Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR006C6.20ON1071107156840.0
Ecym_30246.20ON1079107033500.0
Sklu_YGOB_Anc_6.20b6.20ON1088106020780.0
Sklu_YGOB_Anc_6.20singletonOFF84985217230.0
TDEL0G044906.20ON1093109117280.0
ZYRO0C07810g6.20ON1099110216520.0
KLTH0C11242g6.20ON1097108716170.0
Kwal_56.224246.20ON1089108515950.0
Skud_13.1526.20ON1090107415450.0
Suva_13.1606.20ON1090107615450.0
KLLA0D01133g6.20ON1067108414720.0
Smik_13.1576.20ON1090107514670.0
CAGL0L07634g6.20ON1130111312731e-156
Kpol_1037.256.20ON1105111612551e-154
TPHA0J003306.20ON1107111012501e-153
NCAS0H008206.20ON1146114112061e-146
KNAG0M011606.20ON1131112411531e-139
YML002W6.20ON73769510791e-132
NDAI0D008006.20ON119311949621e-111
TBLA0A072606.20ON120411778801e-100
KAFR0L004006.20ON9428306052e-64
YML003WsingletonOFF2902813791e-39
ZYRO0D15092g7.172ON73384800.99
Smik_13.388.876ON45267791.1
Ecym_70274.308ON628128781.4
NCAS0D048106.356ON1372124781.9
TPHA0A021308.195ON933149762.5
KLLA0A00781g3.565ON171105723.4
KLLA0B12848g2.452ON36158718.3
TBLA0C062908.876ON503121728.4
Suva_13.518.876ON45467718.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR006C
         (1071 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...  2194   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...  1295   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   805   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   668   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   670   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   640   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   627   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   619   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   599   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   599   0.0  
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   571   0.0  
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   569   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   494   e-156
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   488   e-154
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   486   e-153
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   469   e-146
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   448   e-139
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   420   e-132
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   375   e-111
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   343   e-100
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   237   2e-64
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   150   1e-39
ZYRO0D15092g Chr4 (1268414..1270615) [2202 bp, 733 aa] {ON} simi...    35   0.99 
Smik_13.38 Chr13 complement(75428..76786) [1359 bp, 452 aa] {ON}...    35   1.1  
Ecym_7027 Chr7 (50050..51936) [1887 bp, 628 aa] {ON} similar to ...    35   1.4  
NCAS0D04810 Chr4 complement(919711..923829) [4119 bp, 1372 aa] {...    35   1.9  
TPHA0A02130 Chr1 complement(432707..435508) [2802 bp, 933 aa] {O...    34   2.5  
KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}...    32   3.4  
KLLA0B12848g Chr2 (1122397..1123482) [1086 bp, 361 aa] {ON} simi...    32   8.3  
TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa] ...    32   8.4  
Suva_13.51 Chr13 complement(79421..80785) [1365 bp, 454 aa] {ON}...    32   8.5  

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score = 2194 bits (5684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1061/1071 (99%), Positives = 1061/1071 (99%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPYH          AVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60

Query: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQPSAKKCRIQRC 120
            LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQPSAKKCRIQRC
Sbjct: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQPSAKKCRIQRC 120

Query: 121  ELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTADAPLPL 180
            ELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTADAPLPL
Sbjct: 121  ELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTADAPLPL 180

Query: 181  EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKNFRNYL 240
            EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKNFRNYL
Sbjct: 181  EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKNFRNYL 240

Query: 241  NLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPEELDKF 300
            NLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPEELDKF
Sbjct: 241  NLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPEELDKF 300

Query: 301  NLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDADTL 360
            NLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDADTL
Sbjct: 301  NLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDADTL 360

Query: 361  LGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIK 420
            LGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIK
Sbjct: 361  LGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIK 420

Query: 421  LERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDII 480
            LERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDII
Sbjct: 421  LERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDII 480

Query: 481  ANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCD 540
            ANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCD
Sbjct: 481  ANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCD 540

Query: 541  IAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHC 600
            IAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHC
Sbjct: 541  IAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHC 600

Query: 601  FDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKY 660
            FDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKY
Sbjct: 601  FDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKY 660

Query: 661  NRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIK 720
            NRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIK
Sbjct: 661  NRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIK 720

Query: 721  YEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKS 780
            YEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKS
Sbjct: 721  YEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKS 780

Query: 781  GIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRDKI 840
            GIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRDKI
Sbjct: 781  GIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRDKI 840

Query: 841  EPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASV 900
            EPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASV
Sbjct: 841  EPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASV 900

Query: 901  VPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITN 960
            VPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITN
Sbjct: 901  VPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITN 960

Query: 961  LQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAEL 1020
            LQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAEL
Sbjct: 961  LQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAEL 1020

Query: 1021 KHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEFIST 1071
            KHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEFIST
Sbjct: 1021 KHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEFIST 1071

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score = 1295 bits (3350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1070 (57%), Positives = 812/1070 (75%), Gaps = 3/1070 (0%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPYH          AVFNCP P  SPLKKLFNN K ++FIL+VP T+VLLQYQD  + +P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLP 60

Query: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQPSAKKCRIQRC 120
            L+ELCYNY+FVASH L+QLQE++VTE E++T+NG SV+IR Q+GI+ ++P  +KCR++  
Sbjct: 61   LSELCYNYDFVASHILIQLQESKVTEQEYRTLNGNSVIIRSQAGIVMSKPELRKCRVKSY 120

Query: 121  ELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQE--QPLQYQRITQTADAPL 178
            E+LR+FNDYL     F LL+IDRPLVG +     L+VFG  E   P + + I   ++  +
Sbjct: 121  EVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYEMHNPSKSKTINTISENHI 180

Query: 179  PLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKNFRN 238
            P E+F+RL+PQLG QLD  F+  ++R+R     L +L+++F +LV  VY +IK DKNFRN
Sbjct: 181  PFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDVYGVIKEDKNFRN 240

Query: 239  YLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPEELD 298
            Y+ LL + Q YVELNMYED+W KLVQLNG  EPDRV GY  T+ ISLN ++T +YPE  +
Sbjct: 241  YMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGTN 300

Query: 299  KFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDAD 358
             F+L  VTE+EKRVV+AT+CF+KL+LTNSH+EKA+I++STFQ LTTK    ++DP IDAD
Sbjct: 301  SFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTIDAD 360

Query: 359  TLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSS 418
            TL+GLM+VV+CR+QVKNLKSHL+YLREFA   DDVKFGL GYSLST+EAV+ YF+ G  +
Sbjct: 361  TLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGDGT 420

Query: 419  IKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYD 478
             KL++LI+  + N++FW+LI  G+ ++L  ++  LISR+ +CES LS+CI  GR D+  +
Sbjct: 421  EKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLISRSSNCESSLSICIHAGRLDLIKE 480

Query: 479  IIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINK 538
            I+ NYQ    LED+L DVNQ+N +LLIQAL+ G+ +I E +ID++I+NCTN E Y Y+N+
Sbjct: 481  ILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEYVNR 540

Query: 539  CDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQ 598
             + AGRTV HYLPQ + I++++G ++DW++KD+NMHTPLF +CRAYD   Y E+LS+ F+
Sbjct: 541  SNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEMLSRSFE 600

Query: 599  HCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYA 658
            + F++   RG+ FSF DHEDP+GN+LLHI+K GIQ  LS P  NVNK N +GMTPLM+YA
Sbjct: 601  YVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQPNINVNKSNIKGMTPLMLYA 660

Query: 659  KYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHN 718
            KYNRIENIR+IL DKRLI+SK+Q+PQ+LKAIDYVKNP+ILNLIGT +AKNSLYG LS   
Sbjct: 661  KYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKNSLYGLLSADG 720

Query: 719  IKYEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLG 778
            IK+E+N WYLWIT   S  SY T   ++K+IQ LLQ YNKKHPM+FLPIDH L  LK +G
Sbjct: 721  IKFEDNCWYLWITVKFSDNSYSTLRQSVKNIQGLLQFYNKKHPMNFLPIDHILSILKNIG 780

Query: 779  KSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVKQKPNKRD 838
            K GI+ VINLENS+ L  LT  LS+I QR +Y  V  Y ES+LSTWLR +  K + NK +
Sbjct: 781  KPGILPVINLENSIFLGLLTQLLSVIGQRNEYMAVLRYNESDLSTWLRTNNFKPRANKDE 840

Query: 839  KIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIA 898
            +IEPEE+ SIQ+FLKF+L+EF+ ++EKFT+L+KL++F+  K+ DIEC+QRI+Y Q EI++
Sbjct: 841  RIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVS 900

Query: 899  SVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEI 958
            + V     +T    NE N  +D F+QA++F+ MCL++L+SKI  VLDSKV+ WW LYGE+
Sbjct: 901  NSVGPSVEKTFIGSNE-NYSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGEL 959

Query: 959  TNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDA 1018
            ++L++EYQRNFP   K +  S E+SKGFF SY+E KRQK E KLQ+RL VC   LQ L  
Sbjct: 960  SSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSG 1019

Query: 1019 ELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEF 1068
            ELK  HE LAEEISFF++ KNFAY +F++K Y N  IK H+N+L  IEEF
Sbjct: 1020 ELKKDHENLAEEISFFVTFKNFAYESFVMKTYANICIKHHRNILQVIEEF 1069

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1060 (39%), Positives = 650/1060 (61%), Gaps = 34/1060 (3%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPYH          +VFNCP P  SPLKK+F + +D++FILVVP   +LL YQD  T   
Sbjct: 1    MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQ---PSAKKCRI 117
            L +LCY YEFVA+H ++  ++++ ++ EF+T+NGK+V+IR Q+GI+      PS ++C+I
Sbjct: 61   LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 118  QRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTADAP 177
               EL  +FNDYL G   F L++ID+PL+ +      L+VFG         R T T+  P
Sbjct: 121  TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGV--------RSTNTSSLP 172

Query: 178  LP----------LEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVY 227
            L            EQ  RLHPQLG++   +FK+ ++ +      L  LV  F +   + +
Sbjct: 173  LSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAF 232

Query: 228  CLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQ 287
             LI+ ++ F N+  L + V  YVELN+Y+D+W+++ QL   +E +    Y + + I+++Q
Sbjct: 233  ELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQ 292

Query: 288  LSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLT--TK 345
            + T  YPE+  KF+L  VT  EK + QAT+CF +L  ++SH EK +I++ T Q LT  ++
Sbjct: 293  VPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSE 352

Query: 346  TSQATL-DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLST 404
               A + D  IDADTL+GLMV+VVCR+QVKNLKSHL YL+ F+ + + +KFG++ Y+LST
Sbjct: 353  FPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALST 412

Query: 405  LEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIE-QGIPIN-LKEHEEVLISRTPSCES 462
            LEAV+ YF+   +S K+  L   C+RNK FW+ +  + +  + LK + ++L  RT   ES
Sbjct: 413  LEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGES 472

Query: 463  VLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDL 522
             LS+CIQ G       ++ N++    LEDIL D   +  +LL+Q L+ GN  + + ++++
Sbjct: 473  CLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEI 532

Query: 523  LIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCR 582
            L  +CT  E+  Y+N+ +   RT  HYL Q+ ++ D++G F DW+ KD++ HTPLF + R
Sbjct: 533  LCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFR 592

Query: 583  AYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGAN 642
            +YDHP Y ++++  F+    +Y  RG+ F+F+ H+D  GNTLLH++K  I++ L     +
Sbjct: 593  SYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENID 652

Query: 643  VNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIG 702
            VN+ N +G+TPLMVY KYNR++N++ IL D RLI+ K Q    L   DYVKNP+I   +G
Sbjct: 653  VNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELG 712

Query: 703  TAMAKNSLYGCLSVHNIKYEENAWYLWIT--SSLSPESYKTSSYALKDIQSLLQIYNKKH 760
               A+ + +G +  H  ++E N W+LWIT         ++T  + ++ IQ LLQ+Y +++
Sbjct: 713  FHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRN 772

Query: 761  PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820
            PMSFLPID  LE L  +GK+G++SV  LE    L  LT  L +I Q+E++K       S+
Sbjct: 773  PMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASD 832

Query: 821  LSTWLRASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKS 880
            L  W+R S  +++ N   +IEPEEI+SIQ+FL+F+L+E + +R+K ++L+KL IF   K+
Sbjct: 833  LVNWIRESG-RKRTNVSRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKA 891

Query: 881  HDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDP--FEQAVDFMCMCLDSLTS 938
             DI  ++ +L+SQ   +     S+    S    + ++ +        +DF+  C + L  
Sbjct: 892  QDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSATILTSNIDFLKECTNKLVG 951

Query: 939  KIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKL 998
            KI ++L  K++ WW LY E+ + + +Y +NFP   KP+    +D+KG F +Y+E KR KL
Sbjct: 952  KIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPH---LDDNKGLFGTYVEGKRSKL 1008

Query: 999  ESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSK 1038
            E KL +++  C E LQ L  E+K  HE LAEE+S ++  K
Sbjct: 1009 EEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFK 1048

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/852 (40%), Positives = 525/852 (61%), Gaps = 28/852 (3%)

Query: 1   MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
           MPYH          +VFNCP P  SPLKK+F + +D++FILVVP   +LL YQD  T   
Sbjct: 1   MPYHLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSS 60

Query: 61  LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGIITAQ---PSAKKCRI 117
           L +LCY YEFVA+H ++  ++++ ++ EF+T+NGK+V+IR Q+GI+      PS ++C+I
Sbjct: 61  LQDLCYTYEFVANHIIILKKDSKYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCKI 120

Query: 118 QRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTADAP 177
              EL  +FNDYL G   F L++ID+PL+ +      L+VFG         R T T+  P
Sbjct: 121 TNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVFGV--------RSTNTSSLP 172

Query: 178 LP----------LEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVY 227
           L            EQ  RLHPQLG++   +FK+ ++ +      L  LV  F +   + +
Sbjct: 173 LSTDLTQREVSSFEQLFRLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFDKFNYEAF 232

Query: 228 CLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQ 287
            LI+ ++ F N+  L + V  YVELN+Y+D+W+++ QL   +E +    Y + + I+++Q
Sbjct: 233 ELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQ 292

Query: 288 LSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLT--TK 345
           + T  YPE+  KF+L  VT  EK + QAT+CF +L  ++SH EK +I++ T Q LT  ++
Sbjct: 293 VPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSE 352

Query: 346 TSQATL-DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLST 404
              A + D  IDADTL+GLMV+VVCR+QVKNLKSHL YL+ F+ + + +KFG++ Y+LST
Sbjct: 353 FPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALST 412

Query: 405 LEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIE-QGIPIN-LKEHEEVLISRTPSCES 462
           LEAV+ YF+   +S K+  L   C+RNK FW+ +  + +  + LK + ++L  RT   ES
Sbjct: 413 LEAVLCYFEDAENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGES 472

Query: 463 VLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDL 522
            LS+CIQ G       ++ N++    LEDIL D   +  +LL+Q L+ GN  + + ++++
Sbjct: 473 CLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEI 532

Query: 523 LIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCR 582
           L  +CT  E+  Y+N+ +   RT  HYL Q+ ++ D++G F DW+ KD++ HTPLF + R
Sbjct: 533 LCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEAKDISGHTPLFAIFR 592

Query: 583 AYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGAN 642
           +YDHP Y ++++  F+    +Y  RG+ F+F+ H+D  GNTLLH++K  I++ L     +
Sbjct: 593 SYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQENID 652

Query: 643 VNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIG 702
           VN+ N +G+TPLMVY KYNR++N++ IL D RLI+ K Q    L   DYVKNP+I   +G
Sbjct: 653 VNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELG 712

Query: 703 TAMAKNSLYGCLSVHNIKYEENAWYLWIT--SSLSPESYKTSSYALKDIQSLLQIYNKKH 760
              A+ + +G +  H  ++E N W+LWIT         ++T  + ++ IQ LLQ+Y +++
Sbjct: 713 FHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNIRAIQGLLQVYLRRN 772

Query: 761 PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820
           PMSFLPID  LE L  +GK+G++SV  LE    L  LT  L +I Q+E++K       S+
Sbjct: 773 PMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQKEEFKKALYLPASD 832

Query: 821 LSTWLRASMVKQ 832
           L  W+R S  K+
Sbjct: 833 LVNWIRESGRKR 844

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1091 (35%), Positives = 607/1091 (55%), Gaps = 36/1091 (3%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPYH          AVFNCP P  S LKKLF+N KD+KFIL+VP  + LL   D  +  P
Sbjct: 1    MPYHLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSP 60

Query: 61   LTELCYNYEFVASHTLV-------QLQEARVTELEFQTINGKSVVIRPQSGIITAQPS-- 111
            L ELCY+YEFVASH L+        +  A  ++++F T+NGK V++R Q+ II       
Sbjct: 61   LQELCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQ 120

Query: 112  -AKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGE------IELITPLRVFGPQEQP 164
              K+C I + +L  +FN+YLL    F +L ID P+  E      +++   L     + + 
Sbjct: 121  VKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKD 180

Query: 165  LQYQRITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVE 224
                 +  +  +    +  LR+HP    + +E+F +     R         + LFH+++ 
Sbjct: 181  GSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAE----YRSTPEGDDPHIELFHDIIR 236

Query: 225  KVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSIS 284
            + Y  ++ D  F +  +L +++  YVELN+Y+D+W ++   + K+      G    R +S
Sbjct: 237  RAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIWVRITH-HFKDSEVESNGL---RYLS 292

Query: 285  LNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLT- 343
            L+QL T +YP++ ++FNL  V  +E  +  A   FS+L L ++H +KA  LI T + L+ 
Sbjct: 293  LHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSR 352

Query: 344  -TKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSL 402
              K+ Q      I ADTLL L V+V+CR Q++NLK  L YL+ FA+N   + FG+LGY++
Sbjct: 353  VDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAI 412

Query: 403  STLEAVVGYFDIGGSSIKLERLITQCQRNKIFWN-LIEQGIPINLKEHEEVLISRTPSCE 461
            STLEA V YFD    S K+ RL ++C+  +   + L  +   +NL  +++ L  RT   E
Sbjct: 413  STLEAAVCYFDELKGSKKMSRLESECENARSLVDKLSSESSSVNLIHYQKTLSYRTEQGE 472

Query: 462  SVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVID 521
            S+LS+CI  G+ D+  +++++ +S F LEDIL+D     C+LL+Q+L+ GN D    ++D
Sbjct: 473  SLLSICIANGKNDILQELLSDERS-FPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVD 531

Query: 522  LLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVC 581
            L+ ++CT  EM+AY N+ D   RT  HYL     I++++G F DW  KD + HT LFT+ 
Sbjct: 532  LIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIF 591

Query: 582  RAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGA 641
            R+YD P+Y +++   F+   ++Y+ R + F F  HED   NTLLHI+K  I + L     
Sbjct: 592  RSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESV 651

Query: 642  NVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLI 701
            +VN  N +G+TPLMVYAKYNR++N + IL DKR+IL K+Q P  L +IDY KNP+IL+ I
Sbjct: 652  DVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEI 711

Query: 702  GTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPE-SYKTSSYALKDIQSLLQIYNKKH 760
                A ++ +G   VH +KYE ++W + IT     + +++T  + LK +Q+  +   +  
Sbjct: 712  AKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTC 771

Query: 761  PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820
            PM+FLP+D  L  L +LGK+ + S+  LE    L +LT   +++   ++        ES+
Sbjct: 772  PMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESK 831

Query: 821  LSTWLRASMVKQKPNK----RDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFE 876
            L +W++      +         K+EPEE+  IQ FL+F+  E + LR K  V+KKL IF 
Sbjct: 832  LLSWIKVQYKAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFL 891

Query: 877  HYKSHDIECSQRILYSQG-EIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDS 935
              KS D+E S  +L   G E +  + P    + S      ND +    + +D M  C   
Sbjct: 892  RLKSSDVEQSVELLLPLGSEGMGDLYPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIR 951

Query: 936  LTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKR 995
            L   I  +L  K+  WW LYGE+ N +K+Y +NFP   K N  +S D+ G     +E K+
Sbjct: 952  LYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVK-NGETSTDA-GIIGKILEGKK 1009

Query: 996  QKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRI 1055
            +KLE +L   ++    ++    A + H HE LAE++S F+  K       ++K +V   I
Sbjct: 1010 EKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENI 1069

Query: 1056 KQHKNMLLAIE 1066
            K+ K  L+ I+
Sbjct: 1070 KELKERLIHIQ 1080

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1102 (35%), Positives = 612/1102 (55%), Gaps = 65/1102 (5%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            M YH          +VFNC  P  S  KKLF   K ++FIL+VP TE LL + DA +   
Sbjct: 1    MAYHIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSS 60

Query: 61   LTELCYNYEFVASHTLVQLQEA--------RVTELEFQTINGKSVVIRPQSG-IITAQ-- 109
            + +LC NY+FVASH L+  Q+           ++ E++T+N K V +R  SG I+T +  
Sbjct: 61   MNDLCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGF 120

Query: 110  PSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVG----EIELITPL---RVFGPQE 162
            P  ++ RIQ  EL+ +FNDYL G   FAL++ID PL+G    +I++   L      G   
Sbjct: 121  PLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFNGVDA 180

Query: 163  QPLQYQRITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHEL 222
            +    + +TQ + +    E  LRLHP   N L+  F     R R   L+      LF  +
Sbjct: 181  KGSLVRDLTQKSWSSF--ENILRLHPDWSNILNGYFN----RYRSTPLTEGPYEELFRMI 234

Query: 223  VEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRS 282
            V++V+  +  D+ FR   +L +++  YVELN+++DVW ++V    K+E D  P     + 
Sbjct: 235  VKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEP----LKF 290

Query: 283  ISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKL 342
            +S+N+L T +Y ++ +KF L  VT +EK +  A   F  L LT++H EKA  LI+T Q L
Sbjct: 291  LSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSL 350

Query: 343  TTKTSQ----ATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLL 398
            +    Q     TL   +DADTL+   V+VVCR QVKN+KSHL YL++F+++ + +KFG+L
Sbjct: 351  SNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGIL 410

Query: 399  GYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIE-----QGIPINLKEHEEVL 453
            GY++STLEAVV YFD    + KL++L     + K  + LI      Q + +++ +    L
Sbjct: 411  GYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELYILISDKSTGQAV-LDISQFRSNL 469

Query: 454  ISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNK 513
              RTP  ESVLS CI   +  + Y+++ NY+  F LEDIL D      +LLIQAL+  N 
Sbjct: 470  EFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNS 529

Query: 514  DITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNM 573
            +  + ++++L  +CT  E+  Y+N+ D   RTV HYL     I++ +GK+++WK +D N 
Sbjct: 530  EAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNG 589

Query: 574  HTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQ 633
            HTPLFT+ R YD  +Y  ++S  F+    +Y   G+ F F+DHED  GNTLLHIIK+ + 
Sbjct: 590  HTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVS 649

Query: 634  LALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVK 693
            + L     ++N  N +G+TPLM+Y +YNR +N++ I+ D+R+IL KLQ P  L + DY +
Sbjct: 650  ILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYAR 709

Query: 694  NPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSL---SPESYKTSSYALKDIQ 750
            NP++L  + +   K + +    VH++KYE  +W+  IT  +   + E YKT    +K +Q
Sbjct: 710  NPLVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQ 769

Query: 751  SLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDY 810
            +L Q+  K H  SFLP++  LE L  L KS + S+  LE       LT    ++  R D 
Sbjct: 770  NLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVL-LRHDN 828

Query: 811  KNVFSYTESELSTWLRASMVK----QKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKF 866
             N     ES L +W+R+   K    +K  K+  +EPEEI  + +FL+F+  E + ++ K 
Sbjct: 829  LNKLVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKL 888

Query: 867  TVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFN------DGID 920
              +KKL+IF   K+ D+  S + L     +  +     + R    D E N      +   
Sbjct: 889  MTMKKLLIFLKLKNTDLTHSYQFL----SLFGTEYNLAQDRLLFKDLEINCCAFGEEATM 944

Query: 921  PFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASS 980
             F + + F+  C   L  ++ ++L   +  WW LYG++  + K Y++ FP   + +S + 
Sbjct: 945  TFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGT- 1003

Query: 981  EDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNF 1040
                G   S+ E KR+K+ESKL S L+ C + ++ +   +   HE+LAEE+S ++  K+ 
Sbjct: 1004 ----GIIASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFKS- 1058

Query: 1041 AYMNFMVKAYVNRRIKQHKNML 1062
               NF +   + R ++++ N+L
Sbjct: 1059 ---NFFINGILRRAVRENINIL 1077

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/1087 (33%), Positives = 601/1087 (55%), Gaps = 31/1087 (2%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPY+          AVFNCP P  SPL+K+F   + ++F LV P  E+LL+Y+D  +   
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSS 60

Query: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIR-PQSGIITAQP--SAKKCRI 117
            L +LCY+  FV+ H L+        E E++T++GK++ +R  Q  + T +   + ++C++
Sbjct: 61   LQDLCYSASFVSDHILLLGGGGCSHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQV 120

Query: 118  QRCELLRSFNDYLLGRTAFALLYIDRPLVG------EIELITPLRVFGPQEQPLQYQRIT 171
               ELL +FN+Y  G + + ++++D PL G      E       R F   +       + 
Sbjct: 121  LETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYR-FASTDTTSANSSLA 179

Query: 172  QTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIK 231
             + +    LEQ LR HP  G++L  + +  +  +     +   L   F +  EK    I+
Sbjct: 180  ASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAIQ 239

Query: 232  LDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTS 291
             D++FR + NL   +  YVE+N+Y+D W +L      +E +    + I R+IS++Q+ + 
Sbjct: 240  EDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSF 299

Query: 292  IYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATL 351
            +YP +  KF++  VT++EK + +A EC  +L +TNSH  KA++++ T Q ++        
Sbjct: 300  LYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDK 359

Query: 352  DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGY 411
               +DADTL+ L+VVVVC+A+VK+LKSHL YL+EFA++S+ + FG+L Y +STLEAV+ Y
Sbjct: 360  VISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSY 419

Query: 412  FDIGGSSIKLERLITQCQRNKIFWNLIEQG-IPI---NLKEHEEVLISRTPSCESVLSLC 467
            F+   S  KL+ L   C  N  +W  +  G +P+   N  E +++L +RTP+  S LS+C
Sbjct: 420  FE---SREKLKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSIC 476

Query: 468  IQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANC 527
            +Q  + ++F  +   ++  F LED+L D      +LLIQ L  G   ++   I++L  +C
Sbjct: 477  LQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSC 536

Query: 528  TNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHP 587
            T TE+ +++N  +   R+ GHYL    +++ ++GKF++W+++D N HTPLF + R YDH 
Sbjct: 537  TKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHT 596

Query: 588  SYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCN 647
             Y  ++ + ++    + + +GK+F  + H+D  GNTLLH+IK  + + L  P  NVN  N
Sbjct: 597  DYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDPLVNVNSFN 656

Query: 648  TRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAK 707
             +G+TP+MVYA+YNR++NI+ IL DKRLI+ K Q+   L   DY+KNP++L  +G     
Sbjct: 657  KKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCFDYIKNPVVLGELGKHAFF 716

Query: 708  NSLYGCLSVHNIKYEENAWYLWIT--SSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFL 765
                  +  HNIK+E + W LW+T   S+     K    +LK IQS L  ++K + M+F+
Sbjct: 717  LPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVIQRSLKFIQSFLISFSKTNSMTFI 776

Query: 766  PIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWL 825
            P +   E L  L K  IIS+  LE    L   +  LS+I ++E+++++F+     L    
Sbjct: 777  PAESLAEELSLLAKMKIISINRLETKHFLRRASVVLSLICRQEEFEHIFNNPSGSLVNAA 836

Query: 826  RASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIEC 885
                 ++  +    IEPEE+ SIQ  +KF+ TE   ++    +LKKL IF   K  D+E 
Sbjct: 837  EHVQEQEANSTYGMIEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLER 896

Query: 886  SQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFE---QAVDFMCMCLDS--LTSKI 940
            S  +  S G     ++     R++         +   E    A +   + L S  L  KI
Sbjct: 897  SHTMFQSHGNNFTKIIG----RSTNVFGSLKHSLPQCEFGYLANNTALLELSSRLLVQKI 952

Query: 941  VEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLES 1000
             ++L+  +  WW  YGE+ +L+ EY +NFP+  +P  A   ++ GF  SY+E KR +LE 
Sbjct: 953  DKILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVA---ENTGFISSYIETKRVRLEQ 1009

Query: 1001 KLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKN 1060
             L  R++  S+NL      L+  +E LA E++ FI+ K   +++  +K +    IK  + 
Sbjct: 1010 GLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWLQE 1069

Query: 1061 MLLAIEE 1067
             L+ +EE
Sbjct: 1070 QLVCLEE 1076

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/1085 (34%), Positives = 603/1085 (55%), Gaps = 29/1085 (2%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPY+          AVFNCP P  S LKK+F+  +  +F+L+ P TE+LL+Y+D  + +P
Sbjct: 1    MPYYLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLP 60

Query: 61   LTELCYNYEFVASHTLVQLQEARVTELEFQTINGKSVVIRPQSGII---TAQPSAKKCRI 117
            L +LCY   FV+ H ++      + E E++T++GK++++R Q GII    A  + ++CRI
Sbjct: 61   LQDLCYATGFVSDHIVLLDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCRI 120

Query: 118  QRCELLRSFNDYLLGRTAFALLYIDRPLVGEI---ELITPLRVFGPQEQ---PLQYQRIT 171
            QR ELL +FN+YL G T F ++++D PL G +   +     RV   QE    P    +++
Sbjct: 121  QRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKNQEHTNGPKNSGKLS 180

Query: 172  QTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIK 231
               D  + LEQ LR++P+ G  L+++ K  +  +         L   F +  +K   +++
Sbjct: 181  H-GDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVVR 239

Query: 232  LDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTS 291
                F+   NL   V  Y+ELN+Y+D W +L      +E +    Y + + IS++Q+ + 
Sbjct: 240  AYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSF 299

Query: 292  IYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATL 351
            +YP   +KF+L  +T+ EK V  A E F K+ +TN H  KA+++I T Q L+        
Sbjct: 300  LYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDR 359

Query: 352  DPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGY 411
               IDADTL+ L VVVVC AQVK+L+SHL YL+EF ++++ V FG+L Y +STLEAV+ Y
Sbjct: 360  AVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCY 419

Query: 412  FDIGGSSIKLERLITQCQRNKIFWNLIEQG-IPINLKEH---EEVLISRTPSCESVLSLC 467
            F+   S  K+  L   C+ N   W  I +G I +N       +++L  RT   +S L++C
Sbjct: 420  FE---SPEKVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVC 476

Query: 468  IQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANC 527
            +Q+ R + F  I    ++ F LED+L D      +LLI  L++G   +   +I+ LI+NC
Sbjct: 477  LQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNC 536

Query: 528  TNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHP 587
            T  E+ A++N  +   R+ GHYL    +++D +G  ++W+++D N HTPLF + RAYD P
Sbjct: 537  TKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGHTPLFAIVRAYDRP 596

Query: 588  SYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCN 647
             Y +++S  ++        R  RF  ++H D  GNTLLH+IK  + + L+ P  +VN  N
Sbjct: 597  DYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADPFIDVNATN 656

Query: 648  TRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAK 707
             +G+TPLMVY +YNRI N+R IL D+RLI+ K Q    L   DYVKNP +L  +G   + 
Sbjct: 657  AKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKNPAVLKELGKYASY 716

Query: 708  NSLYGCLSVHNIKYEENAWYLWITSSLSPES--YKTSSYALKDIQSLLQIYNKKHPMSFL 765
                  ++VH++K E + W LWIT +   +    K    +L+ IQ+ L +++  HPM+F+
Sbjct: 717  LPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAFLTLFSDAHPMTFV 776

Query: 766  PIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWL 825
            P+D  L  L+ L +S I+ +  ++    L+  + +LS++ Q   + + F+ +   LS+  
Sbjct: 777  PVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMVSQERLFADAFTDSNLNLSSSR 836

Query: 826  RASMVKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIEC 885
                 +        +EPEE+ SIQ+ LKF+L+E + L+    ++KKL +FE  K  D+  
Sbjct: 837  GLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGKDL-- 894

Query: 886  SQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMC--LDSLTSK-IVE 942
                  + G     V   K      F N     +  FE   + + +C    SL  K I +
Sbjct: 895  -SEACMTFGAKCKYVTQGKIQSFDHFLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQ 953

Query: 943  VLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKL 1002
            VL+  +  WW  YGE+ +L++EY+++FP+  +P+   SE+S G F SY+E KR KLE   
Sbjct: 954  VLNDDIPKWWHTYGELLSLRREYKKSFPDANRPH--VSENS-GLFGSYIETKRTKLEQSY 1010

Query: 1003 QSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNML 1062
             +R++  S  L  +  ++   +E LA E++ FI+ KN  ++   +K + +  IK+ +  L
Sbjct: 1011 AARINHTSVRLSEISTKINQDNERLAVELNNFINFKN-EFLKSAIKEHADTNIKRLREQL 1069

Query: 1063 LAIEE 1067
            +  EE
Sbjct: 1070 VCSEE 1074

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/1074 (33%), Positives = 596/1074 (55%), Gaps = 55/1074 (5%)

Query: 3    YHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62
            YH          A+FNCP P  SPLKKLF N K ++FIL+ P    LL Y D  T +PL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLH 63

Query: 63   ELCYNYEFVASHTLVQLQEARVT----ELEFQTINGKSVVIRPQSGIITAQ---PSAKKC 115
            ELCYN +F+ SH L+  + + +     +  ++T++GK+VVI+ ++ II A    P  ++ 
Sbjct: 64   ELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIRQRL 123

Query: 116  RIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQ-PLQYQRITQTA 174
            +I   ++L +FNDY  G   FA+L+ID+PL  E+     L+ F   E+ P   Q ++   
Sbjct: 124  KILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVSN-- 181

Query: 175  DAPLPLEQF----------LRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVE 224
               LP+  +          L +H     QL ++F +     R +A +     ++F ++V+
Sbjct: 182  ---LPVNSYEQERSSFDNILHIHSARLAQLGQLFSN----YRRLAPNDDPSKKMFEDIVQ 234

Query: 225  KVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSIS 284
            + +  +K D  F+N+ NL +++  Y ELN+Y+D+W +LV      E D     Y     S
Sbjct: 235  QSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYF----S 290

Query: 285  LNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTT 344
            +NQL    + ++  +F LS +T IE+RV  A++ F KLTLT+S+ EK++IL+ T Q+L+ 
Sbjct: 291  VNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSG 350

Query: 345  KTSQAT--------LDPM-IDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKF 395
             T  ++        L+ + +DADTLL L V+VVCR++ K+LKSHL YL+ F+ N    KF
Sbjct: 351  PTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKF 410

Query: 396  GLLGYSLSTLEAVVGYF-DIGGSSIKLERLITQCQRNKIFWNLIEQGIPIN----LKEHE 450
            G+LGY++STLEAVV YF D   ++  L +     Q+ +   + +    P N    L  +E
Sbjct: 411  GILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYE 470

Query: 451  EVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQA 510
            + L  R    +S+LS+CI   +  +  D++  Y+  F +EDIL+D      +LLI++++ 
Sbjct: 471  DNLQYRNEQGQSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKT 530

Query: 511  GNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKD 570
            GN +  + +I +++ NC+  E+ +Y+NK D   RTV HYL    +I+  +G +VDWKRK+
Sbjct: 531  GNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKN 590

Query: 571  LNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKD 630
             +  TPLF++ R YD P+Y E++   F     +Y      F + DH D  GN+LLHI+K 
Sbjct: 591  SSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKS 650

Query: 631  GIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAID 690
             + + L     ++N  N +G+TPLM+Y KY RI NI  I  D RLIL K+Q+       D
Sbjct: 651  DVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFD 710

Query: 691  YVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEE-NAWYLWITSSLSPESYKTSSYALKDI 749
            Y K+  +L+ IG   A++SL+G + +H+++Y   NA     T+S + + + T+   +K I
Sbjct: 711  YAKDHSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTI 770

Query: 750  QSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQ-QRE 808
            Q LL+   K +  +FLP++ +++ +  L +S +  +   +   LL  LT   +++   ++
Sbjct: 771  QGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKK 830

Query: 809  DYKNVFSYTESELSTWLRASMVK--QKPNKRDK---IEPEEIHSIQNFLKFSLTEFNYLR 863
              +N+F+  E+ +  W+R +  K  QKP  +D    +EPEEI+ IQ+FL+F+  E +  +
Sbjct: 831  VPQNLFT-DEASVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFK 889

Query: 864  EKFTVLKKLIIFEHYKSHDIECSQRILYSQG-EIIASVVPSKRLRTSPFDNEFND-GIDP 921
                +L+K++IF   KS+D E +   L   G +II         R     N F+D  +  
Sbjct: 890  ASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAE 949

Query: 922  FEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSE 981
              + V F+  C   L++ +  +L  K++ WW  YGE   LQK Y++ FP   KP SA+  
Sbjct: 950  LLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDT 1009

Query: 982  DSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFI 1035
             S     S++E KR++ E +L  ++   S+ L+ L +E+   HE LAEE+S ++
Sbjct: 1010 PSHIPLGSFIETKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYM 1063

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/1076 (33%), Positives = 595/1076 (55%), Gaps = 59/1076 (5%)

Query: 3    YHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62
            YH          A+FNCP P  SPLKKLF N + ++FIL+ P + +LL Y D  T +PL 
Sbjct: 4    YHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLH 63

Query: 63   ELCYNYEFVASHTLVQLQEARVT----ELEFQTINGKSVVIRPQSGII---TAQPSAKKC 115
            ELCYN +F+ SH L+  + + +     +  ++T++GK+VV++ ++ +I      P  ++ 
Sbjct: 64   ELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLRRRL 123

Query: 116  RIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTA- 174
            +I   ++L +FNDY  G   FA+LYID+PL  E      L  F        Y+  ++TA 
Sbjct: 124  KILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFN------SYEETSKTAR 177

Query: 175  DAPLPL-----------EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELV 223
            +AP  L           E  L +HP    QL ++F +     R  AL+     ++F ELV
Sbjct: 178  NAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSN----YRRAALNDDPSKKMFEELV 233

Query: 224  EKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKL-VQLNGKNEPDRVPGYYITRS 282
            E+ +  +K D  F+N+ NL +++  Y ELN+YED+W +L +   G         Y+    
Sbjct: 234  EQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYF---- 289

Query: 283  ISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKL 342
             S+NQL T  Y ++ + F LS +T IE+RV  A++ F KL L++S+ EK++IL+ T Q L
Sbjct: 290  -SVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHL 348

Query: 343  TTKTSQATLDP---------MIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDV 393
            +  T   +  P          +DADTL+ L V+VVCR++ K+++SHL YL+ F+ NS   
Sbjct: 349  SGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSS 408

Query: 394  KFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQ-CQRNKIFWNLIEQGIPIN----LKE 448
            KFG+LGY++STLEAVV YF+    +          C + +   + +    P N    L  
Sbjct: 409  KFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLAT 468

Query: 449  HEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQAL 508
            ++++L  R    +S+LSLCI   + D+  D+++ Y++ F +EDIL+D      +LLI+++
Sbjct: 469  YKDILAYRNEQGQSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESI 528

Query: 509  QAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKR 568
            + GN + T+ +I +++ NCT+ E+  Y+NK D   R+V HYL    +I+  +G +++WK+
Sbjct: 529  KVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQ 588

Query: 569  KDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHII 628
            K+ +  TPLF++ R+YD P+Y E++   F     +Y      F ++DH D  GN+LLH++
Sbjct: 589  KNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVL 648

Query: 629  KDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKA 688
            K  + + L     N+N  N +G+TPLMVY KY R+ NI  I  D RLIL K+Q+      
Sbjct: 649  KTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTC 708

Query: 689  IDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITS-SLSPESYKTSSYALK 747
             DY K+ ++L+ IG   A +S++G + +H+++Y      + +TS S + E + T+   +K
Sbjct: 709  FDYAKDRLVLSKIGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMK 768

Query: 748  DIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQ-Q 806
             IQ LL+   K +P +FLPID++++ +  L +S +  +   +   LL  LT   +++   
Sbjct: 769  TIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFL 828

Query: 807  REDYKNVFSYTESELSTWLR--ASMVKQKPNKRDK---IEPEEIHSIQNFLKFSLTEFNY 861
            ++  +N+F+  E+ +  W+R   S   QKP  +D    +EPEEI+ IQ+FL+F+  E   
Sbjct: 829  KKVPQNLFT-DEASVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILS 887

Query: 862  LREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNE-FND-GI 919
             +    +L+K++IF   KS D E +   L   G  + +   +    T   +++ F+D  +
Sbjct: 888  FKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSL 947

Query: 920  DPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSAS 979
            D   + V F+  C   L + I  +L  ++  WW  YGE   L K Y++ FP   KP S +
Sbjct: 948  DELLEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTA 1007

Query: 980  SEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFI 1035
               S      ++E KR++ E +L  ++   S+ L+ L +E+   HE LAEE+S ++
Sbjct: 1008 GTSSHIPLGGFIETKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYM 1063

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/1084 (32%), Positives = 584/1084 (53%), Gaps = 50/1084 (4%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            MPYH          A+FNCP+P  S LK++F+   D++F ++VP TE LLQ+QD  + + 
Sbjct: 1    MPYHLPVLLNPLLNAIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLE 60

Query: 61   LTELCYNYEFVASHTLVQLQEAR-------VTELEFQTINGKSVVIRPQ-SGIITAQ--P 110
            L ELCY+Y+FVASH +V     +       +   +F T+NG+ + IR + S I+T     
Sbjct: 61   LAELCYHYDFVASHIVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFT 120

Query: 111  SAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRI 170
              +K  I+   LL +FNDYL G     +L+I  PL G++  +  L+VF      +   + 
Sbjct: 121  ERRKITIKEINLLPTFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSK----VAGNKY 176

Query: 171  TQTADAPLPL----------EQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFH 220
            ++   APLP           EQ ++    +  ++   F   K R++  A+S+  +   + 
Sbjct: 177  SKQEQAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKK-AISVIGIRTEWL 235

Query: 221  ELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYIT 280
               + +  +I LDK   +  +L  M+  YVEL ++ D+ ++L ++    E +    +   
Sbjct: 236  NTRDSIRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKAL 295

Query: 281  RSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQ 340
            RSISLNQ+ T+ YP++   F+L+ V E+EK V  A E    + L  +H  K  +L +T +
Sbjct: 296  RSISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMR 355

Query: 341  KLTTKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGY 400
             L+ + +  +     DADTLL L V+++CR+QV  L   L YL  F  +   +KFGL GY
Sbjct: 356  LLSREINGIS----TDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGY 411

Query: 401  SLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSC 460
             LST EA + +F        ++ L  +C  NK  W  I++   +  +     L  RT S 
Sbjct: 412  VLSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSNLRIRTDSG 467

Query: 461  ESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVI 520
            ES+LS+CIQ    +V   ++AN++S F LEDIL D + +  +LLIQALQ  N      + 
Sbjct: 468  ESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQALQVQNSQAAAILS 527

Query: 521  DLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTV 580
            ++++ +CT +E+ +Y+N  ++  R   HY+ Q+  +++ +G++ +W+ KD+N HTPLF V
Sbjct: 528  EIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHTPLFAV 587

Query: 581  CRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPG 640
             R+YD  +Y E+++K       +Y+   K F+F  HEDP GNTLLH++K GI+  L  P 
Sbjct: 588  FRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNTLLHVMKSGIESLLKLPD 647

Query: 641  ANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNL 700
             NVNK +++G+TPLM+Y++YNRI NI  I+ D+RL+   +Q P  + ++D+ KNP +   
Sbjct: 648  VNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKNPKVTKT 707

Query: 701  IGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKH 760
            I  A         + +H++++EE  W + I    S   +K   Y+L  IQ  L+     +
Sbjct: 708  ILDATFNRE---PVVIHSLRFEERKWKIGI---FSEGIFK--KYSLDLIQYYLRYLKIMY 759

Query: 761  PMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESE 820
            P SF P+      L+ LG  G+  V+ L++    + L    S +  R   K      E E
Sbjct: 760  PCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDMLFSYVNTRG--KLWLGKDEEE 817

Query: 821  LSTWLRASMVKQKPNKR-DKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYK 879
            L   L         ++R  K+EPEEI+ IQ FLK++L EF  LR    +LKKL I +  K
Sbjct: 818  LKVLLDVPTPYLSESERFIKLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIK 877

Query: 880  SHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSK 939
              D+   +    S G  ++    +K    +     ++     F + ++++   + +L + 
Sbjct: 878  HRDVITMRNSFLSLGNQMSQKGVAKSFENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNN 937

Query: 940  IVEVLDSKVSTWWTLYGEITNLQKEYQRNFP-EKGKPNSASSEDSKGFFVSYMEDKRQKL 998
              E L +K + WW  +GE+  L+KE+++NFP +K  P+SA    ++ F  +Y+E KR K 
Sbjct: 938  F-ESLLAKTTLWWKHFGELMELKKEWKKNFPNDKAPPSSA----NRNFIDTYIEGKRSKF 992

Query: 999  ESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQH 1058
             +KL ++L + S NL+ +  E+K  HE +A  I+ FI  K   Y + +VK+ V++RI+++
Sbjct: 993  RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIVDQRIREN 1052

Query: 1059 KNML 1062
            K ++
Sbjct: 1053 KQIM 1056

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/1075 (32%), Positives = 586/1075 (54%), Gaps = 52/1075 (4%)

Query: 15   AVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLTELCYNYEFVASH 74
            A+FNCP P  SPLKKLF   K  +FIL+ P +E LL Y D  T +PL ELCYN EF+ SH
Sbjct: 16   AIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHELCYNAEFINSH 75

Query: 75   TLVQLQEARVT----ELEFQTINGKSVVIRPQSGIITAQPS---AKKCRIQRCELLRSFN 127
             L+  + + +     +  ++T++GK+VVI+ ++ +I A       ++ +I   ++L +FN
Sbjct: 76   ILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLKILGTKILPNFN 135

Query: 128  DYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQ------PLQYQRITQTADAPLPLE 181
            DY  G T F ++YI++PL  E      L+ F   ++       +    +  +       E
Sbjct: 136  DYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSLDSSQQERSSFE 195

Query: 182  QFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKNFRNYLN 241
              L +HP    QL E+F +     R +A S     ++F  +V++ +  +K D  F+ + N
Sbjct: 196  NILHIHPTRLTQLGEMFSN----YRTLAPSDDPSEKIFECIVQQAFEGMKSDSLFKKFPN 251

Query: 242  LLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPEELDKFN 301
            L +++  Y ELN+Y+D+W +L       E     G    +  S+N L    Y ++  +F 
Sbjct: 252  LYDLIHEYFELNLYDDIWSRLTSHFKSYEV----GTEEYKYFSINHLLADFYSKDFREFK 307

Query: 302  LSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQAT--LDP------ 353
            L  VT IEKRV  A++ F KLTLT+S+ EK++IL+ T Q+L+  T   +  LD       
Sbjct: 308  LQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPGRLNN 367

Query: 354  -MIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYF 412
              +DADTL+ L V+V+CR++ K+LKSHL YL+ F+ NS   KFG+LGY++STLEAVV YF
Sbjct: 368  LAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAVVCYF 427

Query: 413  -DIGGSSIKLERLITQCQRNKIFWNLIE----QGIPINLKEHEEVLISRTPSCESVLSLC 467
             D   +S  + +     Q+ K   N++          NL  ++++L  R    +S+LS+C
Sbjct: 428  EDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQSILSIC 487

Query: 468  IQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANC 527
            I   +  +  DI++ Y S F LED+L+D      +LLI+++++GN +  + +I +++ NC
Sbjct: 488  ISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMMLNC 547

Query: 528  TNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHP 587
            T  E+ +YIN+ D   RTV HYL    +I+  +G +VDWKRK+    TPLF++ R+YD P
Sbjct: 548  TEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSIFRSYDQP 607

Query: 588  SYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCN 647
            +Y  ++   F     +Y  + + F + DH D  GN LLH++K    + L     ++N  N
Sbjct: 608  NYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKLDINGEN 667

Query: 648  TRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAK 707
             +G+TPLMVY KY R+ NI  I+ D+RL+L K+Q        DY K+  +L+ +G   AK
Sbjct: 668  YKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSKVGERGAK 727

Query: 708  NSLYGCLSVHNIKYEE-NAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLP 766
            +SL+G +  H+++Y   NA      +S + + +  +   +K IQ LL+   K +P +FLP
Sbjct: 728  DSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLP 787

Query: 767  IDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLR 826
            ++ +++ +  L +S +  +   +   LL  L+   +++   +         E+ +  W+R
Sbjct: 788  LNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEASILYWMR 847

Query: 827  ASMVK---QKPNKRD--KIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSH 881
             +  K   ++P+K +   +EPEEI+ IQ+FL+F+  E +  +   ++L+K++IF   KS+
Sbjct: 848  INTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSN 907

Query: 882  DIECSQRILYSQGEIIASVVPSKRLRTSPFD-NEFND-GIDPFEQAVDFMCMCLDSLTSK 939
            D +     L   G+ I +   +     +  + N FND  +    + V F+  C   L++ 
Sbjct: 908  DFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEECTIQLSNL 967

Query: 940  IVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLE 999
            +  +L  K+  WW  YGE+  L K Y++ FP   KP S +          ++E KR++ E
Sbjct: 968  VQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIETKREQSE 1027

Query: 1000 SKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRR 1054
             +L  ++ V S++L+ L +E+   HE LAEE+S         YM F  KA +N+R
Sbjct: 1028 QRLAVQIKVSSKSLKELGSEIFVAHEKLAEELS--------NYMEFR-KACLNQR 1073

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  494 bits (1273), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 341/1113 (30%), Positives = 577/1113 (51%), Gaps = 89/1113 (7%)

Query: 15   AVFNCPAPGASPLKKLFNN-AKDKKFILVVPRTEVLLQYQDATTYVPLTELCYNYEFVAS 73
            A+ NC  P +SPLKKL+    K  K++++VP TE+LL Y D  +   L +LCY   F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 74   HTLVQLQEARVTEL--------------------------EFQTINGKSVVIRPQSGIIT 107
            H L  L +A  TE+                           ++ IN K+ VI   + +  
Sbjct: 79   HIL--LLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKL-- 134

Query: 108  AQPSAKKCRIQRCELLRSFNDYL-LGRTAFALLYIDR---------PLVGEIELI-TP-L 155
                  + +I   E +  FN+Y+        ++YID           L  +I+L+ +P +
Sbjct: 135  GDQIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSM 194

Query: 156  RVFGPQEQPLQYQRIT---QTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSL 212
            R     ++P    + +   + + +    +  LR++    ++ ++ F    ++ R +A   
Sbjct: 195  RSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHF----QKFRLLANQD 250

Query: 213  KELVRLFHELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPD 272
               + +FH ++E+++  +  D  F+N ++L  ++  YVELN+++D+W+ ++++N + E D
Sbjct: 251  DLPIDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEID 310

Query: 273  RVPGYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKA 332
              P      +IS+ Q+ +     E  KF L  V   E+ + +A++   K+   +++  KA
Sbjct: 311  LNPF----GNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKA 366

Query: 333  RILISTFQKLT---------TKTSQATLD--PM-IDADTLLGLMVVVVCRAQVKNLKSHL 380
             ILI T + LT         +K     L   P+ IDAD L+ L V+V CRAQ+KNLK HL
Sbjct: 367  NILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHL 426

Query: 381  DYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQ 440
             YL+ F  N  D KFG+LGY+LSTLEAVV YF+         +LI  C  N+    ++  
Sbjct: 427  SYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSS 486

Query: 441  GIPIN-------LKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDIL 493
                        L+++E  L  R    +S+L+LCI +GR D  Y I+  Y++ F +ED+L
Sbjct: 487  TKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLL 546

Query: 494  QDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQN 553
             D +    +LLIQA++  N+     ++++L  NCT  E+ AYIN+ DI  RT GH+L   
Sbjct: 547  ADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNE 606

Query: 554  YEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSF 613
             E++  +GK+++W +KD    TPLFT+ R+YD  +Y E++S+  ++  ++Y   GK F++
Sbjct: 607  LEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNY 666

Query: 614  ADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDK 673
             DH D  GNTLLHI+K  + + L+    NVN  N  G TPLM   +Y R ENIR++L D 
Sbjct: 667  LDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDP 726

Query: 674  RLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSS 733
            RL +   Q   +L A D+ K+  I +L+G     NS +  +  H +KY  + W L +T  
Sbjct: 727  RLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVK 786

Query: 734  LSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSML 793
            L  ++ KT+++ LK ++ +L++  K +   FLP+   +E L +  +     ++ ++   +
Sbjct: 787  L-KDAPKTTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEM 845

Query: 794  LEALTFSLS-IIQQREDYKNVFSYTESELSTWLRAS-MVKQKPNKRDKIEPEEIHSIQNF 851
            L  ++F LS ++  +    NVF  TE     W++ +  V +K N+   I PE+I  IQNF
Sbjct: 846  LPFISFCLSALVHIKVLDLNVFQ-TEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNF 904

Query: 852  LKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTS-P 910
            LKF++TE    + K  + +KL +F   KS D+  S     +    I S + SKR R++  
Sbjct: 905  LKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVT----IVSQLSSKRFRSTLK 960

Query: 911  FDNEFNDGID-PFEQA----VDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEY 965
            +  E    +    E+A    + ++ +C   L + I+ +  + +S WW +YGE+ N  K Y
Sbjct: 961  YSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHY 1020

Query: 966  QRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHE 1025
             R FPE     + + + +    +S    KR KLE +L  ++   +E L  +  ++K  HE
Sbjct: 1021 TRAFPELANVTTENRDLALHRMIS--NPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHE 1078

Query: 1026 LLAEEISFFISSKNFAYMNFMVKAYVNRRIKQH 1058
            L AEE+S FI  K    + + +++Y+    ++H
Sbjct: 1079 LAAEEVSRFIDLKTKFTLEYALQSYLTISKQEH 1111

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  488 bits (1255), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 322/1116 (28%), Positives = 565/1116 (50%), Gaps = 74/1116 (6%)

Query: 1    MPYHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP 60
            + YH          AVFNCP P  SPL+KLF   K K F+L+VP  E+LL Y+D    + 
Sbjct: 4    LSYHMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLT 63

Query: 61   LTELCYNYEFVASHTLVQLQEA------------RVTELEFQTINGKSVVIRPQSGI--- 105
            L ELCY +EFVASH ++    +               +  ++++N   ++I+  + I   
Sbjct: 64   LKELCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLD 123

Query: 106  ITAQPSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPL 165
                   KK +I   ++L +FN+YL G   + ++Y D P          +  F   ++  
Sbjct: 124  FNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKES 183

Query: 166  QYQRITQTADAPLPLEQ------------FLRLHPQLGNQLDEVFKDAKERMRYIALSLK 213
               +  Q  +   PL Q             + +H +  N  D    D K +     L+L 
Sbjct: 184  NNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSYIIDFKNK----QLNLT 239

Query: 214  ELVRLFHELVEKVYCLIKLDKNFRNYLN-LLEMVQGYVELNMYEDVWRKLVQLNGKNEPD 272
             L   F E+V+K Y  +K ++ F ++ N L  ++  Y+E + Y  +W  +     +N  D
Sbjct: 240  SLPIYFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHI----DRNMID 295

Query: 273  -RVPGYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEK 331
             +     +   +S++QL   +Y +   KFNL  V ++E+ V  AT+ F K+  + SH EK
Sbjct: 296  NQFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEK 355

Query: 332  ARILISTFQKLTTKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSD 391
             +ILI   QKLT+         M+DADTL+ L ++V+CR++V  L++HL YL+ F+ + +
Sbjct: 356  CQILIDALQKLTSYDDVHYEPLMVDADTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDEN 415

Query: 392  DVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGI---PINLKE 448
            +VKFGLLGY +ST EA + Y     +  K  + +  C RNK   + I          +K 
Sbjct: 416  NVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKELISKISSEADHSTFQVKL 475

Query: 449  HEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQAL 508
            +++    R    ES+L+LCI++ + +  ++I+ N++  F LEDIL D +    +LL++AL
Sbjct: 476  YKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTTLLMKAL 535

Query: 509  QAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKR 568
            +  N+   + ++D+L ++C+  E+  Y N+ D   R   HY+    +++ R+G F +WK 
Sbjct: 536  KVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGLFFNWKI 595

Query: 569  KDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHII 628
            KD   +TPL T+CR YD   Y +++   F     +Y  R ++ +F DH D   NTLLHI+
Sbjct: 596  KDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHIL 655

Query: 629  KDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKA 688
            K  IQ+ L     N+N  N + +TPLM Y KYNR+ NI+EI+ D+RLIL K Q    L  
Sbjct: 656  KCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDC 715

Query: 689  IDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWIT-SSLSPESYKTSSYALK 747
             D+VKN II   +G    +NS++   S ++++ E + W L+ T    + +SY T S +LK
Sbjct: 716  YDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYITKSVSLK 775

Query: 748  DIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGII------SVINLENSMLLEALTFSL 801
             + ++++ YNK +P+ F+P   H E L  L  +GI+       +  L+N   L  ++   
Sbjct: 776  ILFNIIKKYNKLYPLHFIP---HKEVLLRL--TGIVKNNPNNGIQKLKNRAFLNLISNYF 830

Query: 802  SIIQQREDYKNVFSYTESELSTWLRASMVK-QKPNKRDKIEPEEIHSIQNFLKFSLTEFN 860
              + + +D+          L+ W++A   K +K N   ++  ++I+ I++F++F++ E  
Sbjct: 831  GTLIETDDFDTELFKNPESLTKWIKAGKRKHKKENYYKRMTLDDINMIKSFVQFNINELG 890

Query: 861  YLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFDNEFNDG-I 919
             L     +LKKL  F   K +D+  S ++  + G ++     S +++         DG I
Sbjct: 891  KLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKI-------DGLI 943

Query: 920  DP--FE-------QAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFP 970
             P  F+         + F+ +C   ++    +++ + +  W +++  ++NL+K+Y+R+F 
Sbjct: 944  KPKYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFS 1003

Query: 971  EKGKPNSASSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEE 1030
            +    N      ++     Y ++KR+  E ++   +   +     + A + + HE LAEE
Sbjct: 1004 DFDSRNGL----NENILSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEE 1059

Query: 1031 ISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIE 1066
             + F++ K+  + + ++   +   I   K+ +L IE
Sbjct: 1060 FNKFLTFKSRFFKDVILNMIIPSAIATLKDQVLNIE 1095

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  486 bits (1250), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 335/1110 (30%), Positives = 565/1110 (50%), Gaps = 83/1110 (7%)

Query: 15   AVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLTELCYNYEFVASH 74
            AVFNCP P ASP KKL+N  +DK F+L+VP   +LL Y+D+T+ +   ELCY Y+FVA+H
Sbjct: 15   AVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFRELCYTYDFVAAH 74

Query: 75   TLVQLQEARVTELE----------FQTINGKSVVIRPQSGI-ITAQPSAKKCRIQRCELL 123
             L+  + +   ++            +++NGK V++R    I I    S +K +++   LL
Sbjct: 75   ILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQSLCIPIKGYFSKRKSQMRDATLL 134

Query: 124  RSFNDYLLGRTAFALLYIDRPL-VGEIELITPLRVFG-PQEQPLQYQRITQTADAPLPLE 181
             +FNDYL G   F +++ID PL V +  LI  L+ F   +E P      +Q  D P  L+
Sbjct: 135  TNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFH----SQDKDKPGLLQ 190

Query: 182  ----------QFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELV--RLFHELVEKVYCL 229
                      +F++L  +  +   E+ K  K   +Y A+   + +   LFH++V  +Y  
Sbjct: 191  RTEENKADRVKFIQLFQERKDWTIELEKYLK---KYQAMEPLQNIGSELFHDIVNMIYNT 247

Query: 230  IKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLS 289
            +K ++ F+ + NL ++   Y+E  +Y+D+W KL +    +  D++  + +   +SL+ L 
Sbjct: 248  LKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQE----HYRDKILDFRLVSQLSLDMLD 303

Query: 290  TSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQA 349
            T+ Y      F L  +  +E  +VQA   F  +   NS+ +K  ++  T   +T K S  
Sbjct: 304  TTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDD 363

Query: 350  TLD-------PMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSL 402
            T+        P+IDADTL+ L  +++CRA V+++  H+ YL+ F ++ + VKFG LGY+L
Sbjct: 364  TIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTL 423

Query: 403  STLEAVVGYF----DIGGSSIKLERLI--------TQCQRNKIFWNLIEQGIPINLKEHE 450
            ST+EA + YF    +   S I+L++L          + Q + +        IPIN  + +
Sbjct: 424  STIEATLSYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDL--------IPIN--QFK 473

Query: 451  EVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQA 510
            +    RT   ES+LSL I   + +   + + N++  F L+D+L D + S  +LLI+ L+ 
Sbjct: 474  DYFRYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKE 533

Query: 511  GNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKD 570
             N +  E +I++   +CTN+E+  Y NK D   RT+ HY+    EI++++GK+++W  KD
Sbjct: 534  RNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKD 593

Query: 571  LNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKD 630
            L   T LFT+ R+YD  +Y   +         +Y      F  +DH D  G++LLHI+K 
Sbjct: 594  LKGRTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKS 653

Query: 631  GIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAID 690
             + L L     ++N  N +GMTPLM Y KYNRI+NI+ IL D RLI+ KLQ  + L  +D
Sbjct: 654  QVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLD 713

Query: 691  YVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPESYKTSSYALKDIQ 750
            Y KN  + NL+   ++K+ ++    +   +YE++ WYL I+       Y T+   LK   
Sbjct: 714  YGKNFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKDDLEYTTNIIKLKKYY 773

Query: 751  SLLQIYNKKHPMSFLPIDHHLETLKTLGKS-GIISVINLENSMLLEALTFSLSIIQQRED 809
            +L+    K +   F+P    L+ LK + +   I+ +  L+    L  L+  LS +   E 
Sbjct: 774  NLINAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEK 833

Query: 810  YKNVFSYTESELSTWLRASMVKQKPNKRDK-----IEPEEIHSIQNFLKFSLTEFNYLRE 864
               +    E+ +  W+ + + +Q+ +  D      +  E+I++I+ F  FS  E      
Sbjct: 834  IDPLTLLDENLIIKWISSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTNN 893

Query: 865  KFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRL----RTSPFDNEFNDGID 920
                  KL IF   K+ D+  S  IL   G   ++   S+ L      SP     +  + 
Sbjct: 894  VIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQSISP---HVHSSMV 950

Query: 921  PFE--QAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSA 978
             +E  Q + FM  C   LTSK+   +  K+S W     ++   +KEY   F +  +    
Sbjct: 951  YYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGN 1010

Query: 979  SSEDSKGFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSK 1038
             SE++  F  ++    R++ E +L+  +     +L+ L  E++  HE LAEE S ++  K
Sbjct: 1011 LSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMK 1070

Query: 1039 NFAYMNFMVKAYVN---RRIKQHKNMLLAI 1065
            +    N +V+ +V+     +K+  N++  I
Sbjct: 1071 SKFNSNLLVRKFVSLNLAHLKEQSNLVQRI 1100

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  469 bits (1206), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 338/1141 (29%), Positives = 596/1141 (52%), Gaps = 121/1141 (10%)

Query: 3    YHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62
            YH          ++FNCP P  SPLKKL+ + KDK FIL+VP TE LL Y D  T + L 
Sbjct: 4    YHLPTLLNPLLNSIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLE 63

Query: 63   ELCY-NYEFVASHTLVQLQE-------------ARVTELE-FQTINGKSVVIRPQSG--- 104
            +LCY N +F+ +H L+  ++              R+  +E F T+NG +++++ ++    
Sbjct: 64   DLCYHNVDFIGAHILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLV 123

Query: 105  IITAQPSAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGE-IELITPLRVFGPQEQ 163
            +++  P+ +K +I+R ++L +FNDYL G T F L++ID+PL+ + I L   L  F     
Sbjct: 124  LLSGSPNRQKIKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTL-- 181

Query: 164  PLQYQRITQTADAPLPLEQFLRLHPQ--------LGNQLDEVFKDAKERMRYIALSLKEL 215
             L       + DA  PL Q +  H +          +  ++ FKD     +    + +  
Sbjct: 182  TLHDNDGDSSPDAR-PLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPN 240

Query: 216  VRLFHELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVP 275
              LF ++V   Y  +K +K F+ + +L  ++  Y+E+N+Y+ +W ++  L   +  D   
Sbjct: 241  ETLFKQIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALD--DETK 298

Query: 276  GYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARIL 335
            G  I ++IS+ ++    Y    + F L  +T++EK +V++T   +KL   NS +EK+  L
Sbjct: 299  GTRI-KNISIEEIDDKFY----EMFPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENL 353

Query: 336  ISTFQKLTT---------KTSQATLDPMIDADTLLGLMVVVVCRAQVK--NLKSHLDYLR 384
            I+T Q LT          + ++   + +IDADTL+ L+++++CR+++   +LK ++ YL+
Sbjct: 354  IATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLK 413

Query: 385  EFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGIPI 444
            +F  + + + FG+L Y++ST E V+  F+           I +  + K +  +IE+ I +
Sbjct: 414  KFNYDENLINFGILSYTISTFEIVIYSFEN----------IVEYDKLKSYSEIIEKLIKV 463

Query: 445  N-LKE------HEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVN 497
            + LK+       E+ L  R+ + ES+L  CI   + + F D++ +Y+  F++++IL D N
Sbjct: 464  DDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDAN 523

Query: 498  QSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIV 557
                +LL+QAL   N  I+  +I+LL+ NC+N ++  YINK D   R VGHYL    EI+
Sbjct: 524  VEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEIL 583

Query: 558  DRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHE 617
              +GK+V+WK++DL   TPLFT+ R YD P+Y E++S  F    ++Y+  G +F  +DH 
Sbjct: 584  KIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHY 643

Query: 618  DPLGNTLLHIIKDGIQLALSTPGAN-----VNKCNTRGMTPLMVYAKYNRIENIREILND 672
            D   N++LHI++  I +  +    N     +NK N +G TPLM+Y KY+R+ N++ IL D
Sbjct: 644  DLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGD 703

Query: 673  KRLILSKLQDPQSLKAIDYVKNPIILNLIGT-AMAKNSLYGCLSVHNIKYEE--NAWYLW 729
             RL+ ++ Q        DY  +  I N +G  A+  N+++G + +H++K     NA +  
Sbjct: 704  DRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATF-S 762

Query: 730  ITSSLSPESYKTSSYAL--KDIQSLLQIYNKKHPMSFLPIDHHLETLKTL-----GKSGI 782
            +T  L  +  +T +  +  K I SLL++  KK  +S LP+D  ++ L  L      K  +
Sbjct: 763  LTFPLPDKENETGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIV 822

Query: 783  ISVINLENSMLLEALTFSLSIIQQRE---DYKNVFSYTESELSTWLRASMVKQKPN---- 835
              +  L N  LL  LT  L  +   +   DY ++ +  E++L  W+     K K N    
Sbjct: 823  RKIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLIT-DETKLLGWVTNENTKLKHNVNKT 881

Query: 836  --KRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQ------ 887
              ++  ++PE+I+ IQ+FLKF++ E   +      L+KL+ F H KS D++ S+      
Sbjct: 882  HGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHL 941

Query: 888  -------RILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLTSKI 940
                   +I  +    +  ++  + L    ++N            +DF+  C   LT  I
Sbjct: 942  VKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTL------IRDELDFLKACTLILTGNI 995

Query: 941  VEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSE-----------DSKGFFVS 989
             ++L +++  WW LYGE+  L K Y + FP     N+ +++           ++ G F  
Sbjct: 996  EDILRTQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGG 1055

Query: 990  YMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKA 1049
             +E++R K   KL++ +     +L+ L  E+   HE+LAEE++ ++  K   +   +++ 
Sbjct: 1056 LIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIRN 1115

Query: 1050 Y 1050
            +
Sbjct: 1116 W 1116

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  448 bits (1153), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 343/1124 (30%), Positives = 562/1124 (50%), Gaps = 90/1124 (8%)

Query: 15   AVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLTELCYNYEFVASH 74
            AVFNC    ASPL+K++++  D  FIL+VP T  L  Y D  T  PL ELC++ EFV+SH
Sbjct: 11   AVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHELCHSPEFVSSH 70

Query: 75   TLVQ------------LQEAR-VTELEFQTINGKSV--VIRPQSGIITAQPSAKKCR-IQ 118
             L +            L   R V E +F T NGK +  +   QS   T   S +  R I 
Sbjct: 71   ILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDGFSFRSTRRIL 130

Query: 119  RCELLRSFNDYLLGRTAFALLYIDRPLVGEIELIT--PLRVF-------GPQEQPLQYQR 169
            + E L  F +YL G + F L+YID+PL+    L+    L  F        P  + L    
Sbjct: 131  KYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTTPSTRSLANLS 190

Query: 170  ITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCL 229
              +      PL   + +H Q   +   VF++ ++    I  S   L+  F + ++K+Y  
Sbjct: 191  SAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKE---ITQSESMLIPGFRKTIDKIY-- 244

Query: 230  IKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLN---GKNEPDRVPGYYITRSISLN 286
              LD +F     + +++Q YVE N+Y+DVW+ L+  N   G+ E  +     I R ISL+
Sbjct: 245  DGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEK-QSESSDIFRFISLD 303

Query: 287  QLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKT 346
            QL T  Y  +  KF L  + ++EK + +AT+ F  L++T+++ EK R+L+ T Q L+   
Sbjct: 304  QLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQILSKPV 363

Query: 347  SQ-ATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTL 405
             +       I ADTL+ L ++++ R ++KN++ HL YL+ F Q+ + +KFGLLGY++STL
Sbjct: 364  KRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTL 423

Query: 406  EAVVGYFD-----------IGGSSIKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLI 454
            EAV+ Y +           I  +   LE  +T   R+K   N   +G+  +L ++     
Sbjct: 424  EAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSN---EGL--DLSKYSHNFR 478

Query: 455  SRTPSCESVLSLCIQYGRQDVFYDIIA-NYQSHFTLEDILQDVNQSNCSLLIQALQAGNK 513
             R     S LSLCI   + D+F+++++ NY+S+F  ED+L+D      +LL+Q+LQ  N 
Sbjct: 479  YRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNH 538

Query: 514  DITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNM 573
            +ITE + D+++ N T  E+Y Y  K D   R +GHY+     ++ ++GK++ W  KD   
Sbjct: 539  EITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTG 598

Query: 574  HTPLFTVCRAYDHPSYLELLSKCFQHCFDFYST-RGKRFSFADHEDPLGNTLLHIIKDGI 632
             TPL  + R+YD   Y  ++   F    ++YST +  +F F DH D  GNTLLHIIK  I
Sbjct: 599  QTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNI 658

Query: 633  QLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYV 692
               L +P  ++NK N++G++PL   A Y+R EN+  +L D RLI S       LK     
Sbjct: 659  SFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSF---DFLKQYPNT 715

Query: 693  KNPIILN---LIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPESYK---TSSYAL 746
            K+  IL+   L   A  +N     ++ H      N   + +TS    ++ +   + ++ L
Sbjct: 716  KSAPILSHYCLDNEAPFRN----IIASHFDFRISNKRSVVLTSRSKEDAQELIGSEAFEL 771

Query: 747  KDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLEN--SMLLEALTFSLSII 804
            K++++L ++  K+HP +F P++  L+ L  + K+     +   +  S +L+ LT+ L  +
Sbjct: 772  KNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSSFCSKVLKKLTYCLDSM 831

Query: 805  QQREDYKNVFSYTESELSTWLRASMVK------QKPNKRDKIEPEEIHSIQNFLKFSLTE 858
             + E        + + L   +    V       ++ +K  K++PE I +I  FLK+ L  
Sbjct: 832  VEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILES 891

Query: 859  FNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQG-EIIASVVPSKRLRTSPFDNEF-- 915
               L+     L+K  I    KS DI  S+ I+ + G E+ +  +    +R S  DN+F  
Sbjct: 892  LLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVRYSTIDNKFLG 951

Query: 916  NDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKE----YQRNFPE 971
                D     + F   CL S+ + I  +L  K+  WW  YG++  L KE      R    
Sbjct: 952  EQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDH 1011

Query: 972  KGKPNSASSEDSK--------GFFVSYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHC 1023
            K  PN++++  +         G   +++E KR K + + ++ +S     L+ LD E+   
Sbjct: 1012 KQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTN 1071

Query: 1024 HELLAEEISFFISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEE 1067
            + L+  E   FI+ ++    + M++ +V   I   K  LL  +E
Sbjct: 1072 NTLVVIEYCIFINFQSKFIHSAMLEKWVKLNINLLKKSLLDSKE 1115

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  420 bits (1079), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 240/695 (34%), Positives = 402/695 (57%), Gaps = 15/695 (2%)

Query: 355  IDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYF-D 413
            +DADTL+ L V+VVCR++ K+LKSHL YL+ F+ NS   KFG+LGY++STLEAVV YF D
Sbjct: 17   MDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCYFED 76

Query: 414  IGGSSIKLERLITQCQRNKIFWNLIEQGIPIN----LKEHEEVLISRTPSCESVLSLCIQ 469
               ++  + +  T C++ K   + +    P N    L  ++++L  R    +S+LS+CI 
Sbjct: 77   FNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSICIT 136

Query: 470  YGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTN 529
              +  +  DI++ Y++ F +ED+L+D      +LLI++++AGN +  + +I +++ NCT 
Sbjct: 137  NHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFNCTE 196

Query: 530  TEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSY 589
             E+ +YINK D   RTV HYL    +I+  +G ++DWKRK+ +  TPLF++ R+YD P+Y
Sbjct: 197  EELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSYDQPNY 256

Query: 590  LELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTR 649
             E++   F     +Y      F + DH D  GN+LLH++K  I + L     ++N+ N +
Sbjct: 257  EEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDINEENYK 316

Query: 650  GMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNS 709
            G+TPLMVY KY R+ NI  I  D+RLIL K+Q+       DY K+  +L+ IG    K+S
Sbjct: 317  GLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSKIGERGVKDS 376

Query: 710  LYGCLSVHNIKYEE-NAWYLWITSSLSPESYKTSSYALKDIQSLLQIYNKKHPMSFLPID 768
            L+G +  H+++Y   NA     + S + + + T+   +K IQ LL+   K +P +FLP++
Sbjct: 377  LFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGLLRSILKDNPFTFLPLN 436

Query: 769  HHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQ-QREDYKNVFSYTESELSTWLRA 827
             +++ +  L +S +  +   + + LL  LT   +++   ++  +N+F+  E+ +  W+R 
Sbjct: 437  TYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPENLFT-DEASILYWMRI 495

Query: 828  SMVK--QKPNKRDK---IEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHD 882
            +  K  QKP+ ++    +EPEEI+ IQ+FL+F+  E +  +    +L+K++IF + KS D
Sbjct: 496  NTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDD 555

Query: 883  IECSQRILYSQG-EIIASVVPSKRLRTSPFDNEFND-GIDPFEQAVDFMCMCLDSLTSKI 940
             E + + L   G ++I S   S         N F++  +    + V F+  C   L+S +
Sbjct: 556  FEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLENVRFLEQCTIQLSSFV 615

Query: 941  VEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLES 1000
              +L  K+  WW  YGE   L K Y++ FP   KP SAS   S+     ++E KR++ E 
Sbjct: 616  QIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGFIETKREQSEQ 675

Query: 1001 KLQSRLSVCSENLQHLDAELKHCHELLAEEISFFI 1035
            +L  ++   S+ L+ L +E+   HE LAEE+S ++
Sbjct: 676  RLAVQIKASSKMLKELGSEIFVAHERLAEELSNYM 710

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  375 bits (962), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 332/1194 (27%), Positives = 566/1194 (47%), Gaps = 167/1194 (13%)

Query: 3    YHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62
            YH          AVFNCP P  SP KKLF   K+++FIL+VP T  LL Y D+   + L 
Sbjct: 4    YHLPTLLNPLLNAVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLN 63

Query: 63   ELCY-NYEFVASHTLV------QLQEARVT--ELEFQTINGKSVVIRPQSGIITAQ---P 110
            ELCY N +F+ SH L         +++  T  + EF  +NG   +I+ +  II  +    
Sbjct: 64   ELCYHNSDFLGSHILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFS 123

Query: 111  SAKKCRIQRCELLRSFNDYLLGRTAFALLYIDRPL-VGEIELITPLRVFGPQEQPLQYQR 169
            + ++ +I +   L +FNDY  G   F L++ID+P+ V  +     L+   P  + L+   
Sbjct: 124  NDQRFKILKIHPLTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLK--- 180

Query: 170  ITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALS---------LKELVRLFH 220
             +Q  + PL  +   +      N L+   K+    +++  LS         L+   +LF 
Sbjct: 181  -SQEKETPLVQDLSQQSKSSFENDLN---KNEAWNLKFGILSNNYKIESSELEPNHKLFR 236

Query: 221  ELVEKVYCLIKLDKNFRNYL-------NLLEMVQGYVELNMYEDVWRKLVQL---NGKNE 270
            ELV + +  I++D               L ++   Y+E ++Y+++W ++ ++   + KN 
Sbjct: 237  ELVNEAF--IEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNY 294

Query: 271  PDRVPGYYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHE 330
             D     ++ +  S+ ++  + Y    D F L  V  +EK +  +  C +KL  T S+ E
Sbjct: 295  ADDQKAQHLIKHFSIVEIDPNFY----DIFPLKFVPMLEKNLKHSVTCINKLKSTKSYTE 350

Query: 331  KARILISTFQKLTTKTS--QATLDP-----MIDADTLLGLMVVVVCRAQV--KNLKSHLD 381
            K+ ILI + Q +T   +  + + D      +IDAD LL L+ +V+ ++ +   +LK++L 
Sbjct: 351  KSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLY 410

Query: 382  YLREFAQNSDDVKFGLLGYSLST-------LEAVVGYFDIGGSSIKLERLITQCQRNKI- 433
            YL+ F+ +     FG+L Y+++T       LE V+ +  +   S  +E LI     + + 
Sbjct: 411  YLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEELIMTDDLSTLS 470

Query: 434  --FWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLED 491
              F N           + + +L+ R  + ES+L+L I   +   F   +  Y+    ++ 
Sbjct: 471  STFEN-----------DKKTLLMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDI 519

Query: 492  ILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTN-TEMYAYINKCDIAGRTVGHYL 550
            I  D +  + +LL+QA+++ N +    ++ LL  NC N  E+ +YIN+ DI  R +GHYL
Sbjct: 520  ISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYL 579

Query: 551  PQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKR 610
              N  I+  +G+F++WK+KD+N  TPLFT+ R+YD  +Y EL+ + FQ    +Y+    +
Sbjct: 580  VINLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLK 639

Query: 611  FSFADHEDPLGNTLLHIIKDGIQLALSTPG-----ANVNKCNTRGMTPLMVYAKYNRIEN 665
            F   DH+D  GN+LLHI+++ I + L          N+NK N +G TPLM+Y KY R +N
Sbjct: 640  FQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDN 699

Query: 666  IREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNS-LYGCLSVHNIKYEEN 724
            IR I+ +++LI +K Q P  +   DY  +  I+N IG  +  N  L+G + V ++K + +
Sbjct: 700  IRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMS 759

Query: 725  A-----WYLWITSSL----SPESYKTSSYALKDIQSLLQIYNKKHPMSFLPID------- 768
                    L+I  ++    + +S  T +     +   L+I  +K+ +SFLP+D       
Sbjct: 760  TVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQ 819

Query: 769  ----------HHLET--LKTLGKSGIISVINLENSMLLEALTFSLSIIQ--QREDYKNVF 814
                      ++L T  L+ + K  I   +   N+ L   L F  S I          + 
Sbjct: 820  SFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELL 879

Query: 815  SYTESELSTWLRASMVKQKPNKRDKIE------------PEEIHSIQNFLKFSLTEFNYL 862
             +   E S   R+S     P+ + K+E            PE I+ IQNFLKF+L E N +
Sbjct: 880  EWISIEESKLRRSSTT---PSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTI 936

Query: 863  REKFTVLKKLIIFEHYKSHDIECSQ-RILYSQGEIIASVVPS------KRLRTSPFDNEF 915
                 VL KL+IF + K+ DI  +Q R       +    VPS        + +S +D++ 
Sbjct: 937  SMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDK 996

Query: 916  NDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNF------ 969
               ++   + + F   C   L   +  ++  K+  WW LYGE+  L K Y +NF      
Sbjct: 997  GVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVH 1056

Query: 970  --------------------------PEKGKPNSASSEDS-KGFFVSYMEDKRQKLESKL 1002
                                      P++   +S    +S  G F + +E+++ KLE K 
Sbjct: 1057 ARRTDLLSGNNANTNTNTNTNTNTNSPQRLHHHSEHQNNSNNGVFANLIENQKNKLERKT 1116

Query: 1003 QSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRIK 1056
               +      L+ L + L + HE LAEE++ ++  KN  +   ++K +V   IK
Sbjct: 1117 SHHIDETISLLESLGSGLLNKHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIK 1170

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  343 bits (880), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 314/1177 (26%), Positives = 553/1177 (46%), Gaps = 175/1177 (14%)

Query: 43   VPRTEVLLQYQDATTYVP-----------LTELCYN-YEFVASHTLVQLQEARVTELE-- 88
             P T++LL Y D++   P           L +LC N Y+F+ASH L  L +++V + +  
Sbjct: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHIL--LYDSKVIKNDQC 99

Query: 89   -FQTINGKSVVIRPQSG--------IITAQPSA------KKCRIQRCELLRSFNDYLLGR 133
              ++INGK++ I+  +G        ++   PS       K  +I + +L  +FN YL G 
Sbjct: 100  VMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGM 159

Query: 134  TAFALLYIDRPLVGEIELITPLRVFGPQE-QPLQYQRITQ--------TADAPLPLEQFL 184
              + + YID PL   I     L  F  +  +  QY  I Q        T D    +    
Sbjct: 160  ENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNIS 219

Query: 185  RLHPQLGNQ----LDEVFKDAKERMRYIALSLKELVRLFH------------------EL 222
            +L P +         ++ KD +   + +  S +   +                     E+
Sbjct: 220  KLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEM 279

Query: 223  VEKVYC----LIKLDK--NFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPG 276
            V  + C     +K +K  NF ++ NL+E++  ++E+ +++D+W ++     +++ D    
Sbjct: 280  VRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFD---- 335

Query: 277  YYITRSISLNQLSTSIYP-EELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARIL 335
            +    +IS+N+L  + Y       F L  +  +EK++ +A   F K     +  EK+  L
Sbjct: 336  FSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTAL 395

Query: 336  ISTFQKLTTKTSQATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKF 395
            I T Q LT       ++ + DADTL+GL+ +V+CR +V+NLKSHL YL+ FA + + +KF
Sbjct: 396  IKTLQILT-------INKLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKF 448

Query: 396  GLLGYSLSTLEAVVGYFDIGGSSIKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLIS 455
            G+LGYS+STLEA+  YFD    S K + LI  C +    ++ I   I        ++L  
Sbjct: 449  GILGYSISTLEAITYYFDHISHSHKAD-LIAFCDKLHNLYDTILNNIK---SLDNDILSY 504

Query: 456  RTPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDI 515
            R+ + ES+LSLCI   + D+F +++  Y+  F +EDIL D + +  SLL+QA +  N   
Sbjct: 505  RSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVA 564

Query: 516  TEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHY--LPQNYEIVDRLGKFVDWKRKDLNM 573
            +E ++ +L  +C   E+  ++NK D   R+V HY  +  +  I+   G  +DW+ KD+  
Sbjct: 565  SEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKK 624

Query: 574  HTPLFTVCRAYD---HPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKD 630
             TPL T+ + +    + S++++L   F+    +Y    K F+   H D  GN LLH++KD
Sbjct: 625  LTPLLTIFKVHKVNYNESFIKIL---FRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKD 681

Query: 631  GIQLALSTP----GANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSL 686
             I   +  P      N+N  N +G++P MVY K NR +NIR IL +  LI S+ Q P  +
Sbjct: 682  YINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLI 741

Query: 687  KAIDYVKNPIILNLIGTAMAKNSLYGCLSVHNIKYEEN---------AWYLWIT----SS 733
             + + + N  + +L+ T   +   +  + +H++++ +          AW + I+     S
Sbjct: 742  TSTN-LYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKES 800

Query: 734  LSPESY----KTSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKS-GIISVIN- 787
              P S+    +T +  LK I+SLL  + +K+  S LP+   LE    L KS   IS  + 
Sbjct: 801  EFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSN 860

Query: 788  ---LENSMLLEAL--TFSLSIIQQ-------REDYKNVFSYTESELSTWLRASMVKQK-- 833
               L  S+L++ L   ++L +I           D+     + E +L  +L+ +  K K  
Sbjct: 861  RHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKES 920

Query: 834  --------PNKRDKI-------EPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHY 878
                     N  D+        +PE+I++IQ F+KF+L E    +   T +K + I   Y
Sbjct: 921  NSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKY 980

Query: 879  KSHDIECSQRILYSQ---------GEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFM 929
            K  D+  SQ                EI+      K L T+ + +      + ++  V+F+
Sbjct: 981  KIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFL 1040

Query: 930  CMCLDSLT--SKIV--------EVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSAS 979
               L++L    K+V        ++ +  + TWW  YG + + + +Y +++P +    + +
Sbjct: 1041 NKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNN 1100

Query: 980  SEDSKGFFVSYMEDKRQKLESKLQSRLSV------CSENLQHLDAELKHCHELLAEEISF 1033
             E     F     DKR   +S      ++       S  L+  + ++K  HE LA E++ 
Sbjct: 1101 FESFNTMF-----DKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNN 1155

Query: 1034 FISSKNFAYMNFMVKAYVNRRIKQHKNMLLAIEEFIS 1070
            F++ KN     +++K      IK  K+ ++ ++  I+
Sbjct: 1156 FMNFKNKFIREYIIKFSTIEVIKILKDNIIYMDSIIA 1192

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  237 bits (605), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 249/830 (30%), Positives = 391/830 (47%), Gaps = 125/830 (15%)

Query: 251  ELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTS-IYPEELDKFNLSPVTEIE 309
            E  +Y  +W KLV     +EP  +  +Y    IS ++L+ +  Y    +KF+L  V  IE
Sbjct: 179  EARLYSSIWNKLVH--QTSEPQNIDKFYGCY-ISFHELNINDYYSLPFNKFSLRDVVFIE 235

Query: 310  KRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDADTLLGLMVVVVC 369
              V  A + F KL  + S  EK  IL+STF  LT+K  Q      IDAD LL  M++++ 
Sbjct: 236  NVVDLACKEFVKLRESLSFDEKIDILLSTFNILTSKLPQLE----IDADNLLNFMLIIIN 291

Query: 370  RAQVKNLKSHLDYLREF--AQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSSIKLERLITQ 427
            R ++ NL  H  YL+ F   QN D   FG+L Y++STL AV+ Y D   +  K +R    
Sbjct: 292  RVKLNNLNEHFHYLQNFNFKQNKD---FGILNYAISTLGAVLYYID--NNLDKFKRYTDA 346

Query: 428  CQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDII--ANYQS 485
             Q +KI                EE L  R  + ES L  CI     D   +++  + Y  
Sbjct: 347  IQDSKI---------------SEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIK 391

Query: 486  HFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRT 545
            +F +EDIL D      +LL+ A++  N      +I+++I N T  E+  Y+N  D   R 
Sbjct: 392  NFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRN 451

Query: 546  VGHYLPQNYEIVDRLGKFVDWKRKDLNM-HTPLFTVCRAYDHP--SYLELLSKCFQHCFD 602
            VGH++   Y ++ ++G +++W  KD     TPLF + R+YD    SY ++  + F+   D
Sbjct: 452  VGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD 511

Query: 603  FYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNR 662
                    F    H D   NTLLHI+K  IQ+ L      +N  N+ GMTPLMV+ KY R
Sbjct: 512  -----SGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRR 566

Query: 663  IENIREILNDKRLILSKLQDPQSLKAIDYVKNPI-----------ILNLIGTAMAKN-SL 710
            + NI+ +L+      SK +D  S+     V N             ILNL+G    KN S+
Sbjct: 567  LYNIQILLS------SKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSI 620

Query: 711  YGCLSVHNIKY--------EENAWYLWITSSLSPESYKTSSYALKDIQSLLQIY--NKKH 760
            +G    H++K          +N + + IT     + YKT  + +K I++L+ +   +  H
Sbjct: 621  FGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKK-YKTIRFNIKTIKALINMVLTSNSH 679

Query: 761  PMSFLPIDHHLETLKTLG-----KSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFS 815
              SFLP+      L  +      KS I+ + NL  +++L+ + F L ++  RE +     
Sbjct: 680  VSSFLPLYKVFNELNGIASMISTKSKILFINNL--NVILDTILF-LELV-PREGF----- 730

Query: 816  YTESELSTWLRASM-VKQKPNKRDKIEPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLII 874
              E+ L  +LR    +K    K  K++ E+I+ I NFLKF+L E N  +     +KK  I
Sbjct: 731  ILEARLKDYLRNQRKIKTVATKSKKLQIEDINMISNFLKFNLNELNAFKNG---VKK--I 785

Query: 875  FEHYKSHDIEC-SQRILYSQGEIIASVVPSKRLRTSPFDNEFNDGIDPF---EQAVDFMC 930
                 S +++   QRI Y        VV    L    ++  +N  I  F   E ++D   
Sbjct: 786  LRQMNSINLKLFDQRISYMDLLHCPDVVV--HLNNPLWNLNYNILISNFQILENSIDNTL 843

Query: 931  MCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDS--KGFFV 988
              L     K+ +  + K+  WW L  E+ NL K             +++S+D   + FF 
Sbjct: 844  HFL-----KVFQ--NEKIRKWWKLNNELINLTKL------------ASNSDDDLLRSFF- 883

Query: 989  SYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSK 1038
                ++++KL  ++  ++   +E    L+ ++   HELLA EI+ F+  K
Sbjct: 884  ----NRKEKLSIEIDDKIRSINE----LNCDIFVSHELLAVEINNFMKFK 925

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  150 bits (379), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 147/281 (52%), Gaps = 31/281 (11%)

Query: 3   YHXXXXXXXXXXAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLT 62
           YH          A+FNCP P  SPLKKLF N K ++FIL+ P +E LL Y D  + +PL 
Sbjct: 4   YHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLH 63

Query: 63  ELCYNYEFVASHTLVQLQEARVT----ELEFQTINGKSVVIRPQSGIITAQPS---AKKC 115
           +LCYN EF+ S+ L+  + + +     +  ++T++GK+VVI+ ++ +I A       ++ 
Sbjct: 64  DLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIRRRL 123

Query: 116 RIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQPLQYQRITQTAD 175
           +I   ++L +FNDY  G   F +L+ID+PL  E      L+ F        Y++I + A 
Sbjct: 124 KILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFH------NYEKIPKNAH 177

Query: 176 APLP-------------LEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHEL 222
           A +P              E  L +HP    QL ++F       R +A        +F  +
Sbjct: 178 A-MPNLSIDSFQQERSSFENILHIHPARLTQLGQLFSS----YRTLAPGDDPSRSIFESI 232

Query: 223 VEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLV 263
           V++ +  +K D  F+N+ NL +++  Y ELN+Y+D+W +L 
Sbjct: 233 VQQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLT 273

>ZYRO0D15092g Chr4 (1268414..1270615) [2202 bp, 733 aa] {ON} similar
           to uniprot|P40566 Saccharomyces cerevisiae YIR007W
           Hypothetical ORF
          Length = 733

 Score = 35.4 bits (80), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 758 KKHPMSFLPIDHHLETLKTLGKSGIISVINLE-------NSMLLEALTFSLSIIQQREDY 810
           K HPMS   I+ H++ +K+LG + +  + N E            E + F++ ++Q+  + 
Sbjct: 61  KGHPMSLEEIESHVKRIKSLGYNSVRFLFNWEAIEHEGPEIYDYEYMDFAIELLQRINEI 120

Query: 811 KNVFSYTESELSTWLRASMVKQKP 834
             ++ Y +     W RA      P
Sbjct: 121 GGLYVYLDPHQDVWSRACGGSGAP 144

>Smik_13.38 Chr13 complement(75428..76786) [1359 bp, 452 aa] {ON}
           YML097C (REAL)
          Length = 452

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 357 ADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGY-FDIG 415
           ADT + +++  + + QV+ L S+++Y+  F   S D   G   Y LS+L+A + +  ++ 
Sbjct: 251 ADTFIPILIYCILKGQVRYLVSNVNYIERF--RSSDFIRGEEEYYLSSLQAAINFIMNLT 308

Query: 416 GSSIKLE 422
            SS+ +E
Sbjct: 309 ESSLTIE 315

>Ecym_7027 Chr7 (50050..51936) [1887 bp, 628 aa] {ON} similar to
           Ashbya gossypii AER113W
          Length = 628

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 58/128 (45%), Gaps = 20/128 (15%)

Query: 177 PLPLEQFLRLHPQLGNQLDEVFK-DAKERMRYIALSLKELVRLFHELVEKVYCLIKLDKN 235
           PLP+E  L+L P+  +    V + +     R +A  +++ + LF + +E + C +++DK 
Sbjct: 286 PLPVE--LQLDPRSFSSFPSVRRSELAPYCRIMACDIQQTIELFKKDIESIQCQLEVDKA 343

Query: 236 FRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYPE 295
             N         G   +   E +  ++ Q   + E D++P  +            +I P+
Sbjct: 344 MYN-------DDGVYAIKAIEQIQNEIKQCTEQEETDKIPDIF----------RLTIGPK 386

Query: 296 ELDKFNLS 303
            LD++N S
Sbjct: 387 ALDRYNDS 394

>NCAS0D04810 Chr4 complement(919711..923829) [4119 bp, 1372 aa] {ON}
           Anc_6.356 YCR081W
          Length = 1372

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 18/124 (14%)

Query: 590 LELLSK-CFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTPG-----ANV 643
           LEL+ K  F H    +  + + F F     PL   +L I  DGI   L T G     +N 
Sbjct: 263 LELIDKEIFHHWLVEFVAKVENFEFI----PLTLHMLTIFWDGICKPLGTKGNTEMLSNQ 318

Query: 644 NKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGT 703
           +      MT  M+  KY+ I   R ++ND++ I++ ++    LK         +L+++GT
Sbjct: 319 SLFLISKMTD-MLLQKYSTIYQSRSMINDEKYIINDIKKNNKLKE-------SMLSILGT 370

Query: 704 AMAK 707
            + K
Sbjct: 371 LIGK 374

>TPHA0A02130 Chr1 complement(432707..435508) [2802 bp, 933 aa] {ON}
            Anc_8.195 YDR074W
          Length = 933

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 11/149 (7%)

Query: 853  KFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFD 912
            +FS  E      KF+ +  L + +     +IE   + + ++GEI+  ++ +K   T  F 
Sbjct: 741  EFSAKELKNELLKFSDVHDLEVMD--GKANIEVRPKFV-NKGEIVKRLIWNKHGETPDFL 797

Query: 913  NEFNDGIDPFEQAVDF-MCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPE 971
               + G  PFEQ  DF +C+  D     + + L+S    W   Y ++ N    Y      
Sbjct: 798  KGADTG-KPFEQMADFVLCLGDDRTDEDMFKQLNSVHDIWSEKYPDMKNGNGSYGL---- 852

Query: 972  KGKPNSASSEDSKGFFVSYMEDKRQKLES 1000
               P S  S   K    +++ D +Q LE+
Sbjct: 853  --YPVSVGSGKKKTVAKAHLTDPQQVLET 879

>KLLA0A00781g Chr1 complement(75435..75950) [516 bp, 171 aa] {ON}
           similar to uniprot|P53066 Saccharomyces cerevisiae
           YGL242C Hypothetical ORF
          Length = 171

 Score = 32.3 bits (72), Expect = 3.4,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 17/105 (16%)

Query: 615 DHEDPLGNTLLHIIK-----DGIQLALSTPGANVNKCNT-RGMTPLMVYAKYNR------ 662
           D +DPLGNT +H+       D + + L   G +VN+ N+  G T L +   Y+       
Sbjct: 43  DSKDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG 102

Query: 663 ---IENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTA 704
               EN+ E+  D R+   + Q P  L   D +++  ++NL+  A
Sbjct: 103 TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELES--LVNLLQGA 145

>KLLA0B12848g Chr2 (1122397..1123482) [1086 bp, 361 aa] {ON} similar
           to uniprot|Q03175 Saccharomyces cerevisiae YMR101C SRT1
           Cis-prenyltransferase involved in dolichol synthesis and
           weakly similar to YBR002C uniprot|P35196 Saccharomyces
           cerevisiae YBR002C RER2 Cis- prenyltransferase involved
           in dolichol synthesis; participates in endoplasmic
           reticulum (ER) protein sorting
          Length = 361

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%)

Query: 774 LKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVK 831
           L TL    +  +    +  L +  + SL  I+QR +YK+V SY  S L  WL+  MV+
Sbjct: 16  LVTLDGENVSHLFEQNDENLNKVSSLSLQQIRQRLNYKDVGSYPFSRLFAWLQMFMVR 73

>TBLA0C06290 Chr3 complement(1521582..1523093) [1512 bp, 503 aa]
           {ON} Anc_8.876 YML097C
          Length = 503

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 62/121 (51%), Gaps = 4/121 (3%)

Query: 294 PEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDP 353
           PE LD  N+     ++K V  + +  SK+    +  +K   ++++ + L     Q+ L+ 
Sbjct: 197 PEYLDITNVE-TERLDKFVNFSVDELSKVNGYKAPRDKVVCILNSCKVLFGILKQSQLEG 255

Query: 354 MIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFD 413
              ADT + L++  + ++ ++NL S++ Y+  F    ++   G   Y LS+L+A + + +
Sbjct: 256 K-GADTFIPLLIYTLLKSDIENLVSNVRYIERFR--FENFIRGEESYYLSSLQAAINFIN 312

Query: 414 I 414
           +
Sbjct: 313 L 313

>Suva_13.51 Chr13 complement(79421..80785) [1365 bp, 454 aa] {ON}
           YML097C (REAL)
          Length = 454

 Score = 32.0 bits (71), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 357 ADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGY-FDIG 415
           AD+ + +++  + + QV+ L S+++Y+  F   S +   G   Y LS+L+A V +  ++ 
Sbjct: 250 ADSFIPVLIYCILKGQVRYLVSNVNYIERF--RSPEFMRGEEEYYLSSLQAAVNFTMNLT 307

Query: 416 GSSIKLE 422
            SS+ +E
Sbjct: 308 ESSLTIE 314

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 111,871,329
Number of extensions: 5011041
Number of successful extensions: 16190
Number of sequences better than 10.0: 76
Number of HSP's gapped: 16514
Number of HSP's successfully gapped: 79
Length of query: 1071
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 951
Effective length of database: 39,721,479
Effective search space: 37775126529
Effective search space used: 37775126529
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)