Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR007W6.19ON31331315870.0
Smik_15.1756.19ON31231810171e-138
KLLA0D01111g6.19ON31430110171e-138
YOR006C (TSR3)6.19ON3133129981e-136
TDEL0G045006.19ON3012949961e-135
Ecym_30236.19ON3492819941e-134
CAGL0E02717g6.19ON3253189911e-134
Suva_15.1816.19ON3363199891e-134
SAKL0E01144g6.19ON4303169961e-133
TPHA0J003206.19ON3423319811e-133
Kpol_1037.246.19ON3663249691e-130
KNAG0M011506.19ON3073209541e-129
ZYRO0C07832g6.19ON2812879451e-128
Skud_15.1676.19ON3123149481e-128
Kwal_56.224216.19ON3373019301e-125
KLTH0C11264g6.19ON3463179131e-122
NCAS0H008106.19ON3233288871e-119
NDAI0D007906.19ON4013508801e-116
KAFR0L003906.19ON3293048371e-111
TBLA0A072506.19ON3042997981e-105
Kwal_23.5227singletonOFF10931740.25
TBLA0B052006.184ON81242780.37
CAGL0E03454g4.46ON867103760.65
KLLA0D04136g4.37ON382115740.94
NCAS0A116503.460ON144759722.1
Ecym_31825.304ON11556672.4
YIL091C (UTP25)2.292ON72165712.5
ZYRO0D17358g6.366ON66885703.3
KAFR0D043205.383ON1450172703.6
CAGL0D05368g7.174ON11351654.4
KAFR0B036708.823ON20144674.8
Smik_5.3338.224ON33345684.8
AGR198C8.566ON515125685.5
Kpol_1029.42.171ON1134130686.1
Skud_5.3008.224ON33345676.4
Smik_4.2313.214ON44060677.0
Kwal_14.13284.168ON77349677.8
NCAS0I021103.156ON84445677.9
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ACR007W
         (942 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   615   0.0  
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   396   e-138
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   396   e-138
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   389   e-136
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   388   e-135
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   387   e-134
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   386   e-134
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   385   e-134
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   388   e-133
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   382   e-133
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   377   e-130
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   372   e-129
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   368   e-128
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   369   e-128
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   362   e-125
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   356   e-122
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   346   e-119
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   343   e-116
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   327   e-111
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   311   e-105
Kwal_23.5227 s23 (1067468..1067797) [330 bp, 109 aa] {OFF} [cont...    33   0.25 
TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa] ...    35   0.37 
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    34   0.65 
KLLA0D04136g Chr4 (350976..352124) [1149 bp, 382 aa] {ON} conser...    33   0.94 
NCAS0A11650 Chr1 (2316596..2320939) [4344 bp, 1447 aa] {ON} Anc_...    32   2.1  
Ecym_3182 Chr3 (348541..348543,348610..348954) [348 bp, 115 aa] ...    30   2.4  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...    32   2.5  
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    32   3.3  
KAFR0D04320 Chr4 complement(847765..852117) [4353 bp, 1450 aa] {...    32   3.6  
CAGL0D05368g Chr4 complement(513884..514225) [342 bp, 113 aa] {O...    30   4.4  
KAFR0B03670 Chr2 complement(766212..766817) [606 bp, 201 aa] {ON...    30   4.8  
Smik_5.333 Chr5 complement(498906..499907) [1002 bp, 333 aa] {ON...    31   4.8  
AGR198C Chr7 complement(1125892..1127383,1127431..1127486) [1548...    31   5.5  
Kpol_1029.4 s1029 complement(4715..8119) [3405 bp, 1134 aa] {ON}...    31   6.1  
Skud_5.300 Chr5 complement(484388..485389) [1002 bp, 333 aa] {ON...    30   6.4  
Smik_4.231 Chr4 complement(420155..421477) [1323 bp, 440 aa] {ON...    30   7.0  
Kwal_14.1328 s14 complement(280218..282539) [2322 bp, 773 aa] {O...    30   7.8  
NCAS0I02110 Chr9 (396834..399368) [2535 bp, 844 aa] {ON} Anc_3.1...    30   7.9  

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  615 bits (1587), Expect = 0.0
 Identities = 301/313 (96%), Positives = 301/313 (96%)
 Frame = +1

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 180
           MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC
Sbjct: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60

Query: 181 SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 360
           SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP
Sbjct: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120

Query: 361 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 540
           FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG
Sbjct: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180

Query: 541 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 720
           FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN
Sbjct: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 240

Query: 721 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVP 900
           MR            EYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVP
Sbjct: 241 MRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVP 300

Query: 901 ETKILESDEEDQQ 939
           ETKILESDEEDQQ
Sbjct: 301 ETKILESDEEDQQ 313

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  396 bits (1017), Expect = e-138
 Identities = 198/318 (62%), Positives = 237/318 (74%), Gaps = 5/318 (1%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 177
           M KGKNK  E +  +P +G++ H+ + N RR E+K+ ++ + +FP KLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 178 CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 357
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+D E+VEQHG SVVECSWARL+E+
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 358 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 537
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 538 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 717
           GFLELN+ELLE YQQCTD  S+K AEE WLQKLE+E ++R+ Q  EEDIWMMGN+NR+  
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRGG 240

Query: 718 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI----ENGR 885
                           + SD   +  S    GE  + G K+ V YDSLGN I     N R
Sbjct: 241 G---------------WQSD---ESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSR 282

Query: 886 REFVPETKILESDEEDQQ 939
           +    E++  E+D E+ +
Sbjct: 283 KSLSEESEDEENDLEENK 300

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  396 bits (1017), Expect = e-138
 Identities = 193/301 (64%), Positives = 230/301 (76%), Gaps = 4/301 (1%)
 Frame = +1

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 180
           M KGKNK++  R +  KGS+ H+ + N +R E+KH  +  ++FP KLAMWDFDHCDPKRC
Sbjct: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60

Query: 181 SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 360
           SGKKLERLGLIKSLR+GQKFQG+VVSPNGKTVVCP+DK +VE++G SVVECSWARLDE+P
Sbjct: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120

Query: 361 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 540
           F+KIGG++ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA +LLS+FSWGP 
Sbjct: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180

Query: 541 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 720
           FLELN+ELL+ YQQCTDH S+KAAEE WLQK+E+EA +R++Q   EDIWM+GNVNR + +
Sbjct: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRASRD 240

Query: 721 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSK----RDVTYDSLGNVIENGRR 888
           +                        S  EE ED   G      RD+ YDSLGNVI     
Sbjct: 241 LPGS---------------------SGEEEEEDYLNGDSLIDVRDIKYDSLGNVISYNDE 279

Query: 889 E 891
           E
Sbjct: 280 E 280

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  389 bits (998), Expect = e-136
 Identities = 193/312 (61%), Positives = 233/312 (74%), Gaps = 1/312 (0%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 177
           M KGKNK  E +  +P +G++ H+ + N RR E+K+ ++++ +FP KLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 178 CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 357
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+D EIVEQHG SVVECSWARL+E+
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 358 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 537
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 538 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 717
           GFLELN+ELLE YQQCTD  S+K AEE WLQKLE+E ++R+ +  EEDIWMMGN+NR+  
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRG- 239

Query: 718 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFV 897
                             S  D     +  E  D+  G+ + + YDSLGN I     +  
Sbjct: 240 ----------------NGSQSDTSESEENSEQSDLE-GNNQCIEYDSLGNAIRIDNMK-S 281

Query: 898 PETKILESDEED 933
            E +  ES++E+
Sbjct: 282 REAQSEESEDEE 293

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  388 bits (996), Expect = e-135
 Identities = 191/294 (64%), Positives = 225/294 (76%), Gaps = 1/294 (0%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 177
           M+KGKNK  E +     KGS+ H+ + N +R E+K G T++T+FP KLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKR 59

Query: 178 CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 357
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNG  VVCP+DK IVE+HG SVVECSWARLDE+
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 358 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 537
           PF+KIGG+HERLLPYLVAANQVNYGRPW+LNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 538 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 717
           GFLELNQELLE YQQCTD  S+KAAE AWL K+++E E+R+ Q  +EDIWM GNVNRK  
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239

Query: 718 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIEN 879
                           +  D + +  S+ EE ++     K  + YD LGN+IE+
Sbjct: 240 T---------------FLDDNEEEESSEVEESDEEEDNGK-TLRYDRLGNLIES 277

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  387 bits (994), Expect = e-134
 Identities = 192/281 (68%), Positives = 220/281 (78%)
 Frame = +1

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 180
           M KG+NK  ++     KGS+ H+ ++N RR E K+   + ++FP  LAMWDFDHCDPKRC
Sbjct: 1   MGKGRNKDYDKNHSQ-KGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRC 59

Query: 181 SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 360
           SGKKLERLGLIKSLR+ QKFQGIVVSPNGKTVVCPND+EI E++GVSVVECSWARL+EIP
Sbjct: 60  SGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIP 119

Query: 361 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 540
           F KIGGRHERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLAE LLSHFSWG G
Sbjct: 120 FEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLG 179

Query: 541 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 720
           FLELN+E+LE YQ+CTDH SIKAAEEAWL+++E EA +RRKQT E DIWMMGNVNRK  +
Sbjct: 180 FLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNAS 239

Query: 721 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRD 843
                         +  SD   DL SD+     +A  SK D
Sbjct: 240 KELHPYSDIDDIDEDETSDFKSDL-SDSNNDLCVANISKED 279

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  386 bits (991), Expect = e-134
 Identities = 191/318 (60%), Positives = 237/318 (74%), Gaps = 7/318 (2%)
 Frame = +1

Query: 7   KGKNKKTEE-RQKPAKGSSKHNGKSNQRRTELKH-GHTKETEFPAKLAMWDFDHCDPKRC 180
           KGKNK  +E R   + GS+ H+ + N R  E+K+ G +K++ FP KLAMWDFDHCDPKRC
Sbjct: 5   KGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKRC 64

Query: 181 SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 360
           SGKKLERLGLIKSLR+GQKFQGIVVSPNGK+VVCP+D+EIVE HG SVVECSWARL+E+P
Sbjct: 65  SGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEVP 124

Query: 361 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 540
           F+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA ELLSHFSWG G
Sbjct: 125 FNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGLG 184

Query: 541 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 720
           FLELN++LLE YQQCTD  SIK  EE WLQ++++E ++R+ +   ED+WMMGN NR    
Sbjct: 185 FLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNSG 244

Query: 721 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIE-----NGR 885
           +                SD + +   + EE E+    ++++V YD+LGN+IE     N  
Sbjct: 245 LMP-------------PSDSEEEYEEEAEEEEEDTT-TRKNVRYDNLGNIIEDSEDDNNE 290

Query: 886 REFVPETKILESDEEDQQ 939
            ++  E    E+ +ED +
Sbjct: 291 SDYSNEESSDEASDEDYE 308

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  385 bits (989), Expect = e-134
 Identities = 193/319 (60%), Positives = 233/319 (73%), Gaps = 6/319 (1%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 177
           M KGKNK  E +  +P +G++ H+ + N +R E+K+ +++ T FP KLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 178 CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 357
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNG  VVCP+D E+VEQHG SVVECSWARL+E+
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 358 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 537
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A  LLSHFSWG 
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 538 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 717
           GFL+LN+ELLE YQ+CTD  S+K AEE WLQKLE+E ++R+ Q+ +EDIWMMGNVNRK  
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK-- 262

Query: 718 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGS-----KRDVTYDSLGNVIENG 882
                                D+   SD  E E+ +  S     K+ + YDSLGN I   
Sbjct: 263 ---------------------DNGAQSDESESEEDSDQSELESDKQSIEYDSLGNAI--- 298

Query: 883 RREFVPETKILESDEEDQQ 939
             + V   K+L    ED++
Sbjct: 299 CIDNVKSRKMLSEGSEDEE 317

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  388 bits (996), Expect = e-133
 Identities = 193/316 (61%), Positives = 233/316 (73%), Gaps = 3/316 (0%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKET--EFPAKLAMWDFDHCDP 171
           M KGKNK  EER  +P +G++ H+ + N +R E+K G       +FP KLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 172 KRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLD 351
           KRCSGKKLERLGLIKSLR+GQKFQGIVVSPNG+ VVCPND+ IVE+HG SVVECSWARLD
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 352 EIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSW 531
           E+PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA ELLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 532 GPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 711
           G GFLELN+ELLE YQQCTD  S+KAAEEAWL+K+EEEA+QR++Q+ EEDIWMMGNVNR+
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

Query: 712 APNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRRE 891
                            E   + + +   + EE E+     + +   +      E    E
Sbjct: 241 RTCDTSEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 300

Query: 892 FVPETKILESDEEDQQ 939
              E +  E +EE+++
Sbjct: 301 EEEEEEEEEEEEEEEE 316

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  382 bits (981), Expect = e-133
 Identities = 193/331 (58%), Positives = 240/331 (72%), Gaps = 20/331 (6%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGH------TKETEFPAKLAMWDFD 159
           MAKGKNK +E R  KP++GS+ H+ ++N +R E+K  +      +KE  FP KLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 160 HCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSW 339
           HCDPKRCSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+DKE VE+ G SVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 340 ARLDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLS 519
           ARLDE+PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 520 HFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGN 699
           HFSWG GFLELN+ELLE YQ+CTD  S+K  EE WL+K+++E ++R+ Q+ E DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 700 VNRKAPNMRXXXXXXXXXXXXEYASD-------VDHDLVSDTEEGEDIAIGSKRDVTYDS 858
            NR   +M             E  ++       + + L+S+ E   +     + +V YD+
Sbjct: 241 TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLISEEENESE----EEEEVRYDA 296

Query: 859 LGNVIENGRREFVPETK------ILESDEED 933
           LGN+IE+   E   E K      ++E DE++
Sbjct: 297 LGNIIES--EEEAAELKYDSLGNLIEDDEQE 325

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  377 bits (969), Expect = e-130
 Identities = 191/324 (58%), Positives = 234/324 (72%), Gaps = 16/324 (4%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKH---GHTKETEFPAKLAMWDFDHCD 168
           MAKGKNK+ E R  KP++GS+ H+ K N +  E+K      +++ +FP KLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 169 PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 348
           PKRCSGK+LERLGLIKSLR+GQKFQG+VVSPNGK V+CPND+EIVE+ G SVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 349 DEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFS 528
           DE+PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 529 WGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNR 708
           WG GFLE+N+ELL+ YQQCTD  S+K AEE WL K+E+E ++R+ Q  E DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 709 --KAPNMRXXXXXXXXXXXXEYASDVDH---------DLVSDTEEGEDIAIGSKR-DVTY 852
                +              +Y  + ++         +++   E+ +D      R +V Y
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESEEDYDDYDDEEDRVEVKY 300

Query: 853 DSLGNVIENGRREFVPETKILESD 924
           DSLGN+IEN   E   E K L  D
Sbjct: 301 DSLGNIIENSDYEQYEEEKELRYD 324

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  372 bits (954), Expect = e-129
 Identities = 193/320 (60%), Positives = 231/320 (72%), Gaps = 10/320 (3%)
 Frame = +1

Query: 1   MAKGKNKKTEERQKPAKGSSK----HNGKSNQRRTELK-HGHTKETEFPAKLAMWDFDHC 165
           MAKGK K      + ++GS K    H+ + N +R EL+ H   K T+FP K+AMWDFDHC
Sbjct: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60

Query: 166 DPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWAR 345
           DPKRCSGKKLERLGLI SL++GQKFQGIVVSPNG+ VVCP+D+ IVE+ G SVVECSWAR
Sbjct: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120

Query: 346 LDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHF 525
           LDE+PF++IGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA +LLS+F
Sbjct: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180

Query: 526 SWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVN 705
           SWG GFLELN+ELLE YQ+CTDH S+K AEE WL K+EEEA+QR+ +  + DIWMMGNVN
Sbjct: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

Query: 706 RKAPNMRXXXXXXXXXXXXE-YASDVDHD----LVSDTEEGEDIAIGSKRDVTYDSLGNV 870
           R   NM             E  AS + +D     + D  + E+  I S   + YD+LGNV
Sbjct: 241 R---NMNKMTLSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEISS---IRYDNLGNV 294

Query: 871 IENGRREFVPETKILESDEE 930
           I            + ESDEE
Sbjct: 295 I------------VDESDEE 302

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  368 bits (945), Expect = e-128
 Identities = 180/287 (62%), Positives = 213/287 (74%), Gaps = 4/287 (1%)
 Frame = +1

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHG---HTKETEFPAKLAMWDFDHCD 168
           M KGKNK  E R  +P +G++ HN K N +  E+KHG   ++ +T FP KL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 169 PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 348
           PKRCSGKKLERLGLI+SLR+GQKFQG+VV+PNG  VVCPNDK IVE+HG SVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 349 DEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFS 528
           DE+PF++IGGRHERLLPYLVAANQVNYGRPW+LNCVEA+AACFAIVGR D A ELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 529 WGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNR 708
           +GP FLE+N ELLE YQQCTD  S+K AE AWL+K+E+E + R+ Q   EDIWM GNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

Query: 709 KAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVT 849
                +            E   D D +   + EE E+     K DV+
Sbjct: 241 MPAASQ--------ESDEEEDEDEDEEEEEEEEEEEEKEEDVKEDVS 279

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  369 bits (948), Expect = e-128
 Identities = 179/314 (57%), Positives = 231/314 (73%), Gaps = 3/314 (0%)
 Frame = +1

Query: 1   MAKGKNKKTEER-QKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 177
           M KGKNK  E + ++  +G++ H+ + N +  E+K+  +++ +FP KLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 178 CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 357
           CSGKKLERLGLI+SLR+GQKFQG+VVSPNG+ VVCPND EIVEQHG SVVECSWARL+E+
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 358 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 537
           PF+KIGG++ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVG+ D A ELLSHFSWG 
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 538 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 717
           GFL+LN+ELLE YQ+CTD  S+K AE+ WL+KLE E ++R+  T + DIWMMGN+NR+  
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRR-- 238

Query: 718 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAI-GSKRDVTYDSLGNVIE-NGRRE 891
                             + V  D +   E+ E   +  S++ + YD+LGN I  +  + 
Sbjct: 239 -----------------GNGVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKS 281

Query: 892 FVPETKILESDEED 933
            +  + + E +E D
Sbjct: 282 RIMLSGVSEDEESD 295

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  362 bits (930), Expect = e-125
 Identities = 185/301 (61%), Positives = 218/301 (72%), Gaps = 6/301 (1%)
 Frame = +1

Query: 49  KGSSK----HNGKSNQRRTELKHG-HTKETEFPAKLAMWDFDHCDPKRCSGKKLERLGLI 213
           KGS+K    H+ +S+    E KHG H     FP KLAMWDFD CDPKRCSGKKLERLG+I
Sbjct: 9   KGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLGII 68

Query: 214 KSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIPFSKIGGRHERL 393
           KSLR+GQKFQGIVVSPNGK VVCPNDK+IVE+ G +VVECSWARL+EIPF+KIGGR+ERL
Sbjct: 69  KSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRNERL 128

Query: 394 LPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPGFLELNQELLET 573
           LPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELL+HFSWG GFLELN+EL+E 
Sbjct: 129 LPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELIEV 188

Query: 574 YQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPNMRXXXXXXXXX 753
           YQ+CTD  S+K AE +WL+K+E EA +RR  +  +D+WM GNVNR++P            
Sbjct: 189 YQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSP-----LGNDTES 243

Query: 754 XXXEYASDVDHDLVSDTEEGEDIAIGS-KRDVTYDSLGNVIENGRREFVPETKILESDEE 930
              E  + VD     D +  +D A G+ KR V YD+LGN       E  P      S+E 
Sbjct: 244 SQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGN-------EIYPSESSESSEER 296

Query: 931 D 933
           D
Sbjct: 297 D 297

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  356 bits (913), Expect = e-122
 Identities = 186/317 (58%), Positives = 224/317 (70%), Gaps = 8/317 (2%)
 Frame = +1

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGK-SNQRRTELKHGHTKETE-FPAKLAMWDFDHCDPK 174
           MAK    K   +Q+ A  S   +G  S  R  E KHG  K  + FP KLAMWDFD CDPK
Sbjct: 1   MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPK 60

Query: 175 RCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDE 354
           RCSGKKLERLG+IKSLR+GQKFQGIVVSPNGK+VVCPND+ IVE++G +VVECSWARLDE
Sbjct: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120

Query: 355 IPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWG 534
           +PF+KIGGR+ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELLSHFSWG
Sbjct: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180

Query: 535 PGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKA 714
             FLELN+ELLE YQ+CTD  SIK AE+AWL+++E+EA++R+ +   +D+W+ GNVN K 
Sbjct: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240

Query: 715 PNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKR---DVTYDSLGNVI---E 876
            +              E  S  +    S+ E  E  A G +     V YDSLGN I   E
Sbjct: 241 GH---GVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEITLSE 297

Query: 877 NGRREFVPETKILESDE 927
           +   E+    ++LE  +
Sbjct: 298 SSDPEYSDSEELLEEPD 314

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  346 bits (887), Expect = e-119
 Identities = 173/328 (52%), Positives = 231/328 (70%), Gaps = 15/328 (4%)
 Frame = +1

Query: 1   MAKGKNKKTEE---RQKPAKGSSKHNGKSNQRRTELKHGHTKET----EFPAKLAMWDFD 159
           M KGKNKK ++   + +  +G++ H+ + N +  E++    ++T    + P KL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 160 HCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSW 339
           HCDPKRCSGKKLERLGLIKSL+IGQ+FQG+++SPNGK VV P D +I+++ G +VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 340 ARLDEIPFSKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAE 507
           ARLDEIPFSK+    GG++ERLLPYLVAANQVNYGRPW+LNCVEA+AACFAI+GR+D A 
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 508 ELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIW 687
           +LLS+FSWG  FL LN+EL E Y QCTD  SI+ A+EAWL K++EEA++R+ Q  + DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 688 MMGNVNRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGN 867
           +MGN NR   N+R               SD D D   + E+ ED    +++ V YD+LGN
Sbjct: 241 LMGNTNRVNDNLRDLT-----------LSDGDED--EEEEDAEDYL--TEKSVKYDNLGN 285

Query: 868 VIENGRREFVPE----TKILESDEEDQQ 939
           VIE+   E          ++E +EE+++
Sbjct: 286 VIESSEDEITLRYDNLGNVIEEEEEEKR 313

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
            Anc_6.19 YOR006C
          Length = 401

 Score =  343 bits (880), Expect = e-116
 Identities = 178/350 (50%), Positives = 234/350 (66%), Gaps = 37/350 (10%)
 Frame = +1

Query: 1    MAKGKNKKTEERQKPAK---GSSKHNGKSNQRRTELK-HGHTKETEF------------- 129
            M KGKNK  ++  K  +   G++ H+ + N +  E+K H     T+              
Sbjct: 45   MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 130  ----PAKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKE 297
                P KL MWDFDHCDPKRCSGKKLERLGLIKSL+IGQ+FQG+++SPNGK VV P+D +
Sbjct: 105  VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 298  IVEQHGVSVVECSWARLDEIPFSKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAI 465
            I+++ G +VVECSWARLDEIPFSK+    GG++ERLLPYLVAANQVNYGRPW+LNCVEA+
Sbjct: 165  IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 466  AACFAIVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEE 645
            AACFAI+GR+D A +LLS+FSWG  FL+LN+EL E Y +CTD  S+KAA+E WL K+E+E
Sbjct: 225  AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 646  AEQRRKQTHEEDIWMMGNVNRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIA 825
            A +R+ Q  E DIWMMGN NR   N+R               SD D +   + +E ED  
Sbjct: 285  ATERKLQAQETDIWMMGNTNRLDANLRSMN-----------ISDEDEEEEEEYDEEEDGG 333

Query: 826  --IGSKRDVTYDSLGNVIENGRREFVPETK----------ILESDEEDQQ 939
              I   +++ YD+LGNVIE+   E++ E +          I+ES+EE+++
Sbjct: 334  EHITRNKELRYDNLGNVIEDTDEEYLSEEEKEIRYDNLGNIIESEEEEEE 383

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  327 bits (837), Expect = e-111
 Identities = 171/304 (56%), Positives = 209/304 (68%), Gaps = 7/304 (2%)
 Frame = +1

Query: 1   MAKGKNK----KTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCD 168
           MAKGK K    KT         S+ H+ + N ++ E K   ++ET FP KLAMWDFDHCD
Sbjct: 1   MAKGKGKNKLGKTGGNGAIRTNSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCD 60

Query: 169 PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 348
           PKRCSGKKLERL LI+SL+I QKFQGI VSPNGK  V P D+E+V + G +VVECSWAR+
Sbjct: 61  PKRCSGKKLERLNLIRSLKINQKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARI 120

Query: 349 DEIPFSKIG-GRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHF 525
           DEIPFSK    + +RLLPYLVAANQVNYGRPW+LNCVEAIAAC AIVG  DLAEELLSHF
Sbjct: 121 DEIPFSKFSTPKLDRLLPYLVAANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHF 180

Query: 526 SWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEE--DIWMMGN 699
           SWG  FL+LN+ELLE YQQCTD   I+AA++AW+ ++E+E ++R+   + +  DIWM GN
Sbjct: 181 SWGVNFLKLNRELLEIYQQCTDSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGN 240

Query: 700 VNRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIEN 879
           VNR                      + D D  ++ E+ ED       +VTYD+LGN+IEN
Sbjct: 241 VNR--------------------IDESDED--NEDEDSED------EEVTYDNLGNIIEN 272

Query: 880 GRRE 891
             RE
Sbjct: 273 EPRE 276

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  311 bits (798), Expect = e-105
 Identities = 163/299 (54%), Positives = 204/299 (68%), Gaps = 6/299 (2%)
 Frame = +1

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQ-RRTELKHG---HTKETEFPAKLAMWDFDHCD 168
           MAKGKNK  EER          N KSN  RR E KH     + +T FP KLAMWDFDHCD
Sbjct: 1   MAKGKNKGHEERS---------NRKSNNSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCD 51

Query: 169 PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 348
           PKRCSGKKLER GL +SLR+GQ+F G+VVSPNGK VV P D+E +EQ+G++VVECSWARL
Sbjct: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111

Query: 349 DEIPFSKIGGR--HERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSH 522
           DE+PF+K+GG+  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A ++L  
Sbjct: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171

Query: 523 FSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNV 702
           FSWG  FLELN ELL+ Y  CTD  S++ A++ WL+K+E E ++R+++ +  D W++GN 
Sbjct: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231

Query: 703 NRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIEN 879
           NRK  N                    D D  S++ E ++I+  S  D  YD+LGN+I N
Sbjct: 232 NRKNLN--------------------DFDNSSESTE-DNISTVSSADERYDALGNLISN 269

>Kwal_23.5227 s23 (1067468..1067797) [330 bp, 109 aa] {OFF} [contig
           8] FULL
          Length = 109

 Score = 33.1 bits (74), Expect = 0.25
 Identities = 14/31 (45%), Positives = 17/31 (54%)
 Frame = -2

Query: 296 SLSFGQTTVFPFGDTTIPWNFWPMRSDFISP 204
           SLSF  T V P   +T+P   WP+ S F  P
Sbjct: 43  SLSFRSTLVVPLMSSTVPSPLWPLNSPFFKP 73

>TBLA0B05200 Chr2 complement(1221706..1224144) [2439 bp, 812 aa]
           {ON} Anc_6.184 YPL186C
          Length = 812

 Score = 34.7 bits (78), Expect = 0.37
 Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +1

Query: 556 QELLETYQQCTDHASIKAA-EEAWLQKLEEEAEQRRKQTHEE 678
           + LLE  Q+  + A +K   EEA L+K +EEAE +RKQ  EE
Sbjct: 319 KRLLELEQKLKEEAELKRKQEEAELKKKQEEAELKRKQEEEE 360

 Score = 30.4 bits (67), Expect = 7.8
 Identities = 17/45 (37%), Positives = 26/45 (57%)
 Frame = +1

Query: 544 LELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEE 678
           L+  QE  E  ++  +    +  EEA L++ +EEAE +RKQ  EE
Sbjct: 363 LKRKQEEAELKKKQEEEERKRKQEEAELKRKQEEAELKRKQEEEE 407

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 33.9 bits (76), Expect = 0.65
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 4/103 (3%)
 Frame = +1

Query: 379 RHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHF--SWGPGFLEL 552
           ++E+  P L+ A +    +  ++  +E I A    VG  D A E L  F  +       L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 553 NQEL--LETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHE 675
           N+E+  L   Q+ TD+     A EA +++LEE+ E + + + E
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKE 157

>KLLA0D04136g Chr4 (350976..352124) [1149 bp, 382 aa] {ON} conserved
           hypothetical protein
          Length = 382

 Score = 33.1 bits (74), Expect = 0.94
 Identities = 28/115 (24%), Positives = 47/115 (40%)
 Frame = +1

Query: 526 SWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVN 705
           S GPG ++  +E  E  ++  +    +  EE   ++ EEE EQ++ Q  EE+  + G   
Sbjct: 114 SKGPGLIQFGEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEQKQDQEQEEEDQVEGQEE 173

Query: 706 RKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNV 870
               +              E A       + +T + ED+ +  K    YD LG V
Sbjct: 174 VDKDDFE------NAWEILELARSYYESSLKETPDNEDLKL--KLSECYDLLGEV 220

>NCAS0A11650 Chr1 (2316596..2320939) [4344 bp, 1447 aa] {ON}
           Anc_3.460 YGR116W
          Length = 1447

 Score = 32.3 bits (72), Expect = 2.1
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +1

Query: 763 EYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVPETKILESDEEDQQ 939
           E A DV+    SD EEGED+   S+ D   D      +      + E  I++ ++ED Q
Sbjct: 15  EVAQDVEDKPPSDEEEGEDVFDSSEEDADLDE-----DEDEARKIKEGFIVDDEDEDDQ 68

>Ecym_3182 Chr3 (348541..348543,348610..348954) [348 bp, 115 aa]
           {ON} similar to Ashbya gossypii AAL076W
          Length = 115

 Score = 30.4 bits (67), Expect = 2.4
 Identities = 19/56 (33%), Positives = 30/56 (53%)
 Frame = +1

Query: 547 ELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKA 714
           E+N+   +  Q+  DH   +AA   W + LE+EAE R+ QT  E I  + +  + A
Sbjct: 42  EINEYKAQMDQELRDH---EAANVGWAENLEKEAE-RKVQTELEQIKRLSSQKKDA 93

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score = 32.0 bits (71), Expect = 2.5
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 7/65 (10%)
 Frame = +1

Query: 763 EYASDVDH----DLVSDTEEGEDIAI---GSKRDVTYDSLGNVIENGRREFVPETKILES 921
           + A D+DH    D VSD + G+D  I     K++  YD+L  ++++   E  P+ +  E+
Sbjct: 44  DVAEDIDHRSDEDEVSDVDSGDDFDIEDEEGKKEKVYDALLTILKSEHPE--PKRRRREA 101

Query: 922 DEEDQ 936
           DE ++
Sbjct: 102 DESNK 106

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 31.6 bits (70), Expect = 3.3
 Identities = 23/85 (27%), Positives = 34/85 (40%), Gaps = 1/85 (1%)
 Frame = -3

Query: 532 PTKNAIGALPPGPSCQQLQNKPL*PPHSSASMVGHSSLGWPRPSMAVTAHDARQSWKMES 353
           P++NA    PP P     Q   + P   +    G+   G P P +    +D         
Sbjct: 483 PSRNAANVAPPPPP--STQKSEVQPQTENEPEKGNDEQGSPAPPLPSRTYDQEPP----- 535

Query: 352 HQDVPRSTQQQKHHA-APQFPCRSG 281
              +P   Q+++  A APQ P RSG
Sbjct: 536 APSLPSRKQEEEEEAPAPQLPSRSG 560

>KAFR0D04320 Chr4 complement(847765..852117) [4353 bp, 1450 aa] {ON}
           Anc_5.383 YDR334W
          Length = 1450

 Score = 31.6 bits (70), Expect = 3.6
 Identities = 45/172 (26%), Positives = 73/172 (42%), Gaps = 25/172 (14%)
 Frame = +1

Query: 499 LAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAW---------LQKLEEEAE 651
           +++ +  HF    G  E  ++  E +++    A+++A ++ W         L+K EEE  
Sbjct: 349 VSQMIEQHFRHIAGAEERKEKDEERHKKALARATMQAVKKRWTIAEKAFRVLKKDEEEQL 408

Query: 652 QR-RKQTH-----EEDIWMMG-----NVNRKAPN-MRXXXXXXXXXXXXEYASDVDHD-- 789
           QR + + H     E+   ++G     NVN  + N +                SD + D  
Sbjct: 409 QRIQGKKHLSKILEQSSQLLGAQLNQNVNDTSENEISEDRQNKSDVAELTGTSDDEEDDI 468

Query: 790 LVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVPETKIL--ESDEEDQQ 939
           L S +EEG+ I   S+R  T D    V E   +   PE+ IL   S  ED Q
Sbjct: 469 LTSSSEEGDVIISASERSTTADESLTVNELKEKYLEPESAILLPNSTVEDGQ 520

>CAGL0D05368g Chr4 complement(513884..514225) [342 bp, 113 aa] {ON}
           similar to uniprot|P32570 Saccharomyces cerevisiae
           YBR253w SRB6 DNA-directed RNA polymerase II suppressor
           protein
          Length = 113

 Score = 29.6 bits (65), Expect = 4.4
 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +1

Query: 553 NQELLETYQQCTDHASIKAAEEAWLQKLE--EEAEQRRKQTHEEDIWMMGN 699
           NQ LLET  Q T+  S+K AE A L  +E  E+ E  +       + M+ N
Sbjct: 3   NQALLETLNQTTELLSVKLAELAKLASMETNEDTEDCQLSVVTNGLMMVNN 53

>KAFR0B03670 Chr2 complement(766212..766817) [606 bp, 201 aa] {ON}
           Anc_8.823 YMR269W
          Length = 201

 Score = 30.4 bits (67), Expect = 4.8
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +1

Query: 7   KGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAK 138
           K K+KK + R KP    SK   KSN+ + + +H    + E  +K
Sbjct: 150 KKKDKKKDGRHKPKSKHSKEVKKSNKEKRDRRHKKLSKKEHSSK 193

>Smik_5.333 Chr5 complement(498906..499907) [1002 bp, 333 aa] {ON}
           YER161C (REAL)
          Length = 333

 Score = 30.8 bits (68), Expect = 4.8
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +1

Query: 544 LELNQ-ELLETYQQCTDHASIK-AAEEAWLQKLEEEAEQRRKQTH 672
           +E N+ E+LE  +     A ++   EEAWL+K EEE ++R+K  H
Sbjct: 289 MEANEMEILEEEEIARKMAKLEDKREEAWLKKHEEEKKRRKKGIH 333

>AGR198C Chr7 complement(1125892..1127383,1127431..1127486) [1548
           bp, 515 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YPL089C (RLM1) and YBR182C (SMP1); 1-intron
          Length = 515

 Score = 30.8 bits (68), Expect = 5.5
 Identities = 32/125 (25%), Positives = 47/125 (37%), Gaps = 4/125 (3%)
 Frame = -3

Query: 763 PSPSCRRYLACWTSYSVPFG*HCPSSRYPLHASAFCAARLPPRASEAM----PPPQLLWK 596
           P P   ++ +    +  PF  +  S + P H S+     LP R    +    P P+    
Sbjct: 202 PQPQRSQHPSMHPPFQKPFHPYHASGQAPAHDSSGARGALPARREPCLLNAGPAPEPAAS 261

Query: 595 RGPCIAGRFLVALGLVLRSQAPTKNAIGALPPGPSCQQLQNKPL*PPHSSASMVGHSSLG 416
               + G    A   VLR Q PT N+ G++   PS     +    P  S  +  G   L 
Sbjct: 262 PSAPM-GTAKQATRPVLRVQIPTSNSTGSIKSQPSSHSSNDTIDHPKQSQFTKNGQLEL- 319

Query: 415 WPRPS 401
            P PS
Sbjct: 320 -PNPS 323

>Kpol_1029.4 s1029 complement(4715..8119) [3405 bp, 1134 aa] {ON}
            complement(4715..8119) [3405 nt, 1135 aa]
          Length = 1134

 Score = 30.8 bits (68), Expect = 6.1
 Identities = 31/130 (23%), Positives = 46/130 (35%)
 Frame = -3

Query: 700  HCPSSRYPLHASAFCAARLPPRASEAMPPPQLLWKRGPCIAGRFLVALGLVLRSQAPTKN 521
            H   S   L  S+    R PP      PPP ++      +   F  A+          K+
Sbjct: 989  HKAMSSTDLGTSSSLDMRTPPPRKSTSPPPPIVPSARKVLPPGFTEAI-------LTPKS 1041

Query: 520  AIGALPPGPSCQQLQNKPL*PPHSSASMVGHSSLGWPRPSMAVTAHDARQSWKMESHQDV 341
               +LP   S   +  K   PP        HSS+  P P+ A      +   K ++ QD 
Sbjct: 1042 TSSSLPLTKSPDPISRKTPPPPPKH-----HSSIVSPPPASATKIEKVKNDGK-DNSQDA 1095

Query: 340  PRSTQQQKHH 311
              +TQ  + H
Sbjct: 1096 KPNTQASEEH 1105

>Skud_5.300 Chr5 complement(484388..485389) [1002 bp, 333 aa] {ON}
           YER161C (REAL)
          Length = 333

 Score = 30.4 bits (67), Expect = 6.4
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +1

Query: 544 LELNQ-ELLETYQQCTDHASIK-AAEEAWLQKLEEEAEQRRKQTH 672
           +E N+ E+LE  +     A ++   EEAWL+K EE+ ++R+K  H
Sbjct: 289 MEANEMEILEEEEVARKMARLEDKREEAWLKKHEEDKKRRKKDIH 333

>Smik_4.231 Chr4 complement(420155..421477) [1323 bp, 440 aa] {ON}
           YDL005C (REAL)
          Length = 440

 Score = 30.4 bits (67), Expect = 7.0
 Identities = 18/60 (30%), Positives = 33/60 (55%)
 Frame = +1

Query: 499 LAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEE 678
           + ++L +  S    +LE   EL +  ++  + A  K AEE  L+K +E+ E +++Q  EE
Sbjct: 83  ILDDLETSLSQSSSYLETLTELGKEKEKEREEAEKKRAEEENLRKAKEQQELKKRQELEE 142

>Kwal_14.1328 s14 complement(280218..282539) [2322 bp, 773 aa] {ON}
           YLR337C (VRP1) - 1:1 [contig 243] FULL
          Length = 773

 Score = 30.4 bits (67), Expect = 7.8
 Identities = 20/49 (40%), Positives = 24/49 (48%)
 Frame = -3

Query: 538 QAPTKNAIGALPPGPSCQQLQNKPL*PPHSSASMVGHSSLGWPRPSMAV 392
           Q PT +A    PP PS  Q+   PL P  S      H SLG P PS ++
Sbjct: 578 QPPTSSA----PPVPSLPQMGPPPLPPTLSPKMGQEHPSLGPPAPSSSM 622

>NCAS0I02110 Chr9 (396834..399368) [2535 bp, 844 aa] {ON} Anc_3.156
           YDL035C
          Length = 844

 Score = 30.4 bits (67), Expect = 7.9
 Identities = 19/45 (42%), Positives = 22/45 (48%)
 Frame = +1

Query: 10  GKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLA 144
           G N  T   Q+PA      +G SNQ+ TEL H H    EF   LA
Sbjct: 467 GSNISTNTSQRPAT----QDGTSNQKTTELLH-HLDNVEFDENLA 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,875,740
Number of extensions: 1848565
Number of successful extensions: 7279
Number of sequences better than 10.0: 38
Number of HSP's gapped: 7163
Number of HSP's successfully gapped: 39
Length of query: 314
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 205
Effective length of database: 40,982,805
Effective search space: 8401475025
Effective search space used: 8401475025
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 33 (17.3 bits)