFPDRCSTFPFKISMKHMNFS 204

Query: 467 -DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
            D   +   L + + H S+G++    ++ Y +G +D   +K KPE
Sbjct: 205 YDLAKVAKTLDS-LPHVSDGLIFTPVQAAYHIGGKDSYLLKWKPE 248

>Skud_10.124 Chr10 complement(230827..233124) [2298 bp, 765 aa] {ON}
           YJL090C (REAL)
          Length = 765

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%)

Query: 790 IERGYDIIHPEWLMDCVKYGTMLQIEPKYVYSASEEL 826
           I++   IIH +W++DC K   +L  +P Y+    ++L
Sbjct: 190 IDQNLPIIHFKWILDCQKRNALLPYDPHYLLPKVKDL 226

>NDAI0E03930 Chr5 (868403..871489) [3087 bp, 1028 aa] {ON} Anc_7.46
           YOR346W
          Length = 1028

 Score = 32.3 bits (72), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 36/63 (57%), Gaps = 3/63 (4%)

Query: 750 EIGEAVVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIERGYDIIHPEWLMDCVKYG 809
           ++ E++V  GG +IH+L  +  +   +I+    T + K+  E+ Y ++ P+W++  ++  
Sbjct: 197 QLHESIVLHGGKFIHHLSAKKKI--THIIASNLTLKKKLEFEK-YKVVKPDWIVKSIESK 253

Query: 810 TML 812
            +L
Sbjct: 254 KLL 256

>YGR103W Chr7 (695417..697234) [1818 bp, 605 aa] {ON}  NOP7Component
           of several different pre-ribosomal particles; forms a
           complex with Ytm1p and Erb1p that is required for
           maturation of the large ribosomal subunit; required for
           exit from G0 and the initiation of cell
           proliferation
          Length = 605

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 879 IFKGWLFYILDDYAYHSSWSDIVKWNIESCGGEVTNDLELATIVVAVKDCFSQLSLQAV- 937
           +F  ++FY+  +        DI+++ I SCGG V ++  +  I        S+++ Q V 
Sbjct: 359 LFSAFVFYVSREVPI-----DILEFLILSCGGNVISEAAMDQIENKKDIDMSKVTHQIVD 413

Query: 938 RNNIGARITGSNDVQPIPKIVTSEWVEACMEAQYLVDEDEY 978
           R  +  ++ G   +QP       +W+  C+    LV  ++Y
Sbjct: 414 RPVLKNKVAGRTYIQP-------QWIFDCINKGELVPANKY 447

>Ecym_2188 Chr2 (371869..373254) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AFL107W
          Length = 461

 Score = 32.0 bits (71), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 42/105 (40%), Gaps = 16/105 (15%)

Query: 421 YAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS-------------- 466
           Y +FD L +NG+ L       R  +L K        +  +    CS              
Sbjct: 144 YLMFDCLAINGRSLVQSPTSSRLAHLGKEFFKPYYDLRSVYPDHCSNFPFKLSMKHMNFS 203

Query: 467 -DAEAITAALGAAVAHGSEGIVLKKARSKYSVGKRDDSWIKIKPE 510
            D   I + L   + H S+G++     + Y+VG +D + +K KP+
Sbjct: 204 YDLVKIASTLDK-LPHVSDGLIFTPVNTSYNVGGKDSNLLKWKPQ 247

>AAR094W Chr1 (513366..515156) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR103W (NOP7)
          Length = 596

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 15/80 (18%)

Query: 755 VVSCGGTYIHNLRIRASLDKLYILGCKDTRELKMLIER--------GYDIIHPEWLMDCV 806
           +VSCGG+ I      A+LD+        ++    L++R        G   I P+W+ D +
Sbjct: 372 IVSCGGSVIS----EAALDQADAANVDVSKVTHQLVDRPVVKNKVAGRTYIQPQWVFDSI 427

Query: 807 KYGTMLQIEPKYVYSASEEL 826
             G ++   P  +Y   E L
Sbjct: 428 NKGELV---PANLYLPGESL 444

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,586,236
Number of extensions: 5033391
Number of successful extensions: 12779
Number of sequences better than 10.0: 72
Number of HSP's gapped: 12887
Number of HSP's successfully gapped: 74
Length of query: 981
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 862
Effective length of database: 39,836,145
Effective search space: 34338756990
Effective search space used: 34338756990
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)