Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR007W6.19ON31331316110.0
KLLA0D01111g6.19ON31429110301e-140
Ecym_30236.19ON34928110181e-138
SAKL0E01144g6.19ON43024010151e-136
YOR006C (TSR3)6.19ON3132929971e-135
Smik_15.1756.19ON3122399911e-135
TDEL0G045006.19ON3012429861e-134
TPHA0J003206.19ON3422989821e-133
CAGL0E02717g6.19ON3253199801e-133
Suva_15.1816.19ON3362389801e-133
Kpol_1037.246.19ON3663289781e-132
KNAG0M011506.19ON3072989651e-131
ZYRO0C07832g6.19ON2812409581e-130
Skud_15.1676.19ON3122939551e-129
Kwal_56.224216.19ON3372819271e-124
KLTH0C11264g6.19ON3463149191e-123
NCAS0H008106.19ON3233108631e-115
NDAI0D007906.19ON4013188491e-112
KAFR0L003906.19ON3292838231e-109
TBLA0A072506.19ON3042998141e-108
CAGL0E03454g4.46ON867103731.2
NCAS0I021103.156ON84445702.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR007W
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   625   0.0  
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   401   e-140
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   396   e-138
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   395   e-136
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   388   e-135
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   386   e-135
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   384   e-134
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   382   e-133
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   382   e-133
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   382   e-133
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   381   e-132
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   376   e-131
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   373   e-130
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   372   e-129
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   361   e-124
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   358   e-123
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   337   e-115
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   331   e-112
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   321   e-109
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   318   e-108
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    33   1.2  
NCAS0I02110 Chr9 (396834..399368) [2535 bp, 844 aa] {ON} Anc_3.1...    32   2.9  

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/313 (96%), Positives = 301/313 (96%)

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60
           MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC
Sbjct: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60

Query: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120
           SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP
Sbjct: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120

Query: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180
           FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG
Sbjct: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180

Query: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 240
           FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN
Sbjct: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 240

Query: 241 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVP 300
           MR            EYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVP
Sbjct: 241 MRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRREFVP 300

Query: 301 ETKILESDEEDQQ 313
           ETKILESDEEDQQ
Sbjct: 301 ETKILESDEEDQQ 313

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  401 bits (1030), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/291 (65%), Positives = 229/291 (78%), Gaps = 17/291 (5%)

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60
           M KGKNK++  R +  KGS+ H+ + N +R E+KH  +  ++FP KLAMWDFDHCDPKRC
Sbjct: 1   MGKGKNKESSTRPRSQKGSNGHSSRLNHKRMEMKHVDSTTSKFPVKLAMWDFDHCDPKRC 60

Query: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120
           SGKKLERLGLIKSLR+GQKFQG+VVSPNGKTVVCP+DK +VE++G SVVECSWARLDE+P
Sbjct: 61  SGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDEVP 120

Query: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180
           F+KIGG++ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA +LLS+FSWGP 
Sbjct: 121 FNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWGPA 180

Query: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 240
           FLELN+ELL+ YQQCTDH S+KAAEE WLQK+E+EA +R++Q   EDIWM+GNVNR +  
Sbjct: 181 FLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNRAS-- 238

Query: 241 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291
            R            +Y   ++ D + D            RD+ YDSLGNVI
Sbjct: 239 -RDLPGSSGEEEEEDY---LNGDSLIDV-----------RDIKYDSLGNVI 274

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  396 bits (1018), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 220/281 (78%), Gaps = 2/281 (0%)

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRC 60
           M KG+NK  + +    KGS+ H+ ++N RR E K+   + ++FP  LAMWDFDHCDPKRC
Sbjct: 1   MGKGRNKDYD-KNHSQKGSNGHSSRTNHRRIETKYNAIQGSKFPVTLAMWDFDHCDPKRC 59

Query: 61  SGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIP 120
           SGKKLERLGLIKSLR+ QKFQGIVVSPNGKTVVCPND+EI E++GVSVVECSWARL+EIP
Sbjct: 60  SGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEIP 119

Query: 121 FSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPG 180
           F KIGGRHERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLAE LLSHFSWG G
Sbjct: 120 FEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWGLG 179

Query: 181 FLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPN 240
           FLELN+E+LE YQ+CTDH SIKAAEEAWL+++E EA +RRKQT E DIWMMGNVNRK  +
Sbjct: 180 FLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRKNAS 239

Query: 241 MRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRD 281
                         +  SD   DL SD+     +A  SK D
Sbjct: 240 KELHPYSDIDDIDEDETSDFKSDL-SDSNNDLCVANISKED 279

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  395 bits (1015), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/240 (76%), Positives = 211/240 (87%), Gaps = 3/240 (1%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHG--HTKETEFPAKLAMWDFDHCDP 57
           M KGKNK  EER  +P +G++ H+ + N +R E+K G   +   +FP KLAMWDFDHCDP
Sbjct: 1   MGKGKNKNHEERSSRPHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 58  KRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLD 117
           KRCSGKKLERLGLIKSLR+GQKFQGIVVSPNG+ VVCPND+ IVE+HG SVVECSWARLD
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 118 EIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSW 177
           E+PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA ELLS+FSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 178 GPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237
           G GFLELN+ELLE YQQCTD  S+KAAEEAWL+K+EEEA+QR++Q+ EEDIWMMGNVNR+
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNRR 240

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/292 (64%), Positives = 224/292 (76%), Gaps = 19/292 (6%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59
           M KGKNK  E +  +P +G++ H+ + N RR E+K+ ++++ +FP KLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+D EIVEQHG SVVECSWARL+E+
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239
           GFLELN+ELLE YQQCTD  S+K AEE WLQKLE+E ++R+ +  EEDIWMMGN+NR+  
Sbjct: 181 GFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRG- 239

Query: 240 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291
                             S  D     +  E  D+  G+ + + YDSLGN I
Sbjct: 240 ----------------NGSQSDTSESEENSEQSDLE-GNNQCIEYDSLGNAI 274

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  386 bits (991), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 206/239 (86%), Gaps = 1/239 (0%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59
           M KGKNK  E +  +P +G++ H+ + N RR E+K+ ++ + +FP KLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+D E+VEQHG SVVECSWARL+E+
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 121 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWGM 180

Query: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKA 238
           GFLELN+ELLE YQQCTD  S+K AEE WLQKLE+E ++R+ Q  EEDIWMMGN+NR+ 
Sbjct: 181 GFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRRG 239

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  384 bits (986), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/242 (73%), Positives = 204/242 (84%), Gaps = 2/242 (0%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59
           M+KGKNK  E +     KGS+ H+ + N +R E+K G T++T+FP KLAMWDFDHCDPKR
Sbjct: 1   MSKGKNKNREAKNGHSGKGSNGHSSRQNHKRMEMKRG-TEDTKFPVKLAMWDFDHCDPKR 59

Query: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNG  VVCP+DK IVE+HG SVVECSWARLDE+
Sbjct: 60  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWARLDEV 119

Query: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179
           PF+KIGG+HERLLPYLVAANQVNYGRPW+LNCVEA+AACFAIVGR D A ELLSHFSWG 
Sbjct: 120 PFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSHFSWGL 179

Query: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239
           GFLELNQELLE YQQCTD  S+KAAE AWL K+++E E+R+ Q  +EDIWM GNVNRK  
Sbjct: 180 GFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNVNRKGT 239

Query: 240 NM 241
             
Sbjct: 240 TF 241

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  382 bits (982), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/298 (62%), Positives = 226/298 (75%), Gaps = 27/298 (9%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKH------GHTKETEFPAKLAMWDFD 53
           MAKGKNK +E R  KP++GS+ H+ ++N +R E+K        ++KE  FP KLAMWDFD
Sbjct: 1   MAKGKNKSSETRSGKPSRGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 54  HCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSW 113
           HCDPKRCSGKKLERLGLIKSLR+GQKFQGIVVSPNGK VVCP+DKE VE+ G SVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 114 ARLDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLS 173
           ARLDE+PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 174 HFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGN 233
           HFSWG GFLELN+ELLE YQ+CTD  S+K  EE WL+K+++E ++R+ Q+ E DIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 234 VNRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291
            NR   +M                SD D +  S+    E+    ++R + YD+LGNV+
Sbjct: 241 TNRDLQDM----------------SD-DEEFDSEQYYSEE---NTERKIRYDNLGNVL 278

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/319 (58%), Positives = 230/319 (72%), Gaps = 21/319 (6%)

Query: 2   AKGKNKKTEE-RQKPAKGSSKHNGKSNQRRTELKH-GHTKETEFPAKLAMWDFDHCDPKR 59
            KGKNK  +E R   + GS+ H+ + N R  E+K+ G +K++ FP KLAMWDFDHCDPKR
Sbjct: 4   GKGKNKSHDEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHCDPKR 63

Query: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNGK+VVCP+D+EIVE HG SVVECSWARL+E+
Sbjct: 64  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWARLEEV 123

Query: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGRTDLA ELLSHFSWG 
Sbjct: 124 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHFSWGL 183

Query: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239
           GFLELN++LLE YQQCTD  SIK  EE WLQ++++E ++R+ +   ED+WMMGN NR   
Sbjct: 184 GFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTNRGNS 243

Query: 240 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIE-----NG 294
            +                 + D                ++++V YD+LGN+IE     N 
Sbjct: 244 GLMPPSDSEEEYEEEAEEEEED--------------TTTRKNVRYDNLGNIIEDSEDDNN 289

Query: 295 RREFVPETKILESDEEDQQ 313
             ++  E    E+ +ED +
Sbjct: 290 ESDYSNEESSDEASDEDYE 308

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  382 bits (980), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 174/238 (73%), Positives = 205/238 (86%), Gaps = 1/238 (0%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59
           M KGKNK  E +  +P +G++ H+ + N +R E+K+ +++ T FP KLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119
           CSGKKLERLGLIKSLR+GQKFQGIVVSPNG  VVCP+D E+VEQHG SVVECSWARL+E+
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179
           PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A  LLSHFSWG 
Sbjct: 145 PFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWGL 204

Query: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRK 237
           GFL+LN+ELLE YQ+CTD  S+K AEE WLQKLE+E ++R+ Q+ +EDIWMMGNVNRK
Sbjct: 205 GFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  381 bits (978), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 193/328 (58%), Positives = 236/328 (71%), Gaps = 24/328 (7%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELK-HGH--TKETEFPAKLAMWDFDHCD 56
           MAKGKNK+ E R  KP++GS+ H+ K N +  E+K +G   +++ +FP KLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 57  PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 116
           PKRCSGK+LERLGLIKSLR+GQKFQG+VVSPNGK V+CPND+EIVE+ G SVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 117 DEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFS 176
           DE+PF+KIGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR D A ELLS+FS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 177 WGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNR 236
           WG GFLE+N+ELL+ YQQCTD  S+K AEE WL K+E+E ++R+ Q  E DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 237 KAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGS----------------KR 280
              NM               + D D++  ++ +      +G+                + 
Sbjct: 241 ---NMNGDDDEEEGNSYEALSGD-DYEEENNNKSARYDNLGNIIESEEDYDDYDDEEDRV 296

Query: 281 DVTYDSLGNVIENGRREFVPETKILESD 308
           +V YDSLGN+IEN   E   E K L  D
Sbjct: 297 EVKYDSLGNIIENSDYEQYEEEKELRYD 324

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  376 bits (965), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/298 (62%), Positives = 222/298 (74%), Gaps = 10/298 (3%)

Query: 1   MAKGKNKKT----EERQKPAKGSSKHNGKSNQRRTELK-HGHTKETEFPAKLAMWDFDHC 55
           MAKGK K      E  +   KGS+ H+ + N +R EL+ H   K T+FP K+AMWDFDHC
Sbjct: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60

Query: 56  DPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWAR 115
           DPKRCSGKKLERLGLI SL++GQKFQGIVVSPNG+ VVCP+D+ IVE+ G SVVECSWAR
Sbjct: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120

Query: 116 LDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHF 175
           LDE+PF++IGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA +LLS+F
Sbjct: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180

Query: 176 SWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVN 235
           SWG GFLELN+ELLE YQ+CTDH S+K AEE WL K+EEEA+QR+ +  + DIWMMGNVN
Sbjct: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

Query: 236 RKAPNMRXXXXXXXXXXXXEYASDVDH--DLVSDTEEGEDIAIGSKRDVTYDSLGNVI 291
           R    M               +   D+  + + D  + E+  I S R   YD+LGNVI
Sbjct: 241 RNMNKMTLSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEISSIR---YDNLGNVI 295

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  373 bits (958), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 199/240 (82%), Gaps = 4/240 (1%)

Query: 1   MAKGKNKKTEERQ-KPAKGSSKHNGKSNQRRTELKHG---HTKETEFPAKLAMWDFDHCD 56
           M KGKNK  E R  +P +G++ HN K N +  E+KHG   ++ +T FP KL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 57  PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 116
           PKRCSGKKLERLGLI+SLR+GQKFQG+VV+PNG  VVCPNDK IVE+HG SVVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 117 DEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFS 176
           DE+PF++IGGRHERLLPYLVAANQVNYGRPW+LNCVEA+AACFAIVGR D A ELLS+FS
Sbjct: 121 DEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNFS 180

Query: 177 WGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNR 236
           +GP FLE+N ELLE YQQCTD  S+K AE AWL+K+E+E + R+ Q   EDIWM GNVNR
Sbjct: 181 YGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVNR 240

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 222/293 (75%), Gaps = 21/293 (7%)

Query: 1   MAKGKNKKTEER-QKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKR 59
           M KGKNK  E + ++  +G++ H+ + N +  E+K+  +++ +FP KLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 60  CSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEI 119
           CSGKKLERLGLI+SLR+GQKFQG+VVSPNG+ VVCPND EIVEQHG SVVECSWARL+E+
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 120 PFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGP 179
           PF+KIGG++ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVG+ D A ELLSHFSWG 
Sbjct: 121 PFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWGL 180

Query: 180 GFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAP 239
           GFL+LN+ELLE YQ+CTD  S+K AE+ WL+KLE E ++R+  T + DIWMMGN+NR+  
Sbjct: 181 GFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRR-- 238

Query: 240 NMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAI-GSKRDVTYDSLGNVI 291
                             + V  D +   E+ E   +  S++ + YD+LGN I
Sbjct: 239 -----------------GNGVQSDELESGEDSEQSGLENSEQPIEYDALGNAI 274

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 181/281 (64%), Positives = 213/281 (75%), Gaps = 11/281 (3%)

Query: 17  KGSSK----HNGKSNQRRTELKHG-HTKETEFPAKLAMWDFDHCDPKRCSGKKLERLGLI 71
           KGS+K    H+ +S+    E KHG H     FP KLAMWDFD CDPKRCSGKKLERLG+I
Sbjct: 9   KGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKLERLGII 68

Query: 72  KSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIPFSKIGGRHERL 131
           KSLR+GQKFQGIVVSPNGK VVCPNDK+IVE+ G +VVECSWARL+EIPF+KIGGR+ERL
Sbjct: 69  KSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIGGRNERL 128

Query: 132 LPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPGFLELNQELLET 191
           LPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELL+HFSWG GFLELN+EL+E 
Sbjct: 129 LPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELNKELIEV 188

Query: 192 YQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKAPNMRXXXXXXXXX 251
           YQ+CTD  S+K AE +WL+K+E EA +RR  +  +D+WM GNVNR++P            
Sbjct: 189 YQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNRRSP-----LGNDTES 243

Query: 252 XXXEYASDVDHDLVSDTEEGEDIAIGS-KRDVTYDSLGNVI 291
              E  + VD     D +  +D A G+ KR V YD+LGN I
Sbjct: 244 SQEESENSVDTGDEEDDDNEDDYATGNRKRVVKYDNLGNEI 284

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  358 bits (919), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 223/314 (71%), Gaps = 11/314 (3%)

Query: 1   MAKGKNKKTEERQKPAKGSSKHNG-KSNQRRTELKHGHTKETE-FPAKLAMWDFDHCDPK 58
           MAK    K   +Q+ A  S   +G  S  R  E KHG  K  + FP KLAMWDFD CDPK
Sbjct: 1   MAKSSKGKGSNKQRGAHSSKPSSGHTSTHRHVESKHGANKSGKNFPVKLAMWDFDQCDPK 60

Query: 59  RCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDE 118
           RCSGKKLERLG+IKSLR+GQKFQGIVVSPNGK+VVCPND+ IVE++G +VVECSWARLDE
Sbjct: 61  RCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARLDE 120

Query: 119 IPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWG 178
           +PF+KIGGR+ERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA ELLSHFSWG
Sbjct: 121 VPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFSWG 180

Query: 179 PGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVNRKA 238
             FLELN+ELLE YQ+CTD  SIK AE+AWL+++E+EA++R+ +   +D+W+ GNVN K 
Sbjct: 181 LQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVNHKK 240

Query: 239 PNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKR---DVTYDSLGNVI---E 292
            +              E  S  +    S+ E  E  A G +     V YDSLGN I   E
Sbjct: 241 GH---GVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYHGPVKYDSLGNEITLSE 297

Query: 293 NGRREFVPETKILE 306
           +   E+    ++LE
Sbjct: 298 SSDPEYSDSEELLE 311

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  337 bits (863), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/310 (52%), Positives = 215/310 (69%), Gaps = 26/310 (8%)

Query: 1   MAKGKNKKTEE---RQKPAKGSSKHNGKSNQRRTELKHGHTKET----EFPAKLAMWDFD 53
           M KGKNKK ++   + +  +G++ H+ + N +  E++    ++T    + P KL MWDFD
Sbjct: 1   MGKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFD 60

Query: 54  HCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSW 113
           HCDPKRCSGKKLERLGLIKSL+IGQ+FQG+++SPNGK VV P D +I+++ G +VVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSW 120

Query: 114 ARLDEIPFSKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAE 169
           ARLDEIPFSK+    GG++ERLLPYLVAANQVNYGRPW+LNCVEA+AACFAI+GR+D A 
Sbjct: 121 ARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAA 180

Query: 170 ELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIW 229
           +LLS+FSWG  FL LN+EL E Y QCTD  SI+ A+EAWL K++EEA++R+ Q  + DIW
Sbjct: 181 DLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIW 240

Query: 230 MMGNVNRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGN 289
           +MGN NR   N+R            E  +                   +++ V YD+LGN
Sbjct: 241 LMGNTNRVNDNLRDLTLSDGDEDEEEEDA---------------EDYLTEKSVKYDNLGN 285

Query: 290 VIENGRREFV 299
           VIE+   E  
Sbjct: 286 VIESSEDEIT 295

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  331 bits (849), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 168/318 (52%), Positives = 213/318 (66%), Gaps = 34/318 (10%)

Query: 1   MAKGKNKKTEERQK---PAKGSSKHNGKSNQRRTELK-HGHTKETEF------------- 43
           M KGKNK  ++  K     +G++ H+ + N +  E+K H     T+              
Sbjct: 45  MGKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHS 104

Query: 44  ----PAKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKE 99
               P KL MWDFDHCDPKRCSGKKLERLGLIKSL+IGQ+FQG+++SPNGK VV P+D +
Sbjct: 105 VKKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDAD 164

Query: 100 IVEQHGVSVVECSWARLDEIPFSKI----GGRHERLLPYLVAANQVNYGRPWRLNCVEAI 155
           I+++ G +VVECSWARLDEIPFSK+    GG++ERLLPYLVAANQVNYGRPW+LNCVEA+
Sbjct: 165 IIKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEAL 224

Query: 156 AACFAIVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEE 215
           AACFAI+GR+D A +LLS+FSWG  FL+LN+EL E Y +CTD  S+KAA+E WL K+E+E
Sbjct: 225 AACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQE 284

Query: 216 AEQRRKQTHEEDIWMMGNVNRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIA 275
           A +R+ Q  E DIWMMGN NR   N+R            E             EE     
Sbjct: 285 ATERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYD---------EEEDGGEH 335

Query: 276 IGSKRDVTYDSLGNVIEN 293
           I   +++ YD+LGNVIE+
Sbjct: 336 ITRNKELRYDNLGNVIED 353

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  321 bits (823), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 159/283 (56%), Positives = 198/283 (69%), Gaps = 31/283 (10%)

Query: 18  GSSKHNGKSNQRRTELKHGHTKETEFPAKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIG 77
            S+ H+ + N ++ E K   ++ET FP KLAMWDFDHCDPKRCSGKKLERL LI+SL+I 
Sbjct: 22  NSNGHHSRHNNKKMEFKQHVSRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81

Query: 78  QKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARLDEIPFSKIGG-RHERLLPYLV 136
           QKFQGI VSPNGK  V P D+E+V + G +VVECSWAR+DEIPFSK    + +RLLPYLV
Sbjct: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141

Query: 137 AANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCT 196
           AANQVNYGRPW+LNCVEAIAAC AIVG  DLAEELLSHFSWG  FL+LN+ELLE YQQCT
Sbjct: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201

Query: 197 DHASIKAAEEAWLQKLEEEAEQRRKQTHEE--DIWMMGNVNRKAPNMRXXXXXXXXXXXX 254
           D   I+AA++AW+ ++E+E ++R+   + +  DIWM GNVNR                  
Sbjct: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR------------------ 243

Query: 255 EYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIENGRRE 297
                     + +++E  +       +VTYD+LGN+IEN  RE
Sbjct: 244 ----------IDESDEDNEDEDSEDEEVTYDNLGNIIENEPRE 276

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  318 bits (814), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/299 (54%), Positives = 204/299 (68%), Gaps = 36/299 (12%)

Query: 1   MAKGKNKKTEERQKPAKGSSKHNGKSNQ-RRTELKHG---HTKETEFPAKLAMWDFDHCD 56
           MAKGKNK  EER          N KSN  RR E KH     + +T FP KLAMWDFDHCD
Sbjct: 1   MAKGKNKGHEERS---------NRKSNNSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCD 51

Query: 57  PKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWARL 116
           PKRCSGKKLER GL +SLR+GQ+F G+VVSPNGK VV P D+E +EQ+G++VVECSWARL
Sbjct: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111

Query: 117 DEIPFSKIGGR--HERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSH 174
           DE+PF+K+GG+  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A ++L  
Sbjct: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171

Query: 175 FSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNV 234
           FSWG  FLELN ELL+ Y  CTD  S++ A++ WL+K+E E ++R+++ +  D W++GN 
Sbjct: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231

Query: 235 NRKAPNMRXXXXXXXXXXXXEYASDVDHDLVSDTEEGEDIAIGSKRDVTYDSLGNVIEN 293
           NRK  N                    D D  S++ E ++I+  S  D  YD+LGN+I N
Sbjct: 232 NRKNLN--------------------DFDNSSESTE-DNISTVSSADERYDALGNLISN 269

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 4/103 (3%)

Query: 127 RHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHF--SWGPGFLEL 184
           ++E+  P L+ A +    +  ++  +E I A    VG  D A E L  F  +       L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 185 NQEL--LETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHE 225
           N+E+  L   Q+ TD+     A EA +++LEE+ E + + + E
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNRNSKE 157

>NCAS0I02110 Chr9 (396834..399368) [2535 bp, 844 aa] {ON} Anc_3.156
           YDL035C
          Length = 844

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 22/45 (48%), Gaps = 5/45 (11%)

Query: 4   GKNKKTEERQKPAKGSSKHNGKSNQRRTELKHGHTKETEFPAKLA 48
           G N  T   Q+PA      +G SNQ+ TEL H H    EF   LA
Sbjct: 467 GSNISTNTSQRPAT----QDGTSNQKTTELLH-HLDNVEFDENLA 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,740,986
Number of extensions: 1402491
Number of successful extensions: 4186
Number of sequences better than 10.0: 32
Number of HSP's gapped: 4240
Number of HSP's successfully gapped: 33
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)