Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR005W6.21ON32732713870.0
Ecym_30256.21ON3183388231e-109
SAKL0E01210g6.21ON3233338131e-107
KLLA0D01155g6.21ON3353307971e-105
Kwal_56.224336.21ON3223327631e-100
ZYRO0C07788g6.21ON3343297343e-95
KLTH0C11220g6.21ON3273367282e-94
TDEL0G044806.21ON3433397274e-94
CAGL0E02739g6.21ON3433297014e-90
TBLA0G010506.21ON3503406972e-89
TPHA0J003406.21ON3383366865e-88
YOR007C (SGT2)6.21ON3463406875e-88
Smik_15.1766.21ON3453406867e-88
Kpol_1037.266.21ON3423456858e-88
Skud_15.1686.21ON3483436805e-87
NCAS0H008306.21ON3383416735e-86
KAFR0L004106.21ON3313376691e-85
Suva_15.1826.21ON3463406667e-85
NDAI0D008106.21ON3493416572e-83
KNAG0M011706.21ON3393416362e-80
Kpol_1032.86.21ON3433304841e-57
NCAS0D026706.21ON3512183376e-36
NDAI0I022406.21ON3503353236e-34
TBLA0A072706.21ON3732542679e-26
TPHA0M002706.21ON3771222326e-21
NDAI0F009105.617ON583962223e-19
CAGL0H08195g5.617ON583962223e-19
TPHA0D028805.617ON5851142171e-18
TBLA0E033005.617ON582962162e-18
SAKL0G07084g5.617ON585962143e-18
KAFR0C058905.617ON575972134e-18
ZYRO0A05676g5.617ON572962109e-18
Kwal_55.199355.617ON593962101e-17
YOR027W (STI1)5.617ON589962063e-17
Smik_15.2055.617ON589962038e-17
AEL224W5.617ON580962011e-16
KLLA0A07062g5.617ON581962011e-16
Skud_15.1925.617ON589961993e-16
NCAS0G008105.617ON5842331983e-16
Kpol_1018.695.617ON590961984e-16
KLTH0E02178g5.617ON593961975e-16
KNAG0B032005.617ON579961967e-16
Ecym_55825.617ON584961931e-15
Suva_8.805.617ON586961888e-15
TDEL0A048405.617ON576961815e-14
KLLA0F24046g2.152ON604821622e-11
Ecym_44133.481ON510751576e-11
NCAS0A00490singletonON620971542e-10
KLTH0B05170g2.152ON593821495e-10
AAR083C3.481ON5381291461e-09
Kwal_33.147672.152ON594821452e-09
KNAG0A079003.481ON512971452e-09
SAKL0E10956g2.152ON600821442e-09
KAFR0B066103.481ON511891406e-09
NCAS0B070102.152ON625941407e-09
NCAS0G024802.152ON596821391e-08
Kpol_505.413.481ON5131011363e-08
TBLA0C039503.481ON512971353e-08
CAGL0D05060g3.481ON510811354e-08
ABR131W2.152ON594821344e-08
Skud_8.1782.152ON638941336e-08
NDAI0B043402.152ON664821336e-08
Ecym_82042.152ON597821327e-08
NDAI0F028102.152ON609821328e-08
YHR117W (TOM71)2.152ON639941329e-08
Suva_15.3142.152ON644941301e-07
TDEL0D055003.481ON512971273e-07
NDAI0B057903.481ON523971273e-07
NCAS0F034903.481ON512971273e-07
TDEL0B051402.152ON599941274e-07
Smik_8.1952.152ON635941274e-07
SAKL0F03102g3.481ON513891255e-07
Suva_7.4083.481ON513751256e-07
TPHA0I015102.152ON603941256e-07
KAFR0F007202.152ON608821256e-07
Smik_6.2153.481ON513751239e-07
YGR123C (PPT1)3.481ON513751239e-07
ZYRO0G06512g2.152ON604941239e-07
Skud_7.4323.481ON513911221e-06
CAGL0L04048g2.152ON587821212e-06
KNAG0A039508.506ON3861281192e-06
YNL121C (TOM70)2.152ON617941194e-06
TBLA0H033808.506ON3751011184e-06
TPHA0D032203.481ON5131041175e-06
Skud_14.2112.152ON617941176e-06
ZYRO0B04224g3.481ON5131071176e-06
Smik_14.2072.152ON617941176e-06
KLTH0F14542g3.481ON513921176e-06
CAGL0L12936g2.152ON600941176e-06
Kpol_1048.212.152ON597941168e-06
Suva_14.2192.152ON617941169e-06
Kwal_55.211753.481ON511921151e-05
SAKL0H10934g8.506ON3801001131e-05
KNAG0H035302.152ON614671113e-05
KLLA0B09966g8.506ON3701241104e-05
AGL268C8.506ON379991086e-05
KLLA0B10912g3.481ON512671079e-05
ADR230W5.689ON685701061e-04
TBLA0C055302.152ON610941061e-04
Ecym_25598.506ON370851042e-04
Smik_2.2958.506ON385851023e-04
Suva_4.4058.506ON385851006e-04
YBR155W (CNS1)8.506ON38585970.001
KAFR0E029808.506ON380101960.002
CAGL0H07425g8.506ON38088960.002
Skud_2.2828.506ON38585960.002
NCAS0B024008.506ON38088960.002
Ecym_40315.689ON68897960.002
TDEL0B013108.506ON38099950.003
TPHA0D038606.328ON120118880.004
SAKL0A01672g6.328ON12857870.005
NDAI0C052908.506ON379102900.010
Kpol_513.28.506ON374101890.014
CAGL0K09240g6.328ON14263840.016
Kpol_1018.1067.412ON75396890.017
Ecym_20906.328ON17254840.028
KLLA0E20857g7.412ON71087870.028
Kpol_1006.43.367ON73281870.029
ZYRO0F08624g8.506ON379101860.030
Kpol_1043.605.689ON70663860.034
Skud_2.247.412ON76997850.052
NCAS0B025608.470ON578117850.053
YBL084C (CDC27)7.412ON75897850.056
Kwal_27.107407.412ON62896840.064
TPHA0E007407.412ON74697840.064
KLTH0F18150g5.689ON68989830.091
KAFR0L018707.412ON71286820.12
TPHA0L014208.506ON37488800.16
Suva_2.347.412ON76397810.16
Smik_2.367.412ON75197800.17
AEL281C7.546ON139054800.19
Kwal_27.117378.470ON575127800.21
KLLA0A05258g5.72ON63286800.21
Kpol_1028.516.328ON11780740.26
NCAS0E024907.412ON80997790.26
KAFR0J025706.328ON12174740.28
KLLA0C15455g8.470ON566123780.36
ZYRO0B03828g7.412ON72796780.37
SAKL0F12936g7.412ON63296780.38
TBLA0F032203.395ON53663770.38
NDAI0C051308.470ON590118770.40
Kwal_34.159775.352ON59761770.43
NCAS0H035402.665ON76066770.44
SAKL0H11946g8.470ON573119770.45
AAR054C6.328ON13357730.48
NDAI0F004005.689ON76469760.59
Smik_2.2543.367ON1020120760.64
KAFR0E022405.72ON62358760.64
CAGL0I02288g5.72ON63991760.67
Skud_8.2305.72ON62657750.69
KNAG0L020105.689ON70280760.69
TPHA0M016303.367ON1043122750.80
Suva_15.3665.72ON62657750.83
Smik_8.2505.72ON62657740.91
YHR166C (CDC23)5.72ON62657740.91
Ecym_34593.367ON111583741.1
NDAI0C033505.72ON64957741.2
KLTH0C06204g7.412ON62796741.2
NDAI0C043205.352ON706111731.3
SAKL0B07986g3.367ON88083731.3
ZYRO0C16522g3.367ON97483731.3
TDEL0B053001.456ON397126731.3
TDEL0C027207.412ON70093731.4
KLTH0F10428g3.367ON79583731.5
NDAI0E040407.412ON78397731.5
KNAG0H006103.367ON97383731.6
KLTH0E10934g8.470ON568125721.7
TBLA0B086803.32ON91489721.8
AFR453W8.470ON569131721.9
TBLA0B079705.72ON68791721.9
Skud_4.5068.470ON61149721.9
Ecym_56372.665ON71766721.9
SAKL0E14542g5.689ON69053722.0
YCR060W (TAH1)6.328ON11160672.0
TDEL0A05450na 1ON11037672.1
Smik_4.4918.470ON61249712.1
TDEL0E027505.352ON564140712.1
ZYRO0A02926g8.470ON57750712.2
ACR168W2.665ON70766712.2
ABR206W5.72ON61457712.3
KLLA0E08009g2.665ON721116712.5
Suva_2.4108.470ON61149712.5
Skud_2.2403.367ON984120712.6
TDEL0C050903.367ON75983712.6
Ecym_50925.72ON62657712.6
KLTH0A00638g7.546ON141178712.7
NCAS0D045006.328ON12148672.7
NCAS0A112003.367ON90783712.8
ZYRO0C11594g5.72ON62857703.0
NCAS0D013905.72ON63157703.0
CAGL0C01903g7.412ON76988703.0
NDAI0I004406.328ON12863673.1
KAFR0H008703.367ON88783703.4
SAKL0H02244g5.72ON62857694.0
NCAS0C044903.32ON91899694.0
Kwal_23.36703.367ON80281694.1
YBR112C (CYC8)3.367ON966120694.1
KLTH0H00704g5.72ON62157694.2
KAFR0E028208.470ON562123694.3
CAGL0H07095g5.352ON661101694.4
CAGL0D01364g3.367ON114883694.7
CAGL0K11209g8.470ON59064684.8
AGL294W7.412ON65696684.9
Suva_4.3613.367ON96381694.9
Kpol_1050.825.72ON63957684.9
YDR244W (PEX5)8.470ON61249685.0
CAGL0M08030g1.456ON387117685.4
NCAS0A153007.546ON139878685.4
Kwal_56.247505.72ON61957685.5
CAGL0E01573g3.32ON90499685.8
ADL344W3.367ON91083685.8
Suva_10.5604.327ON102551686.0
Kpol_1057.142.665ON72466676.8
AER044W4.237ON110339676.9
KLLA0C08910g6.328ON11553637.2
KNAG0E006805.72ON63957677.3
NDAI0A051003.367ON1007107678.2
TBLA0A016908.470ON66275678.4
TPHA0G004305.689ON72856668.6
TBLA0H015203.367ON68956668.8
TBLA0D004607.412ON83599668.9
TDEL0G009605.72ON62257669.1
CAGL0G10087g7.546ON141183669.2
Ecym_53444.237ON110239669.4
Kwal_23.54087.546ON141073669.5
KNAG0F040107.546ON141878669.6
Ecym_71427.412ON67596669.6
KAFR0B002507.546ON142082669.7
Ecym_34333.395ON53623669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR005W
         (327 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   538   0.0  
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   321   e-109
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   317   e-107
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   311   e-105
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   298   e-100
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   287   3e-95
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   285   2e-94
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   284   4e-94
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   274   4e-90
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   273   2e-89
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   268   5e-88
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   269   5e-88
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   268   7e-88
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   268   8e-88
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   266   5e-87
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   263   5e-86
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   262   1e-85
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   261   7e-85
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   257   2e-83
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   249   2e-80
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   191   1e-57
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   134   6e-36
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   129   6e-34
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   107   9e-26
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    94   6e-21
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     90   3e-19
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    90   3e-19
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    88   1e-18
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    88   2e-18
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    87   3e-18
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    87   4e-18
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    86   9e-18
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    86   1e-17
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    84   3e-17
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    83   8e-17
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    82   1e-16
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    82   1e-16
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    81   3e-16
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    81   3e-16
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    81   4e-16
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    80   5e-16
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    80   7e-16
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    79   1e-15
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    77   8e-15
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    74   5e-14
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    67   2e-11
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    65   6e-11
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       64   2e-10
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    62   5e-10
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    61   1e-09
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    60   2e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    60   2e-09
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    60   2e-09
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    59   6e-09
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    59   7e-09
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    58   1e-08
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    57   3e-08
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    57   3e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    57   4e-08
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    56   4e-08
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    56   6e-08
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    56   6e-08
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    55   7e-08
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    55   8e-08
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    55   9e-08
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    55   1e-07
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    54   3e-07
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    54   3e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    54   3e-07
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    54   4e-07
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    54   4e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    53   5e-07
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    53   6e-07
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    53   6e-07
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    53   6e-07
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    52   9e-07
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    52   9e-07
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    52   9e-07
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    52   1e-06
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    51   2e-06
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    50   2e-06
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    50   4e-06
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    50   4e-06
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    50   5e-06
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    50   6e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    50   6e-06
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    50   6e-06
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    50   6e-06
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    50   6e-06
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    49   8e-06
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    49   9e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    49   1e-05
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    48   1e-05
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    47   3e-05
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    47   4e-05
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    46   6e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    46   9e-05
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    45   1e-04
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    45   1e-04
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    45   2e-04
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    44   3e-04
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    43   6e-04
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    42   0.001
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    42   0.002
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    42   0.002
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    42   0.002
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    42   0.002
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    42   0.002
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    41   0.003
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    39   0.004
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    38   0.005
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    39   0.010
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    39   0.014
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    37   0.016
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    39   0.017
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    37   0.028
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    38   0.028
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    38   0.029
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    38   0.030
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    38   0.034
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    37   0.052
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    37   0.053
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    37   0.056
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.064
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    37   0.064
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    37   0.091
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    36   0.12 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    35   0.16 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    36   0.16 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    35   0.17 
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    35   0.19 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    35   0.21 
KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} simila...    35   0.21 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    33   0.26 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    35   0.26 
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    33   0.28 
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    35   0.36 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    35   0.37 
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    35   0.38 
TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {O...    34   0.38 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    34   0.40 
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...    34   0.43 
NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.6...    34   0.44 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    34   0.45 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    33   0.48 
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    34   0.59 
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    34   0.64 
KAFR0E02240 Chr5 complement(451940..453811) [1872 bp, 623 aa] {O...    34   0.64 
CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {...    34   0.67 
Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON...    33   0.69 
KNAG0L02010 Chr12 (357972..360080) [2109 bp, 702 aa] {ON} Anc_5....    34   0.69 
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    33   0.80 
Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {...    33   0.83 
Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON...    33   0.91 
YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}  ...    33   0.91 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    33   1.1  
NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {O...    33   1.2  
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    33   1.2  
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    33   1.3  
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    33   1.3  
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    33   1.3  
TDEL0B05300 Chr2 (932958..934151) [1194 bp, 397 aa] {ON} Anc_1.4...    33   1.3  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    33   1.4  
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    33   1.5  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    33   1.5  
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    33   1.6  
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    32   1.7  
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    32   1.8  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    32   1.9  
TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5...    32   1.9  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    32   1.9  
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    32   1.9  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    32   2.0  
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    30   2.0  
TDEL0A05450 Chr1 complement(956982..957314) [333 bp, 110 aa] {ON}      30   2.1  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    32   2.1  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    32   2.1  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    32   2.2  
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    32   2.2  
ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic ho...    32   2.3  
KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} simila...    32   2.5  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    32   2.5  
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    32   2.6  
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    32   2.6  
Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}...    32   2.6  
KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {O...    32   2.7  
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    30   2.7  
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    32   2.8  
ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {...    32   3.0  
NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72      32   3.0  
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    32   3.0  
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    30   3.1  
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    32   3.4  
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    31   4.0  
NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {O...    31   4.0  
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    31   4.1  
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    31   4.1  
KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar ...    31   4.2  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    31   4.3  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    31   4.4  
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    31   4.7  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    31   4.8  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    31   4.9  
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    31   4.9  
Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa] ...    31   4.9  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    31   5.0  
CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa] ...    31   5.4  
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            31   5.4  
Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]...    31   5.5  
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    31   5.8  
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    31   5.8  
Suva_10.560 Chr10 complement(974002..977079) [3078 bp, 1025 aa] ...    31   6.0  
Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON} (25908....    30   6.8  
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    30   6.9  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    29   7.2  
KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {O...    30   7.3  
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    30   8.2  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    30   8.4  
TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}...    30   8.6  
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    30   8.8  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    30   8.9  
TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.7...    30   9.1  
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    30   9.2  
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    30   9.4  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    30   9.5  
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    30   9.6  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    30   9.6  
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    30   9.7  
Ecym_3433 Chr3 (813903..815513) [1611 bp, 536 aa] {ON} similar t...    30   9.9  

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/327 (83%), Positives = 272/327 (83%)

Query: 1   MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR 60
           MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR
Sbjct: 1   MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR 60

Query: 61  SLSQLLTTGMAHTSDAGEPKVXXXXXXXXXXXXXXXGNRAMAAKDYETAIQKYTAAIEVL 120
           SLSQLLTTGMAHTSDAGEPKV               GNRAMAAKDYETAIQKYTAAIEVL
Sbjct: 61  SLSQLLTTGMAHTSDAGEPKVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVL 120

Query: 121 PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEA 180
           PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEA
Sbjct: 121 PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEA 180

Query: 181 YKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXXXXXXXXX 240
           YKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTE                   
Sbjct: 181 YKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSAAGSAGGSGLPDLAS 240

Query: 241 MFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAIKKMAENFAS 300
           MF                     NNPQVMQAAQKMMQNPSAIQEMMSNPAIKKMAENFAS
Sbjct: 241 MFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMMSNPAIKKMAENFAS 300

Query: 301 GNGSSGLGDLMADPAVRNMASKFFGPK 327
           GNGSSGLGDLMADPAVRNMASKFFGPK
Sbjct: 301 GNGSSGLGDLMADPAVRNMASKFFGPK 327

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  321 bits (823), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/338 (50%), Positives = 221/338 (65%), Gaps = 31/338 (9%)

Query: 1   MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR 60
           M  SNK+IAALIV FL+TS K V E+Y DSL VAIDCI EAFE+   +++ +VS+   GR
Sbjct: 1   MPGSNKEIAALIVQFLSTSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGR 60

Query: 61  SLSQLLTTG-----------MAHTSDAGEPKVXXXXXXXXXXXXXXXGNRAMAAKDYETA 109
            L  L+ +G             + +DA  P+V               GN+A AAKD+E A
Sbjct: 61  GLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLE-----GNKAFAAKDFEGA 115

Query: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
           ++KYT AIE++P +AV+Y NRAAAYSS +++E+AV DAE A +++ SYS+G+SRLG AKY
Sbjct: 116 VKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKY 175

Query: 170 ALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXX 229
           ALG+ EEA+EAYK+VLDIEGDNATEAM+RDYESAK+KVEES+N++   +  E        
Sbjct: 176 ALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLEALPKGEEQQTSEG-- 233

Query: 230 XXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNP 289
                                             NNPQVMQAAQKMMQNPSA+QEMM+NP
Sbjct: 234 -------------SSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAMQEMMNNP 280

Query: 290 AIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFGPK 327
           AIK+MA+NFASG G+  LGD+M DP +++MA KFFG K
Sbjct: 281 AIKQMAQNFASGGGTPNLGDMMKDPNIKDMAGKFFGQK 318

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 217/333 (65%), Gaps = 18/333 (5%)

Query: 1   MSPSNKDIAALIVDFLTTSAK--TVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           M+ SNK+IAALIVDFL+++ +   V EDY DSL VAIDCI+EAFE        +V     
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 59  GRSLSQLLTTGMAHTSDAGEP-KVXXXXXXXXXXXXXX----XGNRAMAAKDYETAIQKY 113
            R L +LL +         EP KV                   GN+AMA+KD+ETAI+KY
Sbjct: 61  NRKLDELLKSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETAIKKY 120

Query: 114 TAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGR 173
           T AIEVLP++AVYYANRAAAYSSL++YE++V+DAE A KV+ SYSKG+SRLG+AKYALG+
Sbjct: 121 TEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKYALGK 180

Query: 174 HEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXX 233
            EEALEAYK VLDIEGD AT+ M+RDYE+AKRKVE+S+N++++   T+            
Sbjct: 181 PEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVP-TQTDEQESSTDAGA 239

Query: 234 XXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAIKK 293
                  M                      NNPQVM AAQK+MQNP A+ EMM NPA+++
Sbjct: 240 GASGFPDM----------ASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDEMMKNPAVRQ 289

Query: 294 MAENFASGNGSSGLGDLMADPAVRNMASKFFGP 326
           MAENF+SG G+  LGDLM++PA+++MA   FGP
Sbjct: 290 MAENFSSGGGTPNLGDLMSNPAIKDMAKNLFGP 322

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  311 bits (797), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 217/330 (65%), Gaps = 7/330 (2%)

Query: 1   MSPSNKDIAALIVDFLTTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGR 60
           MS SNK+IAALIVDFL++S+ +V EDY DSL VAIDCITEAF+    E D+L+S    G+
Sbjct: 1   MSLSNKEIAALIVDFLSSSSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60

Query: 61  SLSQLLTTGMAHTSDAGEP-----KVXXXXXXXXXXXXXXXGNRAMAAKDYETAIQKYTA 115
            L +LL +  +    +GEP      V               GN+AMAAK ++ AI+KYTA
Sbjct: 61  KLPELLASAPSSGGVSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKYTA 120

Query: 116 AIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHE 175
           AIEV P++AVYY+NRAAAYSSL+QYE+AV+DAE+A +VD +YSKGFSRLG+AKYAL + E
Sbjct: 121 AIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPE 180

Query: 176 EALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXXXX 235
           EAL+AYK+VLDIEG+ AT+ M+RDYE+AK+KVE S+N+++++  T               
Sbjct: 181 EALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSS--TSASSEDVSDKSATEG 238

Query: 236 XXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAIKKMA 295
                                       NNPQVMQAA+KMMQNP  +Q+MMSNPA+K+MA
Sbjct: 239 PGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAMKQMA 298

Query: 296 ENFASGNGSSGLGDLMADPAVRNMASKFFG 325
             F+SG G   L  +M DP++R+MA   FG
Sbjct: 299 NQFSSGGGMPDLSQMMNDPSIRDMAKNMFG 328

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  298 bits (763), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 162/332 (48%), Positives = 211/332 (63%), Gaps = 21/332 (6%)

Query: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MSPSNKD+A LIVDFL  T   K V EDY DSL VAIDCITEAFE       T + +   
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 59  GRSLSQLLTTGMAHTSDAGEP-----KVXXXXXXXXXXXXXXXGNRAMAAKDYETAIQKY 113
           GRSL Q++      +S   E       V               GN+AMAAKD+E A+ KY
Sbjct: 61  GRSLKQVVEAASVGSSSPQESVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQAVLKY 120

Query: 114 TAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGR 173
           + AI+VLPT+AVYYANRAAA+SSL++YE+AV+DAE A KV+ SYSKG+SRLG+A+YALG+
Sbjct: 121 SEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGK 180

Query: 174 HEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXX 233
            EEAL+AYK+VLDIEG+ AT+AM+RDY++A +KV +S+N++++A                
Sbjct: 181 PEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAA------------- 227

Query: 234 XXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAIKK 293
                                         NNPQ+MQAAQ+MMQNP+A+QE+M+NPA+K+
Sbjct: 228 -TRDGAGSATGSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAMQEVMNNPAVKQ 286

Query: 294 MAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           MAE F SG G+  + DLM +PA+ +MA   FG
Sbjct: 287 MAEKFQSGGGTPSMADLMNNPALMDMAKNMFG 318

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  287 bits (734), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 212/329 (64%), Gaps = 25/329 (7%)

Query: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           M+PSNKDI++LIVD+L      K+V ED  DSL VAI+CITEAF +  G +    S   G
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSS----SAAFG 56

Query: 59  GRSLSQLLTTGMAHTSDAGEP-KVX----XXXXXXXXXXXXXXGNRAMAAKDYETAIQKY 113
           G++L++LL+ G    S  GE  KV                   GN+AMA KDYE AI+KY
Sbjct: 57  GKNLAELLSAGAGAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELAIKKY 116

Query: 114 TAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGR 173
           + AI V+PT+AVYYANRAAA+SSL+ Y++A++DAE A KVDSSYSKG+SRLGYAK+A G+
Sbjct: 117 SEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGK 176

Query: 174 HEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXX 233
            EEALEAYK+VLDIEGD+AT+ M+RDYE+AKRKVE+++ +++  E TE            
Sbjct: 177 SEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDE-TETSDRGTGEPAGA 235

Query: 234 XXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQE---MMSNPA 290
                  +                      NNPQVMQAAQ+MMQNP A+ +   MM NP 
Sbjct: 236 NPGGGFDL----------SSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPN 285

Query: 291 IKKMAENFASGNGSSGLGDLMADPAVRNM 319
           +++MAE FA GNG+  L D+M +PA+R+M
Sbjct: 286 VRQMAEKFAGGNGTPNLNDIMNNPALRDM 314

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  285 bits (728), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 216/336 (64%), Gaps = 19/336 (5%)

Query: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           M+P+ K++A+LI+D+L  T   K +GEDY DSL VAIDC+TEAFE+    A +++ +  G
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 59  GRSLSQLL-TTGMAHTSDAGEP-----KVXXXXXXXXXXXXXXXGNRAMAAKDYETAIQK 112
           G+SL Q++  +    T+   EP      V               GN+AMA KD+E AI K
Sbjct: 61  GQSLEQIVGASSKGPTATQQEPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHAISK 120

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           Y+ AI  LP++AVY+ANRAAAYSSL++Y +AVEDAE A KV+ SYSKG+SRLG+A+YALG
Sbjct: 121 YSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQYALG 180

Query: 173 RHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXX 232
           R EEAL+AYK+VLDIEG NAT+AM+RDY++A +KVE+S+N++R+A               
Sbjct: 181 RPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAAGGS 240

Query: 233 XXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAIK 292
                                           NPQVMQAAQ+MMQNP+A+QEMMSNPAIK
Sbjct: 241 ----------GFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQMMQNPNAMQEMMSNPAIK 290

Query: 293 KMAENFASGNGSSGLGDLMADPAVRNMASKFF-GPK 327
           +MA+ F SG G+  + DLM +PA+ +MA   F GPK
Sbjct: 291 QMADKFQSGGGTPSMADLMNNPALMDMAKNMFGGPK 326

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  284 bits (727), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 212/339 (62%), Gaps = 29/339 (8%)

Query: 1   MSPSNKDIAALIVDFLT--TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MSPSNK++A+LIVD+L+     K V E+  DSL VAIDCI E+FE+  G++  +     G
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAVF----G 56

Query: 59  GRSLSQLL-----TTGMAHTSDAGEPKVXX----XXXXXXXXXXXXXGNRAMAAKDYETA 109
           G+ L +LL     ++    T+ A   KV                   GN+AMA KD++ A
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
           I+KY+ AIEVLPT+AVYYANRAAA+SS++ YE+A++DAE A K D +YSKG+SRLGYAK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 170 ALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXX 229
           ALG+ E+ALEAYK+VLDIEGD A++ M+RDYE+AK+KVE+S+++++  E           
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPET---------- 226

Query: 230 XXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQE---MM 286
                                             NNPQ+MQAAQ+MMQNP A+ +   MM
Sbjct: 227 -QARGADAGAGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMM 285

Query: 287 SNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
            NP +++MAENFA GNG   +GDLM +PA+R+MA   FG
Sbjct: 286 QNPGVRQMAENFAQGNGMPNMGDLMNNPALRDMAGSLFG 324

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  274 bits (701), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 148/329 (44%), Positives = 207/329 (62%), Gaps = 20/329 (6%)

Query: 5   NKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGRSL 62
           +K++AA+I+ +L    + K VGEDY DS+ VAIDCI E+FE+  G+ D+++ +    + L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 63  SQLLTTGMAHTSDAGEPKVXX----XXXXXXXXXXXXXGNRAMAAKDYETAIQKYTAAIE 118
            + L         + + KV                   GN+AMA KD+E AI KY+ AIE
Sbjct: 62  EECLECMKGGAVKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIE 121

Query: 119 VLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178
           VLPT+A+YYANRAAA+SSL+QY++AV DAEKA ++D +YSKG+SRLG+AKYA  + EEAL
Sbjct: 122 VLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEAL 181

Query: 179 EAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXXXXXXX 238
           EAYK+V+D+EGD AT+ M+RDYE+AK+KVE+S+N+++    T                  
Sbjct: 182 EAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEK----TPDARGADSGAGAGAGAGG 237

Query: 239 XXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQE---MMSNPAIKKMA 295
              F                     NNPQ+MQAAQ+MM NP A+Q+   MM +P+I++MA
Sbjct: 238 AGGF-------DFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMA 290

Query: 296 ENFASGNGSSGLGDLMADPAVRNMASKFF 324
           E F SGNG+  + DLM++PA+RNMAS  F
Sbjct: 291 EQFTSGNGTPNMDDLMSNPALRNMASSMF 319

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  273 bits (697), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 213/340 (62%), Gaps = 33/340 (9%)

Query: 1   MSPSNKDIAALIVDFLTTS--AKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MS SNKDIA L+VDFL+T+   K V  D  DSL VAIDCITEAFE    +  + ++ K G
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 59  GRSLSQLL---TTGMAHTSDAGEPKVXXXXX--------XXXXXXXXXXGNRAMAAKDYE 107
           G+SL++LL   T     +S   + KV                       GN+AMAAKDY 
Sbjct: 61  GKSLTELLDAATNAKGRSSSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKDYN 120

Query: 108 TAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYA 167
            A++KY AAI+++PT AVYYANRAAAYSS ++Y++A++DAE A KV+ ++SKG+SRLG+A
Sbjct: 121 LAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLGFA 180

Query: 168 KYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXX 227
           K+A G+ +EALEAYK+ L+++GD AT+ M+RDYE+AK+KVE+S+N++++A  +       
Sbjct: 181 KFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSASASAS- 239

Query: 228 XXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQE--- 284
                                               NNPQ+MQAAQ+MM NP A+++   
Sbjct: 240 ---------------ASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMES 284

Query: 285 MMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFF 324
           MM NP+I++MAEN +SG+ S G+GD M +PA+R MAS  F
Sbjct: 285 MMQNPSIRQMAENLSSGS-SEGMGDFMNNPAIREMASNLF 323

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  268 bits (686), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 201/336 (59%), Gaps = 18/336 (5%)

Query: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           M+ SNK+IAALIVD+L      K V  D  DSL VA+DCI EAFE         V     
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 59  GRSLSQLLTTGMAH------TSDAGEPKVXXXXXXXXXXXXXXXGNRAMAAKDYETAIQK 112
           G  L+  L+    +        DA + +                GN+AMA KDYE+AI+K
Sbjct: 61  GNGLTSFLSGSATNDIQVNIADDAADEE-----QKATAEGLKLEGNKAMATKDYESAIKK 115

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           Y+ AIEVLPT+AVYYANRAAAYSSL++Y+ AV DAE A KV+ +YSKG+SRLG+AK+A G
Sbjct: 116 YSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQG 175

Query: 173 RHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXX 232
           + E+AL+AYK+VLDIEGD AT+ M+RDYE+AK+KVE+S+N+++                 
Sbjct: 176 KVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNADAGTG 235

Query: 233 XXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQE---MMSNP 289
                    F                      NPQ+MQAAQ+MMQNP+A+Q+   MM NP
Sbjct: 236 AAGMGGMGGFPDLSSMLGGGLGGGLGDLLK--NPQIMQAAQQMMQNPNAMQQMESMMQNP 293

Query: 290 AIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           A+++MAENFASG G+  L  +M +P +++MA   FG
Sbjct: 294 AVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFG 329

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  269 bits (687), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 206/340 (60%), Gaps = 26/340 (7%)

Query: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFEL-GPGEADTLVSEKC 57
           MS S ++IAALIV++ ++    K + ED  DSL VA+DCI+EAF       +  L   + 
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 58  GGRSLSQLLTTGMA-----HTSDAGEPKVX----XXXXXXXXXXXXXXGNRAMAAKDYET 108
            G+ L+ +L +           DA   ++                   GN+AMA KDYE 
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168
           AI KYT AI+VLPT+A+YYANRAAA+SSL++Y++AV+DAE A  +D SY +G+SRLG+AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 169 YALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXX 228
           YA G+ EEALEAYK+VLDIEGDNATEAM+RDYESAK+KVE+S+N+++   V E       
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT--VPEQSRDADV 238

Query: 229 XXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---IQEM 285
                                              NNPQ+MQAAQKMM NP A   IQ+M
Sbjct: 239 DASQG---------ASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKM 289

Query: 286 MSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           M +P+I++MAE FASG G+  L DLM +PA+RNMA   FG
Sbjct: 290 MQDPSIRQMAEGFASGGGTPNLSDLMNNPALRNMAGNLFG 329

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  268 bits (686), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 156/340 (45%), Positives = 208/340 (61%), Gaps = 26/340 (7%)

Query: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSE-KC 57
           M  S ++IAALIV++ ++    K + ED  DSL VA+DCI+EAF      A  ++ + + 
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 58  GGRSLSQLLTTGMAHT-----SDAGEPKVX----XXXXXXXXXXXXXXGNRAMAAKDYET 108
            G+SL+ +L +    +      DA   +V                   GN+AMA KDYE 
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168
           AI KYT AI+VLPT+A+YYANRAAA+SSL++Y++AV+DAE +  +D SY +G+SRLG+AK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 169 YALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXX 228
           YA G+ EEALEAYK+VLDIEGDNATEAM+RDYESAK+KVE+S+N+++   V E       
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEK--AVPEQSRDADA 238

Query: 229 XXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---IQEM 285
                                              NNPQ+MQAAQKMM NP A   IQ+M
Sbjct: 239 NASQG---------AGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKM 289

Query: 286 MSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           M +P+I++MAE F SG G+  L DLM +PA+RNMA   FG
Sbjct: 290 MQDPSIRQMAEGFTSGGGAPNLSDLMNNPALRNMAGNLFG 329

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  268 bits (685), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 157/345 (45%), Positives = 202/345 (58%), Gaps = 33/345 (9%)

Query: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MS SNKDIAALI+DFL+T      V ED  DSL VA+DCI EAFE        +V     
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 59  GRSLSQLL---------------TTGMAHTSDAGEPKVXXXXXXXXXXXXXXXGNRAMAA 103
           G SLS  L               T  +  T D  E                  GN+AMA 
Sbjct: 61  GNSLSSYLNGSTSASAATTTADETVKVNVTEDDTE-------ASEAAEALKLEGNKAMAG 113

Query: 104 KDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSR 163
           KDYE AI+KYT AI  LPT+AVY+ANRAAAYSSL++Y++AVEDA  A K++ +YSKG+SR
Sbjct: 114 KDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSR 173

Query: 164 LGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXX 223
           LG+AK+A G+ E+ALEAYK+VLDIEGD ATE M+RDYE+AK+KVE+S+N++++       
Sbjct: 174 LGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNAT 233

Query: 224 XXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA-- 281
                            M                      NNPQ+MQAAQ+MMQ+P A  
Sbjct: 234 AESDSASAADPFAGMGGM------PDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMK 287

Query: 282 -IQEMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
            ++ MM NP++K+MA+ F+SGNG+     LM DP++R+MA   FG
Sbjct: 288 QVESMMQNPSVKQMADQFSSGNGTPDFSALMNDPSIRDMAKNMFG 332

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  266 bits (680), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 160/343 (46%), Positives = 210/343 (61%), Gaps = 30/343 (8%)

Query: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAF----ELGPGEADTLVS 54
           MS S  +IA+LIV++ ++    K + ED  DSL VA+DCI+EAF    E  P     L +
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPS---ILEN 57

Query: 55  EKCGGRSLSQLL--TTGMAHTS---DAGEPKVX----XXXXXXXXXXXXXXGNRAMAAKD 105
            +  G++L+ LL  T+ ++ ++   DA   +V                   GN+AMA KD
Sbjct: 58  SEFKGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKD 117

Query: 106 YETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLG 165
           YE AI KYT AI+VLPT+A+YYANRAAA+SSL+ Y++AVEDAE A  +D +Y +G+SRLG
Sbjct: 118 YELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLG 177

Query: 166 YAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXX 225
           +AKYA G+ EEALEAYK+VLDIEGDNATEAM+RDYESAK+KVE+S+N+++   V E    
Sbjct: 178 FAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKT--VPEQSRD 235

Query: 226 XXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---I 282
                                                 NNPQ+MQAAQKMM NP A   I
Sbjct: 236 ADANADASQG-------AGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNI 288

Query: 283 QEMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           Q+MM +P IK+MAE F SG G+  L DLM +PA+R+MA   FG
Sbjct: 289 QKMMQDPNIKQMAEGFTSGGGAPNLSDLMNNPALRSMAGNLFG 331

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  263 bits (673), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 149/341 (43%), Positives = 213/341 (62%), Gaps = 23/341 (6%)

Query: 1   MSPSNKDIAALIVDFLTTSAKT--VGEDYEDSLKVAIDCITEAFELGPGEADTL---VSE 55
           MS SNK++ +LIVDFL+T  K   + ED  DSL VAIDCITE+FE    E DT+   + +
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEF---ERDTVAQTLQD 57

Query: 56  KCGGRSLSQLLTTGMAHTSDAGEPK-------VXXXXXXXXXXXXXXXGNRAMAAKDYET 108
           K  G++L ++L++  A ++ + + +       V               GN+AMAAKDY  
Sbjct: 58  KFSGKTLKEILSSASATSTGSEKEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRL 117

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168
           AI+KY+ AI+ LPT+ +YYANRAAAYSS+++Y+ A++DAEKA ++D +YSKG+SRL +AK
Sbjct: 118 AIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAK 177

Query: 169 YALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXX 228
           YAL + EEALE YK+VLD+EGD AT AM+RD+E AK +VE S+N+++++  T        
Sbjct: 178 YALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAG 237

Query: 229 XXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---IQEM 285
                                              NNPQVMQAAQ+MM +P++   +QEM
Sbjct: 238 QQPANPFAGSG---MPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEM 294

Query: 286 MSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFGP 326
           M NP +++MA+N ASG+    L DLM +P+V++MA+  FGP
Sbjct: 295 MQNPNLREMAQNLASGDA--NLDDLMNNPSVKDMANNLFGP 333

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  262 bits (669), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 200/337 (59%), Gaps = 24/337 (7%)

Query: 1   MSPSNKDIAALIVDFLT--TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           M  SNK+I+ LIVD+L   T    V ED +DSL VAIDCIT++FE        L+  K  
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 59  GRSLSQLLTTGMAHTSD----AGEPK---VXXXXXXXXXXXXXXXGNRAMAAKDYETAIQ 111
             SL +LL   M +++        PK                   GN+AMA KD++ AI 
Sbjct: 61  NLSLPELLEVAMENSAKENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIA 120

Query: 112 KYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYAL 171
           KY+ AI + P +A+YYANRAAAYSSL+ +EKA EDAE A +VD +YSKG+SRLG+AKYAL
Sbjct: 121 KYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLGFAKYAL 180

Query: 172 GRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXX 231
            + EEALEAYK+VLD+EGD ATE M+RDYE+AK++VE+S+N+++  E T           
Sbjct: 181 NKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEK-KESTPKEESVTESAA 239

Query: 232 XXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---IQEMMSN 288
                    M                      NNPQ+MQAAQ+MM +P+A   IQ MM N
Sbjct: 240 NAAAGGFPDM----------SSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQN 289

Query: 289 PAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           P+I++MAENF +GN +     LM DP +++MA  FFG
Sbjct: 290 PSIRQMAENFQNGN-TPDFSQLMNDPNIKDMAKNFFG 325

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  261 bits (666), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 151/340 (44%), Positives = 203/340 (59%), Gaps = 26/340 (7%)

Query: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKC- 57
           MS S ++IA+LIV++ ++    K V ED  DSL VA+DCI+EAF        +++ +   
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 58  -------GGRSLSQLLTTGMAHTSDAGEPKVXXXXXXXXXXXX--XXXGNRAMAAKDYET 108
                     S S+L  +G    +   E  +                 GN+AMA K+YE 
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYEL 120

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168
           AI+KYT AI+VLPT+A+YYANRAAA+SSL++Y++A++DAE A  VD SY +G+SRLG+AK
Sbjct: 121 AIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGFAK 180

Query: 169 YALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXX 228
           YA G+ EEALEAYK+VLDIEGDNAT+AM+RDYESAK++VE+S+N+++ A           
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTA----------- 229

Query: 229 XXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---IQEM 285
                                              NNPQ+MQAAQKMM NP A   IQ M
Sbjct: 230 PEQPRDAGANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNM 289

Query: 286 MSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFFG 325
           M +P+I++MAE F SG G+  L DLM +PA+RNMA   FG
Sbjct: 290 MQDPSIRQMAEGFTSGGGTPNLSDLMKNPALRNMAGSLFG 329

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  257 bits (657), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 146/341 (42%), Positives = 203/341 (59%), Gaps = 21/341 (6%)

Query: 1   MSPSNKDIAALIVDFLTT--SAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MS +NKDI ALIVDFL+T      V ED  DSL VA+DCI+EA E         +  K  
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 59  GRSLSQLLTTGMAHTSDAGEPK---------VXXXXXXXXXXXXXXXGNRAMAAKDYETA 109
           G++L  +L T    T++    K         V               GN+AMA KD+  A
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
           ++KYT AI++LPT+A+YYANRAAA+SSL+++E+A++DAE A K+D SYSKG+SRL +AKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 170 ALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXX 229
            LG+HEEALE+YK+VLDIEGDNAT  M+RDYE+AK++VEES+N++++   T         
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSK--TPEQGQGQQQ 238

Query: 230 XXXXXXXXXXXMFX---XXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQE-- 284
                       F                        +NP  M  AQK+M +P+A+Q+  
Sbjct: 239 TNESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQ 298

Query: 285 -MMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFF 324
            MMS+P+++ +A NF   NG++ + D+M +PA+RNMAS  F
Sbjct: 299 SMMSDPSMRDLANNFK--NGNTDMNDIMNNPAIRNMASNLF 337

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  249 bits (636), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 146/341 (42%), Positives = 200/341 (58%), Gaps = 35/341 (10%)

Query: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTL---VSE 55
           M+ SNK++++LI+D+L    S   V  D  DSL VAIDC+TE F +   E DTL   +  
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGV---EKDTLSATIES 57

Query: 56  KCGGRSLSQLLTTGMAHTSDAGEPKVXX---------XXXXXXXXXXXXXGNRAMAAKDY 106
           K  G+SL++LL     +  +  E K                         GN+A+A+KDY
Sbjct: 58  KFNGKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDY 117

Query: 107 ETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGY 166
           + A++KYT AI++LPT+AVY+ANRAAAY++ Q Y++AV+DAE+A K+D +YSKG+SRL Y
Sbjct: 118 DLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAY 177

Query: 167 AKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXX 226
           AKY     EE+LEAYK+VL+IEGD+ATE  +R YE+AK++VEES+N++++          
Sbjct: 178 AKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQT 237

Query: 227 XXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSA---IQ 283
                         M                      NNPQ+MQAAQ MM NP A   IQ
Sbjct: 238 NPAAGGGFPDFSSLM--------------SGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQ 283

Query: 284 EMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFF 324
            MM NPAI++MAE F  GN +    ++M +PAVRNMAS  F
Sbjct: 284 SMMQNPAIQQMAEQFKGGN-TPDFSEMMNNPAVRNMASSLF 323

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  191 bits (484), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 112/330 (33%), Positives = 176/330 (53%), Gaps = 21/330 (6%)

Query: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MS +NKD  ALIV++L      K V ED  +SL VAIDCI++ FEL P   + ++++   
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 59  GRSLSQLLTTGMA--HTSDAGEPKVXXXXXXXXXXXXXXX----GNRAMAAKDYETAIQK 112
              L  +   G+   + SD  E +V                   GN+ M+ K+Y++AI K
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDK 120

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           Y+ AIE+ P++  YY+NRAAAY  ++ +  AV DA  A K+D +YSK +SRLG AK A G
Sbjct: 121 YSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEG 180

Query: 173 RHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNA-EVTEXXXXXXXXXX 231
            +E+A+ A+K+VL++EGD +TE M+ DYE+AK+ V+  + +++N  + +           
Sbjct: 181 NNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLNTTDVL 240

Query: 232 XXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAI 291
                     F                      NP++MQ  + +MQ          NP +
Sbjct: 241 TDIATVLGSSFGSLMNNTQMMQRAQQMMQTQ--NPEMMQQVEGLMQ----------NPVV 288

Query: 292 KKMAENFASGNGSSGLGDLMADPAVRNMAS 321
           ++ AEN A+GNG  GL D++ +P+V+ +A+
Sbjct: 289 RQFAENVANGNGPGGLSDVLNNPSVKEVAN 318

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  134 bits (337), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 128/218 (58%), Gaps = 21/218 (9%)

Query: 1   MSPSNKDIAALIVDFLTTSAKT--VGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MS SNK+IA+ IV +L++  +T  V EDY +S+ VAI+CI ++F+L          E+  
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDL---------QEEVS 51

Query: 59  GRSLSQLLTTGMAHTSDAGEPKVXXXXXXXXXXXXXX---XGNRAMAAKDYETAIQKYTA 115
             S   L T  +A+ +   EPK+                  GN+A+  ++Y+ AI KYT 
Sbjct: 52  ADS--DLATVLLANLNLEPEPKLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTR 109

Query: 116 AIEVL-----PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYA 170
           AI++L     P D  Y +N++ A +   +YE+A +DA    K+D ++SKG+SRL  AK  
Sbjct: 110 AIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIG 169

Query: 171 LGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVE 208
             ++E+A+ AYK+VLD+EG+ AT+ M+RD+E  K+K E
Sbjct: 170 QNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKFE 207

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  129 bits (323), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 100/335 (29%), Positives = 153/335 (45%), Gaps = 24/335 (7%)

Query: 1   MSPSNKDIAALIVDFLT--TSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCG 58
           MS + +  A+LI+ +L+  T+   + ED ++SL+VAI CI E+F L      T + E+  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 59  GRSLSQLLTTGMA----HTSDAGEPKVXXXXXXXXXXXXXXXGNRAMAAKDYETAIQKYT 114
              L + L T  A    H  +A   K                GN AM    YE AI+KYT
Sbjct: 61  KTILQENLNTLEATQKIHNEEAEALK--------------KEGNEAMIEGQYEEAIKKYT 106

Query: 115 AAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRH 174
            AI+    +  YY+NR+ AYS L +YE AV DA  A  +D S+SK +SRLGYAK    + 
Sbjct: 107 EAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKL 165

Query: 175 EEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTEXXXXXXXXXXXXX 234
           E+ + AYKR +D+EG NA++ +  DYE A+ K E+ +  + ++E  +             
Sbjct: 166 EDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ-LKKNDDSEERKSIKEVTSEECPEK 224

Query: 235 XXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPSAIQEMMSNPAIKKM 294
                  F                     N  Q    +       S +  +M+NP +K+M
Sbjct: 225 NNNQDEGFTAVNHYAQNNDNKSKEETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQM 284

Query: 295 AENFASGN--GSSGLGDLMADPAVRNMASKFFGPK 327
                + N   S  + D++ +P +R   S+    K
Sbjct: 285 VFQAINDNPDASRQVKDVLNNPLLRTTLSELMNTK 319

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  107 bits (267), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 112/254 (44%), Gaps = 44/254 (17%)

Query: 4   SNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGRS 61
           ++KD+A LIV+FL    S K + +D  DSL VAIDCI + + L      + +  K     
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSD 66

Query: 62  LSQLL-----------TTGMAHTSDAGEPKVXXXXXXXXXXXXXXXGN------------ 98
           L+ +L           T+    T    EP                  N            
Sbjct: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126

Query: 99  -------------------RAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQ 139
                              R M ++DY+ AI+ YT AI   P D +YY+NR+ AY  +  
Sbjct: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 140 YEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRD 199
           YE A+ DA     +D+++SK + RL   K    ++ +AL+ YK+ +++  D+  E + R+
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246

Query: 200 YESAKRKVEESINM 213
           +E  K KV+  I++
Sbjct: 247 FEDLKLKVQTDISL 260

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 265 NPQVMQAAQKMMQN-PSA---IQEMMSNPAIKKMAENFASG 301
           NP + Q   K++QN P A   I  +++NPA+K + +NF +G
Sbjct: 300 NPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 94.0 bits (232), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 73/122 (59%), Gaps = 9/122 (7%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  M AK Y  AI  Y+ AI++ PT+  YY NRA AY     ++ A+ DA K+ ++DS 
Sbjct: 141 GNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIEIDSK 200

Query: 157 YS----KGFSRLGYAKYALGRHEEALEAYKRVLDI-----EGDNATEAMRRDYESAKRKV 207
                 K + RLG AKY +G +E +L A+KR+++I     +GD  T+ M  DYE AK KV
Sbjct: 201 IHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQENNKGDEITKQMDADYEKAKEKV 260

Query: 208 EE 209
           +E
Sbjct: 261 QE 262

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 33/47 (70%), Gaps = 4/47 (8%)

Query: 1  MSPSNKDIAALIVDFLT---TSAKTVGEDYEDSLKVAIDCITEAFEL 44
          M+ ++++IA++IVD+     TS K + +D  DSL VAIDCI + F++
Sbjct: 1  MNTTDQEIASIIVDYFNKCITSGK-LNQDNVDSLNVAIDCIADVFDV 46

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  +KD+  AI+ +T AIEV PT + V Y+NR+AAY+S +Q+++A+ DA +  K++ 
Sbjct: 12  GNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++SKG++RLG A++ LG  EEA + YK  L ++ +N
Sbjct: 72  TWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 52/98 (53%), Gaps = 5/98 (5%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ Y+  I+  P DA  Y+NRAAA S L  + +A++D + A K D ++ + + R 
Sbjct: 404 DWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRK 463

Query: 165 GYAKYALGRHEEALEAYKRVLDIE-----GDNATEAMR 197
             A+ A+  +  AL+  +     +     G N+ E MR
Sbjct: 464 ATAQIAIKEYANALDTLEEAKSKDSSVNNGANSNEIMR 501

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A  ++ AI++Y  A   L  D  Y  NR+AA      +E A+    E  ++  +
Sbjct: 262 GNKLYKAHKFDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRE 320

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+R+G A +  G  +++++ Y++ L
Sbjct: 321 LRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQKSL 356

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDYE AI  ++ AIEV  T + V+Y+NR+A Y+SL+++ +A+ DAE+  K++ 
Sbjct: 11  GNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINP 70

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++SKG++RLG A   LG  +EA  +YK+ L+++G N
Sbjct: 71  TWSKGYNRLGAAHLGLGDLDEAEGSYKKALELDGSN 106

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 2/90 (2%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAAA S L  + +A+ED  KA + D ++ + + R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 165 GYAKYALGRHEEALEAYK--RVLDIEGDNA 192
             A+ A+     A+E     R  D E +N+
Sbjct: 465 ATAQIAVKEFAAAIETLDAARTKDAEVNNS 494

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 10/131 (7%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAY-------SSLQQYEKAVEDAEK 149
           GN+A  A+ ++ AI  Y AA   L  D  Y  NR+AA        ++L+  ++AVE   +
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWN-LHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGRE 321

Query: 150 ATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE--GDNATEAMRRDYESAKRKV 207
                   +K F+R+G   +     ++A+E Y++ L      +  T+    + E  K++ 
Sbjct: 322 MRTDYKLIAKSFARMGNVHHKTNNLKKAIEFYQKSLTEHRTPEILTKLRNTEKELKKQEA 381

Query: 208 EESINMDRNAE 218
           EE IN ++  E
Sbjct: 382 EEYINPEKAEE 392

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 268 VMQAA-QKMMQNPSAIQEMMSNPAI-KKMAENFASGNGSSG 306
           VMQ+  Q+  QNP+A+QE M NP + KK+    A+G   +G
Sbjct: 542 VMQSILQQAQQNPAALQEHMKNPDVFKKIQTLIAAGIIRTG 582

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 76/114 (66%), Gaps = 6/114 (5%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLP-TDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A +AK+YE A+  ++ AIEV P  + V Y+NR+A Y+SL+++  A+ DA + TK++ 
Sbjct: 12  GNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT-----EAMRRDYESAK 204
           ++SKG++R+G A Y LG  +EA ++YK+ L+++  N       E ++R  E+ K
Sbjct: 72  TWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNKVAQEGLEQVKRTQEARK 125

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 47/89 (52%), Gaps = 4/89 (4%)

Query: 106 YETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLG 165
           +  A++ YT  I   P DA  Y+NRAAA S L  + +A+ D EKA + D ++ K + R  
Sbjct: 408 WPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKA 467

Query: 166 YAKYALGRHEEALEAYKRVLDIEGDNATE 194
            A+ A+  +  ALE     LDI     TE
Sbjct: 468 TAQIAIKEYSSALE----TLDIARSKDTE 492

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYE---KAVEDA-EKATK 152
           GN+   A  ++ AI+ Y  A E L  D  Y  N+AAA      YE   K +EDA EK  +
Sbjct: 265 GNKLYKAHKFDEAIEHYDKAWE-LHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRE 323

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+R+G A   L   ++A E + + L
Sbjct: 324 LRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNKSL 359

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AK+Y+ AI+K+T AIEV  T + V Y+NR+A Y+S +Q+ K +EDA +  K++ 
Sbjct: 12  GNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++SKG++R+G A + +G  +EA +AYK+ L+++  N
Sbjct: 72  TWSKGYNRVGAAHFGMGDLDEAEKAYKKALELDSSN 107

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 79/202 (39%), Gaps = 34/202 (16%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I   P+DA  Y+NRAAA S L  + +A+ D   A + D ++ + + R 
Sbjct: 404 DWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRK 463

Query: 165 GYAKYALGRHEEALEAYK--RVLDIEGDNATEAMRRD--YESAKRKVEESINMDRNAEVT 220
             A+ A+     A+E     R  D E +N   +   D  Y  A ++  +  N +   E T
Sbjct: 464 ATAQIAIKDFVPAIETLDAARTKDAELNNGANSREIDQLYLKANQQRFQPSNANETPEQT 523

Query: 221 EXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPS 280
                                                       +P +    Q+   NP+
Sbjct: 524 -----------------------------YERAMKDPEVAAIMQDPVMQSILQQAQTNPA 554

Query: 281 AIQEMMSNPAI-KKMAENFASG 301
           A+QE M NP I KK+    A+G
Sbjct: 555 ALQEHMKNPEIFKKIQTLIAAG 576

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 46/96 (47%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVED----AEKATK 152
           GN+   A  ++ AI+ Y  A E L  D  Y  NR+AA      Y+ A+E      EK  +
Sbjct: 262 GNKLYKAHKFDEAIEHYNKAWE-LHNDITYLNNRSAAEFEKGDYQTAIETLHEAVEKGRE 320

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+R+  +   L   + A+  Y++ L
Sbjct: 321 MRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 87.0 bits (214), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 68/96 (70%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVL-PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A AAKD+E AI+ +T AIEV    + V Y+NR+A Y+S +Q+ KA+EDA++   ++ 
Sbjct: 10  GNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINP 69

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++SKG++R+G A + LG  +EA + YK+ L+++  N
Sbjct: 70  AWSKGYNRVGAAHFGLGDLDEAEQGYKKALELDSAN 105

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A+ ++ AI+ Y+ A E L  D  Y  NRAAA     +YE A+    E  E+  +
Sbjct: 266 GNKFYKARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRE 324

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   SK F+R+G + + L   ++A+E Y++ L
Sbjct: 325 LRADYKVISKSFARIGNSYHKLNELKKAIEFYQKSL 360

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAAA S L  + +A++D   A   D ++ + + R 
Sbjct: 408 DWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRK 467

Query: 165 GYAKYAL 171
             A+ A+
Sbjct: 468 ATAQIAV 474

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 268 VMQAA-QKMMQNPSAIQEMMSNPAI-KKMAENFASG 301
           VMQ+  Q+  QNP+A+QE M NP + KK+    A+G
Sbjct: 545 VMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAG 580

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%), Gaps = 1/97 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDY+ AI  +T AIEV  T + V Y+NR+AAY+S +QYE+A+ DA++  K++ 
Sbjct: 12  GNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           S++KG++R G A   L ++EEA + Y   L I+ +NA
Sbjct: 72  SWAKGYTRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAAA + L  +  A+ D  KA + D S+ + + R 
Sbjct: 400 DWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRK 459

Query: 165 GYAKYALGRHEEALE 179
              + A+     A+E
Sbjct: 460 ATCQIAVKEFAGAIE 474

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 57/122 (46%), Gaps = 15/122 (12%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+A  A+ ++ AI  Y  A E    D  Y  NR+AA      YE  +    E  E A +
Sbjct: 258 GNKAYKARQFDEAISHYNQAWETF-KDITYLNNRSAAEYEKGDYETCIKTLTEAVENARE 316

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEE 209
           + + Y   +K F+R+G A   L   ++A+E Y++ L       TE    D  S  RK E+
Sbjct: 317 LRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSL-------TEHRTPDILSKLRKAEK 369

Query: 210 SI 211
            +
Sbjct: 370 DL 371

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDY  AI  +T AIEV  T + V Y+NR+A Y+S +++E+A++DAE+  K+  
Sbjct: 10  GNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISP 69

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S+SKG++R+G A++ L + +EA ++YKR L+++  N
Sbjct: 70  SWSKGYNRVGAAQFGLSQLDEAEKSYKRALELDSSN 105

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  ++  P DA  ++NRAAA + L  + +A+ED  KA  +D ++ + + R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 165 GYAKYALGRHEEALE 179
             A+ A+     A+E
Sbjct: 455 ATAQIAVKEFAAAIE 469

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVE---DA-EKATK 152
           GN+   A+ +E AI+ Y  A E L  D  Y  NR+AA      Y+ A++   DA E+  +
Sbjct: 253 GNKLYKARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRE 311

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+R+G A Y L    +A+E Y R L
Sbjct: 312 LRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 70/96 (72%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKD+E A + ++ AIE   T + V Y+NR+A Y+SL+++++A+EDAE+  K++ 
Sbjct: 10  GNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINP 69

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++SKG++R+G A+Y LG  ++A + YK+ L+I+  N
Sbjct: 70  TWSKGYNRVGAAQYGLGNLDDAEKEYKKALEIDSSN 105

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 5/95 (5%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+ +A+  YT  I+  P DA  Y+NRAA  + L  +  A++D + A   D ++ + + R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 165 GYAKYALGRHEEALEAYK--RVLDIE---GDNATE 194
             A+ A+     A+E     R  D+E   G NA E
Sbjct: 476 ASAQIAVREFAPAMETLDAARAKDLEINKGANARE 510

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A+ ++ AI+ Y  A + L  D  Y  NR+AA      YE+A+    E  ++  +
Sbjct: 274 GNKYYKARKFDEAIEHYNKAWD-LHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGRE 332

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   SK F+R+G A   +   ++A+E Y+R L
Sbjct: 333 MRADYKLISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDY+ AI+ +T AIEV  T + V Y+NR+A Y+SL+++  A+ DA +  K++ 
Sbjct: 12  GNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S+SKG++RLG A   LG  +EA   YK+ L+++  N
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESNYKKALELDASN 107

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 89/216 (41%), Gaps = 36/216 (16%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G       D+  A++ YT  I+  P DA  Y+NRAAA + L  + +A+ D  KA + D +
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYK--RVLDIEGDNATEAMRRD---YESAKRKVEESI 211
           + + + R   A+ A+  +  ALE     R  D E +N + A   D   Y++++++ +   
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQPGT 522

Query: 212 NMDRNAEVTEXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQA 271
           + +   E  +                                           +P +   
Sbjct: 523 SNETPEETYQ------------------------------RAMKDPEVAAIMQDPVMQSI 552

Query: 272 AQKMMQNPSAIQEMMSNPAI-KKMAENFASGNGSSG 306
            Q+  QNP+A+QE M NP + KK+    A+G   +G
Sbjct: 553 LQQAQQNPAALQEHMKNPEVFKKIQTLIAAGIIRTG 588

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV---EDA-EKATK 152
           GN+   A+ ++ AI+ Y  A E L  D  Y  NRAAA     +YE A+    DA E+  +
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQGRE 327

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   SK F+R+G A + LG  ++ +E Y++ L
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDY+ AI+ +T AIEV  T + V Y+NR+A Y+SL+++  A+ DA++   ++ 
Sbjct: 12  GNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S+SKG++RLG A   LG  +EA   YK+ L+++  N
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAENNYKKALELDASN 107

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAAA + L  + +A+ D  KA + D ++ + + R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 165 GYAKYALGRHEEALE 179
             A+ A+  +  ALE
Sbjct: 471 ATAQIAVQEYAAALE 485

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV---EDA-EKATK 152
           GN+   A+ ++ AI+ Y  A E L  D  Y  NRAAA     +Y+ A+    DA E+  +
Sbjct: 269 GNKFYKARQFDEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQGRE 327

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   S+ F+R+G A + LG  ++ +E Y++ L
Sbjct: 328 MRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 268 VMQAA-QKMMQNPSAIQEMMSNPAI-KKMAENFASG 301
           VMQ+  Q+  QNP+A+QE M NP + KK+    A+G
Sbjct: 548 VMQSILQQAQQNPAALQEHMKNPEVFKKIQTLIAAG 583

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A AAKD+E AI+ +  AIEV    + V Y+NR+A Y+S++++ +A+ DA++  ++  
Sbjct: 11  GNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKP 70

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
            +SKG +RLG A Y LG  +EA E+YK+ L+++  N
Sbjct: 71  DWSKGHNRLGAAHYGLGDLDEAEESYKKALELDSSN 106

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAAA + L  +  A++D + A + D ++ + + R 
Sbjct: 403 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRK 462

Query: 165 GYAKYALGRHEEALE 179
             A+ A+  +  A+E
Sbjct: 463 ATAQIAVQEYAAAIE 477

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATK---- 152
           GN     + ++ AI  Y  A + L  D  Y  NRAAA      YE A++  EKA +    
Sbjct: 261 GNELYKKRQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRE 319

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+RLG A Y L   ++A+E Y++ L
Sbjct: 320 LRADYKVIAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 68/96 (70%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVL-PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN+A A+KDY  AI+ +T AIEV    + V ++NR+A Y+S + + KA++DA +  K++ 
Sbjct: 10  GNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINP 69

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S++KG++RLG A Y LG  +EA ++YK+ L+++  N
Sbjct: 70  SWAKGYNRLGAAHYGLGDLDEAEQSYKKALELDSAN 105

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAAA S L  +  A+ D +KA + D ++ + + R 
Sbjct: 404 DWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRK 463

Query: 165 GYAKYALGRHEEALE 179
              + A+  +  A+E
Sbjct: 464 ATGQIAIKDYAGAIE 478

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKAT----K 152
           GN+    + ++ AI+KY  A E    D  Y  NRAAA      YE A+E   KA     +
Sbjct: 262 GNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRE 320

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   SK F+R+G + + LG  ++A++ Y++ L
Sbjct: 321 LRADYKVISKSFARMGNSYHKLGDLKKAIDYYEKSL 356

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDA-VYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AK+Y+ AI+ +T AIEV  T + V ++NR+A Y+SL+++  A+ DA +  K++ 
Sbjct: 12  GNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S+SKG++RLG A   LG  +EA   YK+ L+++ +N
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANN 107

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 90/216 (41%), Gaps = 36/216 (16%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G       D+  A++ YT  I+  P DA  Y+NRAAA + L  + +A+ D  KA + D +
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYK--RVLDIE---GDNATEAMRRDYESAKRKVEESI 211
           + + + R+  A+ A+     ALE     R  D E   G +A E  +  Y++++++ +   
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETLDVARTKDAEVNKGASAKEIDQLYYKASQQRFQP-- 520

Query: 212 NMDRNAEVTEXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQA 271
             D  +E  E                                           +P +   
Sbjct: 521 --DTGSETPE--------------------------ETYQRAMKDPEVAAIMQDPVMQSI 552

Query: 272 AQKMMQNPSAIQEMMSNPAI-KKMAENFASGNGSSG 306
            Q+  QNP+A+QE M NPA+ KK+    A+G   +G
Sbjct: 553 LQQAQQNPAALQEHMKNPAVFKKIQTLIAAGIIRTG 588

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 10/131 (7%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A  ++ AI+ Y  A E L  D  Y  NRAAA      YE  +    +  EK   
Sbjct: 269 GNKFYKAHQFDEAIEHYNRAWE-LHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRD 327

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEE 209
           + + Y   SK F+R+G A + LG  ++ +E Y++ L         A  R+ E  ++K E 
Sbjct: 328 MRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSLTEHRTADILAKLRNVEKEQKKAEA 387

Query: 210 S--INMDRNAE 218
              IN D+  E
Sbjct: 388 EAYINPDKAEE 398

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 118/233 (50%), Gaps = 55/233 (23%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A A+KD+  AI+ +T AI    T + V Y+NR+A Y+SL+Q+++A+ DA++  K++ 
Sbjct: 11  GNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINP 70

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN--ATEAMRRDYESAKRKVEESINM 213
            +SKG++R+G A   LG  ++A   YK+ L+++ +N  A+E + + +     +V+ES   
Sbjct: 71  DWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNNKAASEGLEQVH-----RVQESRKS 125

Query: 214 DRNAEVTEXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQ 273
             +  +TE                   MF                     ++P ++   +
Sbjct: 126 RPDFGMTE-------------------MF---------------------SDPNLI---E 142

Query: 274 KMMQNPSAIQEMMSNPAIKKMAENFASGNGSSGL-GDLMADPAVRNMASKFFG 325
           K+ QNP   ++MM++P++    +++ S     GL  DLM DP +  + +   G
Sbjct: 143 KLRQNPKT-KDMMNDPSLVAKLQSYKS--NPQGLSSDLMGDPRLMTIMATLLG 192

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G       D+  A++ YT  I+  P DA  Y+NRAAA + L  + +A++D EKA + D +
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 157 YSKGFSRLGYAKYALGRHEEALE 179
           + + + R   A+ A+    +ALE
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALE 479

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 10/131 (7%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   +  ++ AI +Y  A + L  D  Y  NR+AA      +E A+    E  E+  +
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRE 321

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVLDIE--GDNATEAMRRDYESAKRKV 207
           + + Y   +K F+R+G A       ++A+E Y++ L      D  T+    + E  K+++
Sbjct: 322 LRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQEI 381

Query: 208 EESINMDRNAE 218
           EE IN ++  E
Sbjct: 382 EEYINPEKAEE 392

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDY+ AI  ++ AI+V    + V Y+NR+A Y+SL+++  A++DAE+  K++ 
Sbjct: 12  GNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S+SKG++R+G A + +G  +EA   YK+ L+++  N
Sbjct: 72  SWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASN 107

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT  I+  P DA  Y+NRAA  S L  + +A++D  KA + D ++ + + R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 165 GYAKYALGRHEEALE 179
             A+ A+     ALE
Sbjct: 472 ATAQIAVREFSSALE 486

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A+ ++ A+ KY  A E    D  Y  NR+AA      YE ++    E  EK  +
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGRE 328

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+R+G     L   ++A++ YK+ L
Sbjct: 329 MRADYKVIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 268 VMQAA-QKMMQNPSAIQEMMSNPAI-KKMAENFASGNGSSG 306
           VMQ+  Q+  QNP+A+QE M NP I KK+    ASG   +G
Sbjct: 549 VMQSILQQAQQNPAALQEHMKNPEIFKKIQTLIASGIIRTG 589

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDYE A + +T AIE     + V Y+NR+A ++SL+++ +A+ DA +  K++ 
Sbjct: 10  GNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINP 69

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++SKG++R+G A + LG+ +EA + YK+ L+I+  N
Sbjct: 70  AWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTSN 105

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 46/89 (51%), Gaps = 2/89 (2%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+  A++ YT   +  P DA  Y+NRAAA + L  + +A++D + A   D ++ + + R 
Sbjct: 416 DWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRK 475

Query: 165 GYAKYALGRHEEALEAYK--RVLDIEGDN 191
             A+ A+     A+E     R  D E +N
Sbjct: 476 ATAQIAVREFASAIETLDAARAKDTELNN 504

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A+ ++ AI+ Y  A + L  D  Y  NR+AA      YE+A+    E  E+  +
Sbjct: 274 GNKFYKARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGRE 332

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   SK F+R+G A   L   ++A+E Y++ L
Sbjct: 333 MRADYKLISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 80.1 bits (196), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 69/96 (71%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A AAK Y+ A+  +T AIEV  T + V Y+NR+A+Y+S Q++ +A++DA + TK++ 
Sbjct: 12  GNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S++KG++R G A + +G  ++A  +YK+ L+++ +N
Sbjct: 72  SWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN 107

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+ +A++ YT  I+  P DA  Y+NRAAA S L  +  A+ D  KA + D ++ + + R 
Sbjct: 400 DWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRK 459

Query: 165 GYAKYALGRHEEALE 179
             A+ A+     A+E
Sbjct: 460 ATAQIAVKDFSYAIE 474

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+A  A++++ AI  Y  A E L  +  Y  NR+AA     +Y+ A+    E  EK  +
Sbjct: 258 GNKAYKARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGRE 316

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+R+G A   +G  +EA+  Y++ L
Sbjct: 317 MRADYKIIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAI-EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKD++ A++ +T AI E    + V Y+NR+ AY+SL+++++A+ DA +  K+ +
Sbjct: 11  GNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKA 70

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
            +SKG +RLG A + LG  +EA E+YK+ L+++  N
Sbjct: 71  DWSKGHNRLGAAHFGLGNLDEAEESYKKALELDATN 106

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 84/202 (41%), Gaps = 34/202 (16%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D+ +A++ Y+  I   P DA  Y+NRAAA S L  +  A++D +KA ++D S+ + + R 
Sbjct: 407 DWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRK 466

Query: 165 GYAKYALGRHEEALEAYK--RVLDIEGDNATEAMRRD--YESAKRKVEESINMDRNAEVT 220
             A+ A+  +  A+E     R  D E +N +     D  Y  A ++  +  N + + E T
Sbjct: 467 ATAQIAVQEYSAAIETLDVARTKDAEVNNGSSIREIDQLYVKATQQRFQPANTNESPEET 526

Query: 221 EXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAAQKMMQNPS 280
                                                       +P +     +  QNP+
Sbjct: 527 -----------------------------YARAVKDPEVASILQDPVMQSILAQAQQNPA 557

Query: 281 AIQEMMSNPAI-KKMAENFASG 301
           A+QE M NP + KKM    A+G
Sbjct: 558 ALQEHMKNPEVFKKMQTLIAAG 579

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+    + ++ AI KY  A   L  D  Y  NRAAA      Y  A+    E  E+  +
Sbjct: 265 GNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRE 323

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   +K F+RLG A Y L   ++A+E Y++ L
Sbjct: 324 LRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 62/96 (64%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDY  AI  +T AIEV    + V Y+NR+A Y+SL+++  A+ DA +  K++ 
Sbjct: 12  GNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINP 71

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           S+SKG++RLG A   LG  ++A   YK+ L+++  N
Sbjct: 72  SWSKGYNRLGAAHLGLGDLDDAESNYKKALELDAAN 107

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 86/216 (39%), Gaps = 36/216 (16%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G       D+  A++ YT  I+  P DA  Y+NRAAA + L  + +A+ D  KA + D +
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYK--RVLDIEGDNATEAMRRD---YESAKRKVEESI 211
           + + + R   A+ A+     ALE     R  D E +N   A   D   Y++++++ +   
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQQRFQSGT 519

Query: 212 NMDRNAEVTEXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQA 271
             D   E  +                                           +P +   
Sbjct: 520 GNDSPEETYQ------------------------------RAMKDPEVAAIMQDPVMQSI 549

Query: 272 AQKMMQNPSAIQEMMSNPAI-KKMAENFASGNGSSG 306
            Q+  QNP+A+QE M NP + KK+    ASG   +G
Sbjct: 550 LQQAQQNPAALQEHMKNPEVYKKIQTLIASGIIRTG 585

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV----EDAEKATK 152
           GN+   A+ +E AI+ Y  A E L  D  Y  NRAAA      YE A+    +  E+  +
Sbjct: 266 GNKFYKARQFEEAIEHYNKAWE-LHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGRE 324

Query: 153 VDSSY---SKGFSRLGYAKYALGRHEEALEAYKRVL 185
           + + Y   SK F+R+G A + LG  ++ ++ Y++ L
Sbjct: 325 MRADYKVISKSFARIGNAYHKLGDLKKTIDNYQKSL 360

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT-DAVYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN A  AKDYE A + +  AI+V    + V Y+NR+A Y+SL+++ + ++DAE+  K++ 
Sbjct: 11  GNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINP 70

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
            +SKG++R+G A++ L   E+A ++Y++ L+++  N
Sbjct: 71  GWSKGYNRVGAAQFGLNNLEDAEKSYQKALELDSAN 106

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 87/215 (40%), Gaps = 34/215 (15%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G    +  D+  A++ YT  I+  P DA  Y+NRAAA + L  + +A+ D ++A + D +
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYK--RVLDIEGDNATEAMRRD--YESAKRKVEESIN 212
           + + + R   A+ A+     A+E     R  D E +N   A   D  Y  A  +  +  +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREIDQLYIKANNQRFQPED 508

Query: 213 MDRNAEVTEXXXXXXXXXXXXXXXXXXXMFXXXXXXXXXXXXXXXXXXXXXNNPQVMQAA 272
           ++ N E T                                            +P +    
Sbjct: 509 VNENPEQT-----------------------------YQRAMKDPEVAAIMQDPVMQSIL 539

Query: 273 QKMMQNPSAIQEMMSNPAI-KKMAENFASGNGSSG 306
           Q+  QNP+A+QE M NP + +K+    A+G   +G
Sbjct: 540 QQAQQNPAALQEHMQNPDVFRKIQTLIAAGIIRTG 574

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVE------DAEKA 150
           GN+   A+ ++ AI+ Y  A E L  D  Y  NRAAA      YE A+       D  + 
Sbjct: 255 GNKFYKARKFDEAIEHYNKAWE-LHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGRE 313

Query: 151 TKVD-SSYSKGFSRLGYAKYALGRHEEALEAYKRVL 185
            + D    +K F+R+G A + LG  ++++  Y++ L
Sbjct: 314 MRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKSL 349

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN    AKD+E AI+ YT AI  L  D V+Y+NR+AAY S+  +EK VED   A K+   
Sbjct: 111 GNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK + R   A   LG+  +A+
Sbjct: 170 YSKCWLRRASAYENLGQFSDAM 191

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 50/75 (66%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+ +A+KDY  AI+ YT AIE+    +++++NRA A   L +++ A+ED+ KA ++DSS
Sbjct: 16  GNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSS 75

Query: 157 YSKGFSRLGYAKYAL 171
             KG+ R G A   L
Sbjct: 76  NVKGYHRRGMAYAGL 90

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 9/100 (9%)

Query: 117 IEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEE 176
           + ++P +A+ Y ++   + + + Y +A+E   KA ++D   S  FS    A   L R + 
Sbjct: 3   LTIVP-EALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQS 61

Query: 177 ALEAYKRVLDIEGDNATEAMRR--------DYESAKRKVE 208
           ALE   + ++++  N     RR        D+ SAKR +E
Sbjct: 62  ALEDSSKAIELDSSNVKGYHRRGMAYAGLQDFISAKRDLE 101

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 57/97 (58%), Gaps = 1/97 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDA-VYYANRAAAYSSLQQYEKAVEDAEKATKVDS 155
           GN+    K YE A+  +T+A+    T+  + Y+NRAAA+  L+ Y +A+ED +   ++  
Sbjct: 15  GNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAP 74

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           ++ KG+SR+G A   L + +EA E +K+ L +   N 
Sbjct: 75  NWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNV 111

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G +    ++Y  A++ YT  I+  PT  V + NRAA +  L    + ++D +KA  VD S
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 157 YSKGFSRLGYAKYALGRHEEALEAY 181
           Y K + R G+A+      +EALE +
Sbjct: 496 YIKAYVRKGFAQITERDLDEALETW 520

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 12/120 (10%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAY-------SSLQQYEKAVEDAEK 149
           GN     ++++ AI  YT A      D  Y  N  AA        + L+   +AV  AE 
Sbjct: 302 GNDLYKKRNFKEAIIHYTKAWNTF-QDITYLNNIGAAQFERGDYGNVLKSLGQAVFFAEH 360

Query: 150 ATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATE----AMRRDYESAKR 205
                   +K + R+G A + +  HE A+ AY+  L + G+   +    ++R ++E  K+
Sbjct: 361 TNPEPQVLAKSYIRMGNAYHRIWDHEHAITAYEYGLMLNGNEEHKKKLASLRVEFEKVKK 420

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 3/75 (4%)

Query: 98  NRAMAA---KDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVD 154
           NRA A    K Y  A++     +E+ P     Y+    AY  LQ+ ++A E+ +KA +++
Sbjct: 48  NRAAAHIGLKHYAEALEDGKNCVELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLN 107

Query: 155 SSYSKGFSRLGYAKY 169
                    L Y KY
Sbjct: 108 EQNVHAKKELAYVKY 122

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K Y+ AIQ Y+ AIEV   D V+Y+NR+A Y SL Q EK VED   A K+   
Sbjct: 102 GNEFFKNKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 160

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A  +LG   +A+
Sbjct: 161 YSKCLLRRASANESLGNFADAM 182

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 35/65 (53%)

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           +  A+++ P+ A  Y +R   Y   QQ+E+A +D EKA ++  S    + +L    Y  G
Sbjct: 362 FEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREG 421

Query: 173 RHEEA 177
           + +++
Sbjct: 422 KFDDS 426

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 67/129 (51%), Gaps = 11/129 (8%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  + AKDY  A++ YT AIE   T +++++NRA A   L +++ A+ED+ +A ++D+ 
Sbjct: 45  GNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAG 104

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLD--IEGDNATEAMRRDYESAKR-----KVEE 209
             K + R G A   L     A    KR L+  +      EA+RR  E  +R     + E 
Sbjct: 105 NVKAYHRRGLAHCGLLEWGPA----KRDLEVVVRAKPGDEAVRRALEVCERMLRRERFER 160

Query: 210 SINMDRNAE 218
           +I  D + E
Sbjct: 161 AIRADGDEE 169

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 124 AVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKR 183
           A+ Y N    +   + Y +AVE   +A + D + S  FS    A   L R + ALE   R
Sbjct: 38  ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSAR 97

Query: 184 VLDIEGDNATEAMRR--------DYESAKRKVE 208
            ++++  N     RR        ++  AKR +E
Sbjct: 98  AIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLE 130

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K +E A++ Y+ AIEV   D V+Y+NR+A Y SL Q EK VED   A K+   
Sbjct: 103 GNEFFKNKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD 161

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A  +LG+  +A+
Sbjct: 162 YSKCLLRRASANESLGKFADAM 183

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           +  A+E+ P  A  Y +R   +   QQ+E+A +D EKA +++ S    + +L    Y  G
Sbjct: 363 FEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREG 422

Query: 173 R 173
           +
Sbjct: 423 K 423

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 55/97 (56%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  + ++DY+ AI+ YT AIE+  T +++Y+NRA A+  L  ++ A+ D   A K+D++
Sbjct: 19  GNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNN 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
             K + R G A   L    +A      +L  + ++AT
Sbjct: 79  NIKAYHRRGLAYVGLLEFRKAKNDLTILLKYKPNDAT 115

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 34/75 (45%)

Query: 124 AVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKR 183
           A+ + +    Y   Q Y+KA+E   KA ++DS+ S  +S    A   L   + AL     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 184 VLDIEGDNATEAMRR 198
            + ++ +N     RR
Sbjct: 72  AIKLDNNNIKAYHRR 86

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K ++ AI+ Y  A+E L  D V+Y+NR+A Y S+ Q EK VED   A K+ S 
Sbjct: 109 GNEFFKEKKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSD 167

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A  +LG + +A+
Sbjct: 168 YSKCLLRRASANESLGNYADAM 189

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 20/120 (16%)

Query: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
            + +  A+E+ P  A  Y +R   Y   QQYE A +D +KA + + +    + +L    Y
Sbjct: 366 FENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAY 425

Query: 170 ALGRHE-----------------EALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESIN 212
              + E                 E    Y  +L  +GD A    ++ YE A RK+E++++
Sbjct: 426 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLAN--AKKQYEIA-RKLEDALD 482

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+ +  +D++ A + YT AIE  PT +++Y+NRA A   L  +  A+ D   A +++SS
Sbjct: 16  GNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSS 75

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVL 185
             K + R G A   L   + A   +  VL
Sbjct: 76  NLKAYHRRGLANIGLLNFKSARNDFNIVL 104

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+   AKDY  AI+ Y  A++ L  D ++Y+N +A Y SL Q +K +E + KA +++ +
Sbjct: 129 GNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPN 187

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A  +L  + +AL     VL + GD
Sbjct: 188 YSKALLRRASANESLENYSDALFDLS-VLSLNGD 220

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD+E AI+ YT A+  L  D VYY+N +A YSSL  YEK +E A KA  +   
Sbjct: 102 GNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPD 160

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A   LG   +A+
Sbjct: 161 YSKVLVRRANAYEKLGNFGDAM 182

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVD 154
           D +     Y  A+++   +A  Y +R   Y   QQYEKA ED +KA ++D
Sbjct: 355 DTDNYFANYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELD 404

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  ++Y  AI+ YT AIE+ P  +++Y+NRA A   L  ++ A  D  +A  +DS 
Sbjct: 19  GNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMR 197
             K + R G A   L   + A      VL  +  +AT A+R
Sbjct: 79  NVKAYHRRGLANVGLLEFKRARNDLNVVLKAKPSDAT-ALR 118

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 31/75 (41%)

Query: 124 AVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKR 183
           AV + N    +   Q Y KA+E   KA ++D + S  +S    A+  L   + A      
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNE 71

Query: 184 VLDIEGDNATEAMRR 198
            L ++  N     RR
Sbjct: 72  ALTLDSKNVKAYHRR 86

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 54/97 (55%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN A+  +DY  AI+ YT AI++  T ++Y++NRA  +  +  ++  + D +KA ++D  
Sbjct: 19  GNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
             K + R G +   L   + A +  K VL  + ++AT
Sbjct: 79  NIKAYHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT 115

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  +DY  AI+KY  AIE+  T +VY++NRA  +  L  ++ A +D +KA  +D  
Sbjct: 16  GNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPK 75

Query: 157 YSKGFSRLGYAKYALGRHEEA 177
             K + R G A   L   ++A
Sbjct: 76  NVKAYHRRGLACVGLLEFKKA 96

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%)

Query: 124 AVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKR 183
           A+ Y N   A   +Q Y KA+E  +KA ++D + S  FS        L   + A +   +
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 184 VLDIEGDNATEAMRR 198
            L ++  N     RR
Sbjct: 69  ALALDPKNVKAYHRR 83

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     + YE AI+ Y  A++ L  D V+Y+NR+A Y  L + EK VED   A K+   
Sbjct: 102 GNECFKDQRYEEAIKFYDCALK-LKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPD 160

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A  +LG + +A+
Sbjct: 161 YSKCLLRRATANESLGNYADAM 182

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%)

Query: 111 QKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
           Q +  A+E+ P  +  Y +RA     +QQ+++A +D +KA + D S    + +L    Y
Sbjct: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAY 418

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN    +K+++ AI+ Y  AIE+ P D V+Y+N +A Y S     K VE   KA ++   
Sbjct: 132 GNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPD 191

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           +SK   R   A  +LG   +A+     VL + GD
Sbjct: 192 HSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 224

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+   +KD E AI+ Y  A+  L  D V+Y+N +A Y ++ Q +K +E + KA ++   
Sbjct: 165 GNQYFKSKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPD 223

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A  ALG ++EAL
Sbjct: 224 YSKALLRRANAYEALGNNKEAL 245

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K YE AI+ Y+ A+  L  D V+Y+NR+A +  L + EK VED   A ++   
Sbjct: 105 GNECFKEKKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPD 163

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A  +LG   +A+
Sbjct: 164 YSKCLLRRATANESLGNFADAM 185

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 20/118 (16%)

Query: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
           +Q +  A+E+ P  +  Y +R   Y   QQ+EK+ +D +KA + +      + +L    Y
Sbjct: 362 LQYFDKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAY 421

Query: 170 ALGRHE-----------------EALEAYKRVLDIEGDNATEAMRRDYESAKRKVEES 210
              + E                 E    Y  +L  +GD   E+  ++YE A RK+E++
Sbjct: 422 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGD--LESALKEYEFA-RKLEDA 476

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN       +E AI+ Y  A++ L  D +YY+N +A Y+SL QYEK +E A KA K+  +
Sbjct: 117 GNELFKTSKFEDAIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPT 175

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           +SK   R   A  A+G   +A+
Sbjct: 176 FSKVLMRRALAYEAMGNFGDAM 197

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 110 IQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKY 169
           +Q +  A+E+ P +   Y +R  +Y   QQYEKA +D +K  ++D +    + +L    Y
Sbjct: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN    AK++  AI+ Y  AIE+ P + V+Y+N +A Y S    EK +E   KA ++   
Sbjct: 134 GNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPD 193

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           +SK   R   A  +LG   +A+     VL + GD
Sbjct: 194 HSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 226

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN    AK +  AI+ Y  AIE+ P D V+Y+N +A Y S    +K VE   KA ++   
Sbjct: 138 GNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPD 197

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           +SK   R   A  +LG   +A+     VL + GD
Sbjct: 198 HSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 230

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 53/97 (54%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  +D+  AI  YT AI +  T ++Y++NRA A+  L  ++ ++ D ++A K+D  
Sbjct: 19  GNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            +K + R G +   L   ++A    + VL  +  +AT
Sbjct: 79  NAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKPGDAT 115

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+ +  K Y  A++ YT AIE+  T +++++NRA A   L  ++  ++D   A ++D  
Sbjct: 20  GNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPK 79

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
             K + R G ++  L   ++A      VL  +  +AT
Sbjct: 80  NIKAYHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDAT 116

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%)

Query: 124 AVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKR 183
           A+   N    Y   ++Y KAVE   KA ++DS+ S  FS    A+  L   +  L+    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 184 VLDIEGDNATEAMRR 198
            L+++  N     RR
Sbjct: 73  ALELDPKNIKAYHRR 87

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 53/97 (54%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  ++Y  AI+ Y+ AIE+ PT +++++NRA A   L  ++  + D + A ++D  
Sbjct: 19  GNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
             K + R G +   L + ++A    + VL  +  +AT
Sbjct: 79  NIKAYHRRGLSHLGLLQCKKARNDLQVVLKAKPTDAT 115

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KDY+ A++ Y  A+ V+  D V+Y+N +A Y SL Q +K VE++ KA ++   
Sbjct: 108 GNEFFKKKDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPD 166

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A  +L  + +A+     VL + GD
Sbjct: 167 YSKALLRRASANESLENYADAMFDLS-VLSLNGD 199

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 1/94 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K++  AI+ Y  AIE+ P D V+Y+N +A Y S     K +E   KA ++   
Sbjct: 131 GNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPD 190

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           +SK   R   A  +LG   +A+     VL + GD
Sbjct: 191 HSKALLRRASANESLGNFTDAMFDLS-VLSLNGD 223

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (53%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K++  A + Y+ AIE+  T ++Y++NRA A+  L  ++ A+ D  KA ++D  
Sbjct: 19  GNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVL 185
             K + R G +   L    +A +  K VL
Sbjct: 79  NVKAYHRRGLSYIGLLEFNKARKDLKIVL 107

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K +  AI+KYT AI++  T ++Y++NRA A+  +  ++ A+ D ++A K+D  
Sbjct: 19  GNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPK 78

Query: 157 YSKGFSRLGYAKYAL 171
             K + R   +  AL
Sbjct: 79  NIKAYHRRALSCMAL 93

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     +D+E A++ Y  A+  L  D V+Y+N +A Y SL Q EK VE + +A K+   
Sbjct: 112 GNDYFKKQDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHD 170

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A  +L  + +A+     VL + GD
Sbjct: 171 YSKALLRRASAYESLANYVDAMVDLS-VLSLNGD 203

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%)

Query: 107 ETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           E +I+ + AAI +  T+A  Y +R   Y   QQYEKA  D +KA ++D S
Sbjct: 366 EESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDES 415

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KDYE A++ Y  A+ +L  D V+Y+N +A Y SL + +K +E + KA ++   
Sbjct: 115 GNEYFKEKDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPD 173

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   R   A   L  + +A+
Sbjct: 174 YSKALLRRATANEQLENYSDAM 195

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K +  AI+KYT AI++  T ++Y++NRA A+  +  ++ A+ D ++A K+D  
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 157 YSKGFSRLGYAKYAL 171
             K + R   +  AL
Sbjct: 79  NIKAYHRRALSCMAL 93

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 44/75 (58%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K +  AI+KYT AI++  T ++Y++NRA A+  +  ++ A+ D ++A K+D  
Sbjct: 19  GNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPK 78

Query: 157 YSKGFSRLGYAKYAL 171
             K + R   +  AL
Sbjct: 79  NIKAYHRRALSCMAL 93

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KDY+ A++ Y  A+  L  D V+Y+N +A Y S+ Q +K VE++ KA ++   
Sbjct: 113 GNEFFKQKDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPD 171

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A  +L  + +A+     VL + GD
Sbjct: 172 YSKALLRRASANESLENYPDAMFDLS-VLSLNGD 204

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K +  AI+KYT AI++  T  +Y++NRA ++  +  ++ A+ D ++A K+D  
Sbjct: 19  GNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
             K + R   +  AL   ++A    KR L++
Sbjct: 79  NIKAYHRRALSCMALLEFKKA----KRDLNV 105

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KDYE AI  Y  A++ L  D V+Y+N AA Y SL+  ++A+E   KA +++  
Sbjct: 93  GNAYFKVKDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPD 151

Query: 157 YSKGFSRLGYAKYALGRHEEAL 178
           YSK   +       +G+  +AL
Sbjct: 152 YSKVLLKRAAVYENIGKFADAL 173

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           +  AI++ P  A  Y +R      +Q+YEKA ED +KA + D +    + +L    Y  G
Sbjct: 354 FQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREG 413

Query: 173 RHEEA 177
             ++ 
Sbjct: 414 HFDDC 418

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 58/128 (45%), Gaps = 15/128 (11%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV----YYANRAAAYSSLQQYEKAVEDAEKATK 152
            N     K +  A + YT  I+V   D       +ANRAA    L+ Y   V D +KA +
Sbjct: 92  ANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAME 151

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT-----------EAMRRDYE 201
           ++    K F R+G A  ALG+ +EA +A    L I+ +N             E  R++Y+
Sbjct: 152 INPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENVPLKNLLAVIAKRETERKEYD 211

Query: 202 SAKRKVEE 209
             K K +E
Sbjct: 212 EKKLKEKE 219

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 50/94 (53%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+    K Y+ AI+ Y  A+E L  D V+Y+N +A Y S+   +K VE + KA ++   
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   LG+  +A+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGKFADAMFDL-SVLSLNGD 197

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 4/101 (3%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K Y  A + YT  I+V   D       YANRAA    L+ + K +ED +KA  
Sbjct: 81  GNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALS 140

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            +    K + R+G A  ++ R +E+ E+ +  L I+ +N +
Sbjct: 141 FNVKNIKCYYRMGKAFLSVDRFDESKESIEFGLKIDSENKS 181

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 5/104 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +   DY++AI+ Y+ AI +  T ++Y++NRA A+     +  AV D + A K+D  
Sbjct: 19  GNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVL-----DIEGDNATEA 195
             K + R G +   +    +A      VL     DI   NA + 
Sbjct: 79  NIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKPNDITASNALKV 122

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+    K Y+ AI+ Y  A+E L  D V+Y+N +A Y S+   +K VE + KA ++   
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPD 164

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   LG   +A+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  +D+  A + YT AIE+  T +++++NRA A+     ++ ++ D +KA ++DS 
Sbjct: 19  GNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVL-----DIEGDNATEAMRR 198
             K + R G +   L   ++A    K VL     D+  D A +   +
Sbjct: 79  NIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+    K Y+ AI+ Y  A+E L  D V+Y+N +A Y S+   +K VE + KA ++   
Sbjct: 106 GNQFFRNKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   LG   +A+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K Y  A++ Y+ AIE+  T +++++NRA +   L  +  A+ED  K+ ++D  
Sbjct: 19  GNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPK 78

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
             K   R G +   L    +A +  K +L ++
Sbjct: 79  NIKAIHRRGLSYVGLLEFSKARKDLKTILQVK 110

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%)

Query: 124 AVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKR 183
           A+ + N+  A+   ++Y +AVE   KA ++D + S  FS   +++  L     ALE   +
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 184 VLDIEGDNATEAMRR 198
            ++++  N     RR
Sbjct: 72  SIELDPKNIKAIHRR 86

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K +E AI+ Y  AI+ L  D V+++N +A Y SL   +K VE + +A ++   
Sbjct: 100 GNALFKEKRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPD 158

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   +GR+++A+     VL + GD
Sbjct: 159 YSKALLRRASAYENMGRYQDAMFDIS-VLSLNGD 191

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+    + YE A++ Y  A++ L  D V+Y+N +A Y SL   EK VE + KA ++   
Sbjct: 106 GNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPD 164

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   L    EA+     VL + GD
Sbjct: 165 YSKALLRRASANENLENFAEAMFDLS-VLSLNGD 197

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 53/117 (45%), Gaps = 20/117 (17%)

Query: 113 YTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALG 172
           +  A++V P  A  Y +R   +   QQYEKA  D EKA + DSS    + +L    Y  G
Sbjct: 366 FDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEG 425

Query: 173 RHE-----------------EALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESIN 212
           + +                 E    Y  VL  +GD   +A  + Y+ AKR +EES++
Sbjct: 426 KFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGD--FDAASKQYDIAKR-LEESLD 479

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+    K Y+ AI+ Y  A+E L  D V+Y+N +A Y S+   +K VE + KA ++   
Sbjct: 106 GNQYFRNKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPD 164

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   LG   +A+     VL + GD
Sbjct: 165 YSKVLLRRASANEGLGNFADAMFDL-SVLSLNGD 197

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN  +  K Y+ A++ Y+ AIE+  T ++Y++NRA +   L  +  A ED +KA  +D  
Sbjct: 17  GNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPK 76

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
             K   R G +   L    +A +  + VL ++
Sbjct: 77  NIKAIHRRGLSYVGLLEFFKARKDLRVVLQVK 108

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 52/100 (52%), Gaps = 4/100 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEV-LPTDAV---YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN    A+ Y+ A + Y   +EV    DA+    + NRAA    L+ + + + D ++A +
Sbjct: 87  GNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALR 146

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
            +    K F R+G A ++L + EEA EA +  L  + +NA
Sbjct: 147 YNPKNVKCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K  E AI+ Y  A+E    D V+YAN +A Y SL  +EK +E+  KA ++   
Sbjct: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171

Query: 157 YSKGFSR 163
           YSK   R
Sbjct: 172 YSKVLLR 178

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 13/124 (10%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEV----LPTDAVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K ++ A   Y  A++V    L  +   Y N AA    ++ Y   +    +A K
Sbjct: 77  GNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCINYCREALK 136

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN---------ATEAMRRDYESA 203
           +++   K F R+G A   LGR E++LEA +  L ++ +N         ATE ++R  E  
Sbjct: 137 LNAKNVKAFFRIGKAYLELGRFEDSLEAVQVGLAVDPENGALKSIQSKATEKLKRKKELE 196

Query: 204 KRKV 207
            R +
Sbjct: 197 NRTL 200

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 4/99 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDA----VYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K +  A   Y   IEV   DA    +   NRAA    L+ Y + + D  +A K
Sbjct: 84  GNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCREALK 143

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
           ++    K F R+G A   L + EEA EA    L ++ +N
Sbjct: 144 LNPKNPKAFFRIGKAFLQLDKLEEAAEAVDFGLRVDTEN 182

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 40/67 (59%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN+ +  K Y  A + YT AIE  P + + Y+NRA     L  ++ +++DA++A ++D++
Sbjct: 20  GNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNN 79

Query: 157 YSKGFSR 163
             K + R
Sbjct: 80  NLKAYHR 86

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 37/70 (52%)

Query: 121 PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEA 180
           P   V   NRAA +  L + ++A+ DA     VD+   KG+ R G     LGR+EEAL+ 
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQV 126

Query: 181 YKRVLDIEGD 190
           Y+  L   G+
Sbjct: 127 YENGLKQAGE 136

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN    A  +E AI+ Y  AIE L  + ++Y+N +A Y SL + E+ ++   KA ++   
Sbjct: 118 GNSLFKADKFEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPD 176

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
           YSK   R   A   L  + +A+     VL + GD
Sbjct: 177 YSKVLLRRANANEKLENYADAMFDLS-VLSLNGD 209

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K Y+ A   Y+  IEV   D       Y NRAA    L+ +   + D +KA  
Sbjct: 86  GNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCINDCKKALN 145

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEA 177
            ++   K F R+G A + L + EEA
Sbjct: 146 FNAKCVKAFYRMGQAYFKLKKLEEA 170

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV----YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN    AK ++ A + YT  I V   D       +ANRAA    L+ Y + +ED  KA  
Sbjct: 90  GNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALT 149

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEA 177
           ++    K + R   A ++L + EEA
Sbjct: 150 INPKNIKCYYRTSKAFFSLSKLEEA 174

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV----YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN    AK ++ A + YT  + V   D       +ANRAA    L+ Y K VED  KA  
Sbjct: 90  GNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALT 149

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEA 177
           ++    K + R+  + + L + EEA
Sbjct: 150 INPKNIKCYYRISKSFFQLRKLEEA 174

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV----YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN    AK ++ A + Y+  + V   D       YANRAA    L+ Y + +ED  KA  
Sbjct: 90  GNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCSKALT 149

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEA 177
           ++    K + R   A + L + EEA
Sbjct: 150 INPKNVKCYYRTSKAFFQLNKLEEA 174

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 4/101 (3%)

Query: 97  GNRAMAAKDYETAIQKYTAAIE----VLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K +  A + YT  IE    V   +   YANRAA    L+ +   + D + A  
Sbjct: 85  GNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALT 144

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            +    K + R+G A  A+ + E A E+ +    I+ DN +
Sbjct: 145 YNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKS 185

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVL----PTDAVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K +  A + Y+  I+V       +   YANRAA    ++ Y + + D ++A +
Sbjct: 88  GNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQ 147

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEA 180
           ++    K + R+  A  AL R +EALE+
Sbjct: 148 LNPKNIKCYYRIAKAFTALERLDEALES 175

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV----YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN    AK ++ A + Y   + V   D       +AN+AA    L+ Y + +ED  KA  
Sbjct: 90  GNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCSKALS 149

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEA 177
           ++   +K + R   A + L + EEA
Sbjct: 150 INPKNTKCYYRTSKAFFQLNKLEEA 174

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEV-LPTDAV---YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K +  A   Y   IE+    D +    +ANRAA    L+ Y   + D + A  
Sbjct: 87  GNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCKHALT 146

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEA 180
           ++    K + R+G A Y L   EEA E+
Sbjct: 147 LNPKNIKCYYRMGKAFYLLNNIEEAKES 174

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 6/97 (6%)

Query: 121 PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEA 180
           P   +   NRAA++  +    KA+ DA++  KVD+   KG+ R G     + + +EAL  
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 181 YKRVLDIEG-DNATEAMRRDYESAKRKVEESINMDRN 216
           Y+     EG   A EA +  +E    K  E +   +N
Sbjct: 127 YR-----EGLSKAKEAYQLHFEKPPSKFVEIVEHQKN 158

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 4/99 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV----YYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN    AK ++ A + Y   IE+   D       YANRAA    ++ Y + + D + A +
Sbjct: 85  GNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQ 144

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
            +    K + R+G A  AL   EEA ++ +  L ++  N
Sbjct: 145 YNPKNLKCYYRMGKAFLALELLEEAQKSVEFGLQVDSSN 183

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 8/118 (6%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKA-TKVDS 155
           GNR      Y+ A + Y   +++ P + + Y+N+A A   L +Y + VE   K  T   +
Sbjct: 10  GNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPN 69

Query: 156 SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINM 213
           +    + +L Y      R E AL+  K V D E  N    +  +     R  EE IN+
Sbjct: 70  TTDTVYKKLNY------RLEMALKNMKHVNDQEQSNE-HLINIEINEVDRLPEEFINL 120

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKV 153
           GN      DYETA+  Y  AI   P++ + Y+N A     L+++ +AV+   K  K+
Sbjct: 11  GNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 5/102 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAV-----YYANRAAAYSSLQQYEKAVEDAEKAT 151
           GN    AK ++ A   Y   I++     V      +AN+AA    L+ + + + D + A 
Sbjct: 83  GNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDCKNAL 142

Query: 152 KVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           +++    K + R+  A +AL + EEA E+ +  L  + +N +
Sbjct: 143 QLNPKNVKCYFRMTRAFFALDKLEEAKESVEFGLKFDPENTS 184

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 4/101 (3%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           GN     K +  A + Y  AI+V   D       YANRAA    L+ Y + + D + A  
Sbjct: 81  GNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALS 140

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           ++    K + R+  A  A+ + ++  EA +  L  + +N +
Sbjct: 141 LNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKS 181

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN      +Y+ AI++Y   I + PT+AV Y+N A AY       +  ++A+ A ++  S
Sbjct: 42  GNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLK----NRCPDEAKTACEMGLS 97

Query: 157 YSK 159
           Y K
Sbjct: 98  YCK 100

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD+E AI+ +  A +V P  A  Y  +   +SS   ++ A     KA   D  
Sbjct: 542 GNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQ 601

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +   +  LG +   LG+++EAL  +++   I   N 
Sbjct: 602 HYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINV 637

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M    Y+ A+  +  A  + P + +       A   LQ  EKA+   E A ++  S
Sbjct: 610 GMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQEKALSYYELACELQPS 669

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +  +  Y++GR+  AL+ ++ +  +  D AT
Sbjct: 670 SSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEAT 706

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKA 150
           GN      DYETAI  Y  A  +  ++ +Y++N A A   L+++++AV   +K 
Sbjct: 48  GNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKG 101

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 41/87 (47%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI  +  AI++ P  A  Y  +   YS+   ++ A     KA  ++ +
Sbjct: 499 GNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKT 558

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKR 183
           +      LG     LG+ EEAL  +++
Sbjct: 559 HYNALYGLGMCCVKLGKFEEALLFFEK 585

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D  T I+ Y + +   P       + A  Y S   ++KAV   EKA  +DS+ ++ +S L
Sbjct: 50  DTTTLIRAYHSVLAHDPLSVTALVSLANFYRSTDAFDKAVHYYEKAVALDSTLAEVWSLL 109

Query: 165 GYAKYALGRHEEALEAYKRVL 185
           G++   L   ++A  AY++ L
Sbjct: 110 GHSYLMLDELQKAYNAYQQAL 130

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A + +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 293 GRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPY 352

Query: 157 YSKGFSRLGYAKYALGRHE--EALEAYKRVLDIEGDNATEAMRRD 199
            S+ +  LG   Y    ++  +AL+AYK+   +E DN     R D
Sbjct: 353 ISEVWYDLG-TLYETCNNQLTDALDAYKQAARLEPDNTHIRERLD 396

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 4/101 (3%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152
            N    AK ++ A + Y   IE+   D       +AN AA    ++ + + +   +KA +
Sbjct: 85  ANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKALQ 144

Query: 153 VDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            +    K + R+  A Y L + +EA E+ K  L I+ +N +
Sbjct: 145 FNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKS 185

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 121 PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEA 180
           P     Y N +A Y  LQ+ +KA E + +   ++    KG+ R+G      G+  EA + 
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 181 YKR 183
           YK+
Sbjct: 128 YKK 130

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI+ +  A ++ P  A  Y  +   +SS    + A     KA   DS 
Sbjct: 558 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQ 617

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           +   +  LG +   LG++EEAL  +++   I   N  
Sbjct: 618 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 654

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  +M    YE A+  +  A  + P + V       +   L   EKA++  E A  +  +
Sbjct: 626 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 685

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    ++G   Y++ R+  AL+ ++ ++ +  D+AT
Sbjct: 686 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 722

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 102 AAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGF 161
           A  D++  I+ +  ++++ P D V +    A+ ++  + E A++   +A  +  S+ +  
Sbjct: 443 AEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKPSFVRAR 502

Query: 162 SRLGYAKYALGRHEEALEAYKRVL---DIEGDNATEAMRRDYESAKRKVEESINMDR 215
             L  A   +G ++EA E    VL    +EG N  E      E  KR +   + MDR
Sbjct: 503 YNLAVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVETDNNVLEILKRVL---MGMDR 556

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 110 IQKYTAAIEVLP-TDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168
           I+K+    E LP  DA     R   Y +   ++K +E  +++ K++ +    ++RLG + 
Sbjct: 416 IKKFNRLAESLPEHDAKLELIRGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASL 475

Query: 169 YALGRHEEALEAYKRVLDIE 188
               + E+A++AY R L+++
Sbjct: 476 ANSNKPEDAIQAYHRALNLK 495

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  AM    YE A+  +  A  + P + V       +   L   EKA++  E A  +  +
Sbjct: 615 GTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 674

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    ++G   Y++ R+  AL+ ++ ++ +  D+AT
Sbjct: 675 SSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDAT 711

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI+ +  A ++ P  A  Y  +   +SS    + A     KA   D  
Sbjct: 547 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 606

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           +   +  LG +   LG++EEAL  +++   I   N  
Sbjct: 607 HYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVV 643

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 44/96 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD+E +I+ +  + ++ P+    Y  +   YSS   ++ A+    KA   +S 
Sbjct: 417 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALASNSQ 476

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +   +  LG     LG++EE L  +++   I   N 
Sbjct: 477 HYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNV 512

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 44/97 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  ++    YE  +  +  A  + P + +       A   L   E+A+++ + A ++   
Sbjct: 485 GMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQERALQNYDLACELQPM 544

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +      A+G++  ALE++++++ I  D AT
Sbjct: 545 SSLALFKRAQLLLAMGKYNYALESFEKLVKIAPDEAT 581

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     K++  AI+ +  A +V P  A  Y  +   Y+S   ++ A     KA   D  
Sbjct: 535 GNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPG 594

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           +   +  LG     LG++EEAL  +++   I   N  
Sbjct: 595 HYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVV 631

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  +M    YE A+  +  A  + P + V       A   L   EKA++  E A ++  S
Sbjct: 603 GMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALEKLSYQEKALQYYELACELQPS 662

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +  +  Y++GR+  AL+ ++ +  +  D AT
Sbjct: 663 SSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEAT 699

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 129 NRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           NRAA +  +   +KA++DA +AT+ +    K + R G     L    +ALE Y+     E
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKLRMDGQALENYE-----E 130

Query: 189 GDNATEAMRRDYE-SAKRKVEESINMDRN 216
           G  A   M R Y     +K+ E++   +N
Sbjct: 131 GVKAIRDMTRKYHLDPPKKLYEALEYQKN 159

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%)

Query: 103 AKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFS 162
            ++YE A++ Y  A ++ P  A+    +A    SL +Y  AVE  E   K+DS       
Sbjct: 609 VRNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLHY 668

Query: 163 RLGYAKYALGRHEEALEAYKRVLDIE 188
            LG     +GR ++A++ Y   ++++
Sbjct: 669 MLGKIYQTMGRKKDAVKEYTVAMNLD 694

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI+ +  A E+ P  A  Y  +   Y+S + ++ A     KA   DS 
Sbjct: 501 GNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQ 560

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKR 183
           +   +  LG      G H+ +L  +++
Sbjct: 561 HYNAYYGLGTCDSQNGNHDRSLLFFEK 587

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 101 MAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKG 160
           +  K+Y + I     A+   P +   Y   A A+S++++Y+++ E  E   KVDS  S  
Sbjct: 123 LEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIEFGLKVDSRNS-- 180

Query: 161 FSRLGYAKYALGRHEEALEAYKRVLDIE 188
            S L   K  + + EE   AY+  L+ E
Sbjct: 181 -SLLNLLKTIIKKQEEK-TAYRLKLERE 206

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI+ +  A ++ P  A  Y  +   +SS    + A     KA   D  
Sbjct: 552 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 611

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           +   +  LG +   LG++EEAL  +++   I   N  
Sbjct: 612 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 648

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 45/97 (46%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  +M    YE A+  +  A  + P + V       +   L   EKA++  E A  +  +
Sbjct: 608 GTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPT 667

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    ++G   Y++ R+  AL+ ++ ++ +  D+AT
Sbjct: 668 SSLSKYKMGQLLYSMTRYSVALQTFEELVKLVPDDAT 704

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 43/97 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI+ +  A ++ P  A  Y  +   +SS    + A     KA   D  
Sbjct: 540 GNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQ 599

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           +   +  LG +   LG++EEAL  +++   I   N  
Sbjct: 600 HYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVV 636

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 35.4 bits (80), Expect = 0.19,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 33/54 (61%)

Query: 134 YSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           Y  LQQ  +++E  + A ++DSS  + +  LG A  A GR E +++ ++R L++
Sbjct: 670 YLELQQEAESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALEL 723

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 61/127 (48%), Gaps = 15/127 (11%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           DY+  +  + AA+ V P D + +    A+ ++  + E+A++   KA ++  ++ +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 165 GYAKYALGRHEEALEAYKRVL---DIEG---------DNATEAMRRDYESAKRK-VEESI 211
             +   +G ++EA E     L   ++EG         +N  E ++R +   +R+ + E +
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMHEVEGILPSETPASNNLIETLKRAFIGMERRDLLEMV 560

Query: 212 --NMDRN 216
             NMD N
Sbjct: 561 RPNMDLN 567

>KLLA0A05258g Chr1 (466776..468674) [1899 bp, 632 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 632

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 104 KDYETA-IQKYTAAIEVL-PTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGF 161
           K Y+ A + +Y A +++  P      AN    +SS QQ+EK++    +A  +D SY+  +
Sbjct: 384 KPYKLAYLAQYAANVDIYRPETCCIIAN---YFSSKQQHEKSILYFRRALMLDKSYTHAW 440

Query: 162 SRLGYAKYALGRHEEALEAYKRVLDI 187
             +G+    +     A+E Y+R  D+
Sbjct: 441 ILMGHEFIEMKNSHAAIECYRRASDV 466

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATK-VDS 155
           GN      +Y  A++ Y   IEV P + + Y+N A +   L +Y +A+E      K V+ 
Sbjct: 10  GNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKYVND 69

Query: 156 SYSKGFSRLGYAKYALGRHE 175
           + S+ + +L Y +Y L   E
Sbjct: 70  ADSQVYKKLQY-RYNLADTE 88

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 47/97 (48%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  +M   +YE A+  +  A  + P++A+           L   EKA+   E A ++  +
Sbjct: 665 GMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPT 724

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +  +  Y++ ++ +AL+A++ ++ I  + AT
Sbjct: 725 SSLAKFKRAHLLYSMAKYTQALDAFEELIKIAPEEAT 761

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAE----KATK 152
           GN+     +Y +AI+ Y   IE+ P + + Y+N+A A     + ++AV   +    + +K
Sbjct: 10  GNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLKRVSK 69

Query: 153 VDSSYSKGFSRLGY 166
            D+++     +L Y
Sbjct: 70  NDATHETIQKKLEY 83

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/123 (19%), Positives = 54/123 (43%), Gaps = 13/123 (10%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G    A +++   I  +  A+EV P D + +    A+ ++  + E+A++   KA  +  S
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLD-------------IEGDNATEAMRRDYESA 203
           + +    L  +   +G ++EA E+    L              ++ +N  E ++R + + 
Sbjct: 483 FVRARYNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKRSFVAM 542

Query: 204 KRK 206
            R+
Sbjct: 543 DRR 545

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     +D++ AI+ +  A EV P  A  Y  +   +SS    + A     KA   D  
Sbjct: 516 GNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYRKAIASDPQ 575

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +   +  LG     LG++EEAL  +++   I   N 
Sbjct: 576 HYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNV 611

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M    YE A+  +  A  + P + +       A   +   EKA++  E A+++  S
Sbjct: 584 GMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQEKALQYYELASELQPS 643

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +  +  Y + R+  ALE ++ + ++  D AT
Sbjct: 644 SSLAKFKKAHLLYVMARYSVALENFEELAELAPDEAT 680

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD++ AI+ +  A ++ P     Y  +   YSS   ++ A     KA   +S 
Sbjct: 421 GNMFSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQ 480

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +      LG     LG++EE+L  +++   I   N 
Sbjct: 481 HYNASYGLGMCCLKLGQYEESLLHFQKAHSINPVNV 516

>TBLA0F03220 Chr6 complement(782214..783824) [1611 bp, 536 aa] {ON}
           Anc_3.395 YPR088C
          Length = 536

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 265 NPQVMQAAQ-KMMQNPSAIQEMMSNPAIKKMAENFASGNGSSGLGD---LMADPAVRNMA 320
           +PQ+MQ AQ ++ QNP  ++ MM+            S  G   + D   +M DP ++ MA
Sbjct: 472 SPQMMQQAQQRLRQNPGMMENMMNMFGGAGGMPGMGSAGGMPNMNDMMKMMQDPKMQEMA 531

Query: 321 SKF 323
            +F
Sbjct: 532 RQF 534

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D++  ++ +  A+++ P D + +    A+ ++  + E+A++   KA  +  S+ +    L
Sbjct: 456 DFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYNL 515

Query: 165 GYAKYALGRHEEA---LEAYKRVLDIEGDNATEAMRRD---YESAKRKVEESINMDRN 216
             A   +G ++EA   L    ++  + G + T +++ D    E+ KR +   I MDRN
Sbjct: 516 AVASMNIGCYQEAAGHLLTVLKMHQVHGQDNT-SVKTDTAVLETLKRVL---IAMDRN 569

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           G  + +A DY TA Q +  ++  LP      A+  +N       L +Y KA+ED+  A K
Sbjct: 311 GTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLSNMIICRLKLGEYRKAIEDSSVALK 370

Query: 153 V 153
           +
Sbjct: 371 L 371

>NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.665
           YKL022C
          Length = 760

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK-YAL-GRHE 175
           E  P  A+ + + A  Y +++   KA +   KA+ +D S+S  +  LG+A  Y L G H+
Sbjct: 463 EKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILDPSFSAAW--LGFAHTYGLEGEHD 520

Query: 176 EALEAY 181
           +AL AY
Sbjct: 521 QALSAY 526

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 56/119 (47%), Gaps = 14/119 (11%)

Query: 102 AAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGF 161
           A +DY+  I  + AA+ V P D + +    A+ ++  + E+A++   +A ++  S+ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 162 SRLGYAKYALGRHEEALEAYKRVL---DIEG-----------DNATEAMRRDYESAKRK 206
             L  +   +G ++EA E     L   ++EG            N  E ++R + + +R+
Sbjct: 494 YNLAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERR 552

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 32.7 bits (73), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKV 153
           GN   +  +YETA+  Y  A    P++ V+ AN + A   L+++E A+   ++A ++
Sbjct: 15  GNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALEI 71

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 129 NRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           NRAA +  + + EKA+ DA K   ++    K F R G     L + ++A   YK  L   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALR-N 157

Query: 189 GDNATEAMR 197
            + AT++++
Sbjct: 158 ANFATDSLK 166

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/120 (20%), Positives = 54/120 (45%), Gaps = 3/120 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A   +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 157 YSKGFSRLGYAKYALGRH-EEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDR 215
            S+ +  LG           +AL+AYK+   ++ +N    +R   E+  +++E   NM++
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNMNK 422

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A   Y A ++  P+ A    + A  Y S   +++A E  E+A  V+   S  ++ L
Sbjct: 63  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 122

Query: 165 GYAKYALGRHEEALEAYKRVL 185
           G+    L   + A  AY++ L
Sbjct: 123 GHCYLMLDDLQRAYNAYQQAL 143

>KAFR0E02240 Chr5 complement(451940..453811) [1872 bp, 623 aa] {ON}
           Anc_5.72 YHR166C
          Length = 623

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           A  YSS Q++EK++    +A  +D   +  ++ +G+    L     A+E Y+R +DI+
Sbjct: 400 ANYYSSRQEHEKSIMYFRRALTLDKKSTGAWTLMGHEFVELKNSNAAIECYRRAIDID 457

>CAGL0I02288g Chr9 complement(203605..205524) [1920 bp, 639 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166c CDC23
          Length = 639

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G+  +  K+   AI+ Y  A+++ P D   +     AY  L  +  ++   ++A  +   
Sbjct: 451 GHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQRACILKPL 510

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
             + +  LG     +G H EA++ Y+R L +
Sbjct: 511 DKRMWQALGSCYAKVGNHAEAIKCYERALQL 541

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 33/58 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           A  YS+ Q++EK++    +A  +D   +  ++ +G+    L     A+E+Y+R +DI+
Sbjct: 417 ANYYSARQEHEKSIMYFRRALTLDKKTTSAWTLMGHEFVELKNSNAAIESYRRAVDID 474

>Skud_8.230 Chr8 complement(408573..410453) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  +D   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 404 ANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDI 460

>KNAG0L02010 Chr12 (357972..360080) [2109 bp, 702 aa] {ON} Anc_5.689
           YOR080W
          Length = 702

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 129 NRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           N  A Y  L Q  KA+  A+K  + D    K + R G     LG    A   YKR L   
Sbjct: 71  NLCACYEKLDQCPKALRIADKMIQRDQFNMKCYIRRGKLLQKLGDDLAAYHNYKRAL--- 127

Query: 189 GDNATEAMRR-DYESAKRKV 207
            + +TE  R+ D +S +R +
Sbjct: 128 -NKSTECSRKYDIDSPQRYI 146

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 54/122 (44%), Gaps = 3/122 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A   +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 312 GRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 371

Query: 157 YSKGFSRLGYAKYALGRH-EEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDR 215
            S+ +  LG       +   +AL+AYK+   ++ DN    +R   ES  ++++   N  +
Sbjct: 372 ISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPDNV--HIRERLESLAQQLQNPNNAQQ 429

Query: 216 NA 217
            A
Sbjct: 430 QA 431

>Suva_15.366 Chr15 complement(643222..645102) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  +D   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 404 ANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDI 460

>Smik_8.250 Chr8 complement(414141..416021) [1881 bp, 626 aa] {ON}
           YHR166C (REAL)
          Length = 626

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  +D   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 404 ANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDI 460

>YHR166C Chr8 complement(437170..439050) [1881 bp, 626 aa] {ON}
           CDC23Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 626

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  +D   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 404 ANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDI 460

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D +TA+     ++EV  TDA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 359 DPQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSI 418

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 419 GVLYYQISQYRDALDAYTRAIRL 441

>NDAI0C03350 Chr3 complement(769764..771713) [1950 bp, 649 aa] {ON}
           Anc_5.72
          Length = 649

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++ S +  ++ +G+    L     A+E Y+R +DI
Sbjct: 427 ANYYSARQEHEKSIMYFRRALTLNKSCTSAWTLMGHEFVELKNSHAAIECYRRAVDI 483

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 43/94 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G+  +  K+   AI+ Y  A+++ P D   +     AY  L+ +  ++   +KA  +   
Sbjct: 461 GHEFVELKNSHAAIECYRRAVDINPKDFKAWYGLGQAYEVLEMHLYSLFYFQKACSLQPL 520

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGD 190
             + +  LG     +G   +AL+ ++R L   G+
Sbjct: 521 DRRMWQALGTCYIKIGYKSDALKCFERALQHSGN 554

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 42/96 (43%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     KD+E +I+ +  + ++ P+    Y  +   YSS   ++ A+    KA   +  
Sbjct: 416 GNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRKALGSNPQ 475

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +      LG     LG++EE L  +++   I   N 
Sbjct: 476 HYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNV 511

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 41/97 (42%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   +    YE  +  +  A  + P + +       A   L   EKA++  + A ++   
Sbjct: 484 GMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQEKALQYYDLACELQPV 543

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +      A+G++  ALE +++++ I  D AT
Sbjct: 544 SSLALFKRAQLLLAMGKYNFALENFEKLVTIAPDEAT 580

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 22/111 (19%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPT----DAVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           G+      DY +A+Q+Y  ++  LP       + Y+N  A    + +Y K++ED + A  
Sbjct: 421 GSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALS 480

Query: 153 V---------------DSSYSKGFSRLGYAKYALGRHE--EALEAYKRVLD 186
           +               DS+  + F  + ++K  + + E  E LE YK  LD
Sbjct: 481 LFPKGKVTSAWNQIIPDSTPQRSFKDI-WSKLIMRQAESYEHLENYKLALD 530

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D +TA+     ++EV  TDA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 289 DPQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSI 348

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 349 GVLYYQISQYRDALDAYTRAIRL 371

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 40/83 (48%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A+   + ++EV P+DA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 285 DPQKALSFLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRL 367

>TDEL0B05300 Chr2 (932958..934151) [1194 bp, 397 aa] {ON} Anc_1.456
           YJR032W
          Length = 397

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 53/126 (42%), Gaps = 22/126 (17%)

Query: 97  GNRAMAAKDYETAIQKYTAAI----EVLPTDAV--------------YYANRAAAYSSLQ 138
           G      KD++ A+ KY  ++    E +P + V               Y N + A  ++Q
Sbjct: 248 GTLIFKKKDFKNAVFKYIKSLRYVNEYVPDEDVDKDNNLKFVTLKMKLYLNLSLALFNMQ 307

Query: 139 QYEKAVEDA----EKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATE 194
            Y+ A+E A    E     D   +K + R G +  A    E+AL+ Y+       D+A+ 
Sbjct: 308 NYDGAIEYATYLLEMENVPDVDQAKAYYRRGNSYLAKKNMEKALQNYELCKHKNPDDASV 367

Query: 195 AMRRDY 200
           A R DY
Sbjct: 368 AQRIDY 373

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%)

Query: 101 MAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKG 160
           M    Y+ A+  +  A  + P + +       A   L   EKA++  E+A ++  S S  
Sbjct: 561 MKLGQYDKALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYEQACELQPSSSLA 620

Query: 161 FSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
             +  +  Y++ R+  ALE ++ +  +  D AT
Sbjct: 621 KFKKAHLLYSMARYSAALENFEELAKLAPDEAT 653

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%)

Query: 117 IEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEE 176
           +E LP     +      YS  + +E A++  EKATK+D +++  ++  G+   +    + 
Sbjct: 475 VETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDSIDT 534

Query: 177 ALEAYKRVL 185
           A   Y+R L
Sbjct: 535 AKNCYRRAL 543

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D +TA+     ++EV  TDA  + +    +     Y  A +  + A   DS     +  +
Sbjct: 293 DTQTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSI 352

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRL 375

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 44/97 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  +M   ++E A+  +  A  + P++ +       A+  L   EKA+   E A +V  S
Sbjct: 640 GMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYELACQVQPS 699

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
            S    +  +  Y++  +  ALE ++ +  +  + AT
Sbjct: 700 SSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEAT 736

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 3/98 (3%)

Query: 107 ETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGY 166
           E A+  Y  A +V P+ ++    RA    S+  Y  A+E  E+ TK+    +     LG 
Sbjct: 684 EKALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLAPEEATVHFILGQ 743

Query: 167 AKYALGRHEEALEAYKRV--LDIEGDNAT-EAMRRDYE 201
               +GR ++A++ Y     LD +G+    EA+ + +E
Sbjct: 744 LYNIMGRKKDAVKEYTIAMNLDPKGNQVILEALEKCHE 781

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A+     ++EV P+DA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 296 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSI 355

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 356 GVLYYQISQYRDALDAYTRAIRL 378

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A   Y A ++  P+      + A  Y S   +++A E  E+A +V+   S  ++ L
Sbjct: 80  DADRAALAYDATLQYNPSSTKALTSLAHLYRSRDMFQRAAELYERALQVNPELSDVWATL 139

Query: 165 GYAKYALGRHEEALEAYKRVL 185
           G+    L   + A  AY++ L
Sbjct: 140 GHCYLMLDDLQRAYNAYQQAL 160

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 58/125 (46%), Gaps = 15/125 (12%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           DY+  +  + AA+ V P D + +    A+ ++  + E+A++   KA ++  ++ +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 165 GYAKYALGRHEEALEAYKRVL---DIEG---------DNATEAMRRDYESAKRK--VEE- 209
             +   +G  +EA E     L   ++EG          N  E ++R +   +R+  +EE 
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKRAFIGMERRDLLEEV 553

Query: 210 SINMD 214
             NMD
Sbjct: 554 RPNMD 558

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 107 ETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYS-KGFSRLG 165
           + A + ++  + +  T+A+ ++N +AAY +  + ++A     +AT+ DS  + + +    
Sbjct: 663 QLAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRATRTDSQKNWRIWENYM 722

Query: 166 YAKYALGRHEEALEAYKRVLDIEGDNATE 194
              + L   +E L + K+++DI  D A E
Sbjct: 723 IVAFKLREWDEVLLSCKKLIDINKDRAGE 751

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 59/131 (45%), Gaps = 18/131 (13%)

Query: 102 AAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGF 161
           A +D++  I  + AA+ V P D   +    A+ ++  + E+A++   +A ++  ++ +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 162 SRLGYAKYALGRHEEALEAYKRVL---DIEG------------DNATEAMRRDYESAKRK 206
             L  +   +G + EA E     L   ++EG             N  E ++R + +  R+
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEGVAMAPGSGNVPSSNILETLKRAFIAMDRR 548

Query: 207 --VEESI-NMD 214
             +E  + NMD
Sbjct: 549 DLLERVVPNMD 559

>TBLA0B07970 Chr2 (1887119..1889182) [2064 bp, 687 aa] {ON} Anc_5.72
           YHR166C
          Length = 687

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 41/91 (45%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G+  +  K+   AI+ Y  A+++ P D   +     AY  L  +  ++   +KA  +   
Sbjct: 494 GHEFVELKNSHAAIECYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 553

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
             + +  LG   + +   + AL+ YKR L +
Sbjct: 554 DKRMWQALGECYFIVDNTDSALKCYKRALQL 584

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 460 ANFYSTRQEHEKSIMYFRRALTLNKKNTSAWTLMGHEFVELKNSHAAIECYRRAVDI 516

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 140 YEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           ++K ++  E A KV+ +    ++RLG +     R EEA++AY R L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK-YAL-GRHE 175
           E  P  +V +      Y S+    +A +   KA+ +D ++  G++ LG+A  YA+ G HE
Sbjct: 426 ESFPKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHE 483

Query: 176 EALEAY 181
           +AL AY
Sbjct: 484 QALSAY 489

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 129 NRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAY 181
           NRAA++  L + +KA++DA+   +V+    K + R G     L + +EA   Y
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIRCGKILQKLNKDKEAYSNY 128

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 28/60 (46%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN       Y  A+  Y   I   P + V Y+N+A A   L +Y +A++  ++  +  S+
Sbjct: 11  GNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTST 70

>TDEL0A05450 Chr1 complement(956982..957314) [333 bp, 110 aa] {ON} 
          Length = 110

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 117 IEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKV 153
           I+  P DA +Y N AA+  S+Q + K  ED EK  K+
Sbjct: 35  IQPFP-DAYHYINEAASTRSVQLFFKGPEDVEKIKKI 70

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 140 YEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           ++K ++  E A KV+ +    ++RLG +     R EEA++AY R L ++
Sbjct: 474 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 522

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 38/73 (52%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D++  I  + +A++V P D + +    A+ ++  + E+A++   +A ++  S+ +    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 165 GYAKYALGRHEEA 177
             +   +G  +EA
Sbjct: 533 AVSSMNIGCFKEA 545

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 60/140 (42%), Gaps = 29/140 (20%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTD----AVYYANRAAAYSSLQQYEKAVEDAEKATK 152
           G     A DY +A Q+Y  ++  LP +     V Y+N  AA   + +Y++ + D E A +
Sbjct: 280 GTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALE 339

Query: 153 V-------------DSSYSKGFSRLGYAKYALGRHE--EALEAYKRVLD-----IEGDNA 192
           +             DS   + F  + + K    R E  E +E Y+R L      IE +N 
Sbjct: 340 MFPKDPNLWDEPIQDSQPIRTFKEM-WPKIVTRRAEAFEHIENYERALQDYQSLIEKNNF 398

Query: 193 TEAMRRDYESAKRKVEESIN 212
            + +       KR+ ++ +N
Sbjct: 399 NDKIM----GGKRRCQKVLN 414

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 139 QYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           Q++K ++  + A  V+S+    ++RLG +     R EEA++AY R L ++
Sbjct: 441 QFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLK 490

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK-YAL-GRHE 175
           E  P  +V +      Y S+    +A +   KA+ +D ++  G++ LG+A  YA+ G HE
Sbjct: 416 ESFPKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNF--GYAWLGFAHTYAVEGEHE 473

Query: 176 EALEAY 181
           +AL AY
Sbjct: 474 QALSAY 479

>ABR206W Chr2 (787387..789231) [1845 bp, 614 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR166C (CDC23)
          Length = 614

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  +S+ QQ+EKA+    +A  ++ + +  ++ +G+    +     A+E Y+R +DI
Sbjct: 391 ANYFSAKQQHEKAIMYFRRALTLNKTCTNAWTLMGHEFVEMKNSHAAIECYRRAVDI 447

>KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKA---VEDAEKATKVDSSYSKGF 161
           D   A + +  A ++ PTD +        Y   Q Y KA   ++ A  A K   S SK +
Sbjct: 515 DLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAW 574

Query: 162 ----SRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAK-RKVEESIN 212
                 LG+    LG  E A++ +K VL+     AT      +   + +K+E++I+
Sbjct: 575 ISIVINLGHTYRKLGEDERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAID 630

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 140 YEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           ++K ++  E A KV+ +    ++RLG +     R EEA++AY R L ++
Sbjct: 473 FDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 39/73 (53%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D++  I  + +A++V P D + +    A+ ++  + E+A++   +A ++  S+ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 165 GYAKYALGRHEEA 177
             +   +G ++EA
Sbjct: 532 AVSSMNIGCYKEA 544

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 54/120 (45%), Gaps = 3/120 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A   +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 297 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 356

Query: 157 YSKGFSRLGYAKYALGRH-EEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDR 215
            S+ +  LG           +AL+AYK+   ++ +N    +R   E+  +++E   N+++
Sbjct: 357 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNINK 414

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A   Y A ++  P+ A    + A  Y S   +++A E  E+A  V+   S  ++ L
Sbjct: 55  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 114

Query: 165 GYAKYALGRHEEALEAYKRVL 185
           G+    L   + A  AY++ L
Sbjct: 115 GHCYLMLDDLQRAYNAYQQAL 135

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A+     ++EV P+DA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 257 DPQKALNFLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 316

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 317 GVLYYQISQYRDALDAYTRAIRL 339

>Ecym_5092 Chr5 complement(208478..210358) [1881 bp, 626 aa] {ON}
           similar to Ashbya gossypii ABR206W
          Length = 626

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  +S+ QQ+EKA+    +A  ++ S +  ++ +G+          A+E Y+R +DI
Sbjct: 403 ANYFSAKQQHEKAIMYFRRALTLNKSCTNAWTLMGHEFVETKNSHAAIECYRRAVDI 459

>KLTH0A00638g Chr1 complement(63363..67598) [4236 bp, 1411 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1411

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVD--SSYSKGFSRLGY 166
           +I+ + +A+ V P D   +     AY S  + E +V+  EKA +V   ++Y+  F  L  
Sbjct: 700 SIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHYFKALSL 759

Query: 167 AKYALGRHEEALEAYKRV 184
           +K  +G ++E++E ++ +
Sbjct: 760 SK--MGLYDESIEIFREL 775

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAV 144
           GNR     DY  A + Y   I   PT+ + Y+N+A +    + +++A+
Sbjct: 10  GNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAI 57

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A+     ++EV P D+  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 287 DPQKALNYLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSI 346

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 347 GVLYYQISQYRDALDAYTRAIRL 369

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 50/112 (44%), Gaps = 3/112 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A   +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 157 YSKGFSRLGYAKYALGRH-EEALEAYKRVLDIEGDNATEAMRRDYESAKRKV 207
            S+ +  LG           +AL+AYK+   ++ +N    +R+  ES  +++
Sbjct: 373 ISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENV--HIRKRLESLTQQL 422

>ZYRO0C11594g Chr3 complement(907459..909345) [1887 bp, 628 aa] {ON}
           similar to uniprot|P16522 Saccharomyces cerevisiae
           YHR166C CDC23 Subunit of the anaphase-promoting
           complex/cyclosome (APC/C) which is a ubiquitin-protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 628

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++ + +  ++ +G+    L     A+E Y+R +DI
Sbjct: 405 ANYYSARQEHEKSIMYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIECYRRAVDI 461

>NCAS0D01390 Chr4 (251721..253616) [1896 bp, 631 aa] {ON} Anc_5.72
          Length = 631

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 409 ANYYSARQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDI 465

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  +M    Y+ A+  +  A ++ P +AV       A   L+  +KA+E  E A  +  +
Sbjct: 626 GIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEYYELACTLQPN 685

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRV 184
            +    +     YA+GR+  AL++++ +
Sbjct: 686 SNLARFKRANLLYAMGRYNLALQSFEEL 713

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN      DY  A   Y   I++ PT+ + Y+N+A +      +  AVE  ++  K  SS
Sbjct: 10  GNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLKYTSS 69

Query: 157 YSK 159
            +K
Sbjct: 70  STK 72

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A+     ++EV P+DA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 285 DPQKALNYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 344

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 345 GVLYYQISQYRDALDAYTRAIRL 367

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 33/57 (57%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++ + +  ++ +G+    L     A+E+Y+R +DI
Sbjct: 405 ANYYSAKQEHEKSIMYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIESYRRAVDI 461

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 46/104 (44%), Gaps = 2/104 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G+  +  K+   AI+ Y  A+++ P D   +     AY  L  +  ++   +KA  +   
Sbjct: 439 GHEFVELKNSHAAIESYRRAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACALKPL 498

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLD--IEGDNATEAMRR 198
             + +  L      L + +E+++ Y+R L   I  D+ T  + R
Sbjct: 499 DKRMWQALASCYEKLSKKDESIKCYERALQLSISSDHDTAILYR 542

>NCAS0C04490 Chr3 complement(919665..922421) [2757 bp, 918 aa] {ON}
           Anc_3.32 YNL313C
          Length = 918

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  A+     E A + ++  + + PT A+ ++N +AAY  L + ++A    +++   DS 
Sbjct: 651 GCVALECNKMEVAAEAFSRCVSLDPTHAMAWSNLSAAYVELNKLKEAFSCLKRSIACDSQ 710

Query: 157 YS-KGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATE 194
            + + +         L   ++ L A K++++I  + + E
Sbjct: 711 RNWRIWENYMLVSAKLNEWDDVLIACKQLVNIRRNKSGE 749

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 37/81 (45%)

Query: 107 ETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGY 166
           +TA+     ++EV  TDA  + +    +     Y  A +  + A   DS     +  +G 
Sbjct: 299 QTALNLLLKSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGV 358

Query: 167 AKYALGRHEEALEAYKRVLDI 187
             Y + ++ +AL+AY R + +
Sbjct: 359 LYYQISQYRDALDAYTRAIRL 379

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 54/120 (45%), Gaps = 3/120 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A   +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 157 YSKGFSRLGYAKYALGRH-EEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDR 215
            S+ +  LG           +AL+AYK+   ++ +N    +R   E+  +++E   N+++
Sbjct: 363 ISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNV--HIRERLEALTKQLENPGNINK 420

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A   Y A ++  P+ A    + A  Y S   +++A E  E+A  V+   S  ++ L
Sbjct: 61  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 120

Query: 165 GYAKYALGRHEEALEAYKRVL 185
           G+    L   + A  AY++ L
Sbjct: 121 GHCYLMLDDLQRAYNAYQQAL 141

>KLTH0H00704g Chr8 (70712..72577) [1866 bp, 621 aa] {ON} similar to
           uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 621

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++ + +  ++ +G+    L     A+E Y+R +DI
Sbjct: 398 ANYYSAKQEHEKSILYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIECYRRAVDI 454

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 26/123 (21%), Positives = 51/123 (41%), Gaps = 19/123 (15%)

Query: 102 AAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGF 161
           A  D++  I+ + AA+   PTD + +    AA ++  + E +++   KA ++  S+ +  
Sbjct: 418 ANDDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLKPSFVRAR 477

Query: 162 SRLGYAKYALGRHEEALEAYKR-------------------VLDIEGDNATEAMRRDYES 202
             L  A   +  ++EA E                       V+D   DN  E ++R + +
Sbjct: 478 YNLAVACMNIHCYKEAAEHLLTALSMHEVGTPNGKAIPEGLVIDSHNDNIMETLKRVFIA 537

Query: 203 AKR 205
             R
Sbjct: 538 LNR 540

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 50/101 (49%), Gaps = 20/101 (19%)

Query: 105 DYETAIQKYTAAIEVLPTDA----VYYANRAAAYSSLQQYEKAVEDAEKATKV------- 153
           DY +A+++Y  ++  LP       + Y+N  A+   + Q+ ++V DA++A K+       
Sbjct: 377 DYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSL 436

Query: 154 ------DSSYSKGFSRLGYAKYALGRHE--EALEAYKRVLD 186
                 +S   + ++ + + K  L + E  EA+E YK  LD
Sbjct: 437 WTAAIQNSDPVRSYNDI-WPKIILRQAESYEAIEKYKLALD 476

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A+     ++EV P+DA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 279 DPQKALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSI 338

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 339 GVLYYQISQYRDALDAYTRAIRL 361

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 8/64 (12%)

Query: 125 VYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRV 184
           ++YAN         ++++ ++  + A KV+ +    ++RLG +     R EEA++AY R 
Sbjct: 433 LFYAN--------DEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRA 484

Query: 185 LDIE 188
           L ++
Sbjct: 485 LQLK 488

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     +D++ AI+    A  + P  A  Y  +   YS+   ++ A     KA  ++ +
Sbjct: 445 GNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 504

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +      LG +   LG+++EAL  +++   I   N 
Sbjct: 505 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 540

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D + A   Y A ++  P+ A    + A  Y S   +++A E  E+A  V+   S  ++ L
Sbjct: 65  DGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATL 124

Query: 165 GYAKYALGRHEEALEAYKRVL 185
           G+    L   + A  AY++ L
Sbjct: 125 GHCYLMLDDLQRAYNAYQQAL 145

>Kpol_1050.82 s1050 complement(185867..187786) [1920 bp, 639 aa]
           {ON} complement(185867..187786) [1920 nt, 640 aa]
          Length = 639

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 32/57 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++   +  ++ +G+    L   + A+E Y+R +DI
Sbjct: 416 ANYYSARQEHEKSIMYFRRALTLNKKNTSAWTLMGHEFVELKNSQAAIECYRRAVDI 472

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%)

Query: 140 YEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIE 188
           ++K ++  E A +V+ +    ++RLG +     R EEA++AY R L ++
Sbjct: 473 FDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLK 521

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/73 (20%), Positives = 37/73 (50%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D++  I  + +A+ V P D + +    A+ ++  + E+A++   +A ++  S+ +    L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 165 GYAKYALGRHEEA 177
             +   +G  +EA
Sbjct: 532 AVSSMNIGCFKEA 544

>CAGL0M08030g Chr13 complement(800149..801312) [1164 bp, 387 aa]
           {ON} similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032w Peptidyl-prolyl cis-trans isomerase CYP7
          Length = 387

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 52/117 (44%), Gaps = 22/117 (18%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEV----LPTDAV--------------YYANRAAAYSSLQ 138
           G+     KDY+ +  KY  A++     +P   V               Y N   A  +L+
Sbjct: 241 GSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLFIELKKKLYLNICLALFNLK 300

Query: 139 QYEKAVEDAEKATKVDS----SYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDN 191
            Y+++++      ++DS      +K + R+G + +A  R++EAL+ Y+   D   D+
Sbjct: 301 DYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRYDEALKNYRLCRDHNPDD 357

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS--YSKGFSRLGY 166
           +I+ + +AI V P D   +     AY    + E +++  EKA ++DSS  Y+K F  +  
Sbjct: 684 SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSIAL 743

Query: 167 AKYALGRHEEALEAYKRV 184
           ++  +G   E++   K +
Sbjct: 744 SE--MGEFTESIPLLKEI 759

>Kwal_56.24750 s56 complement(1132221..1134080) [1860 bp, 619 aa]
           {ON} YHR166C (CDC23) - Cell division cycle protein
           [contig 160] FULL
          Length = 619

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 396 ANYYSAKQEHEKSIMYFRRALTLNKKCTSAWTLMGHEFVELKNSHAAIECYRRAVDI 452

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G  A+     E A + +T    + PT A+ ++N +AAY    + ++A    ++A   DS 
Sbjct: 640 GCIALECNKMEIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQ 699

Query: 157 YS-KGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATE 194
            + + +         L   E+ L A K++++I+ D + E
Sbjct: 700 KNWRIWENFLLVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           D +TA+     ++E   TDA  + +    +     Y  A +  ++A   DS     +  +
Sbjct: 293 DPQTALNLLLKSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSI 352

Query: 165 GYAKYALGRHEEALEAYKRVLDI 187
           G   Y + ++ +AL+AY R + +
Sbjct: 353 GVLYYQISQYRDALDAYTRAIRL 375

>Suva_10.560 Chr10 complement(974002..977079) [3078 bp, 1025 aa]
           {ON} YLR442C (REAL)
          Length = 1025

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 273 QKMMQNPSAIQEMMSNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKF 323
           QK+ +N SAI+ +++   I+ +A+N A+ +G++G    + D AV      F
Sbjct: 807 QKLPENVSAIEHIINTKIIELIAKNIANVSGTTGKAFKICDMAVETSKKDF 857

>Kpol_1057.14 s1057 (25908..28082) [2175 bp, 724 aa] {ON}
           (25908..28082) [2175 nt, 725 aa]
          Length = 724

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 40/66 (60%), Gaps = 4/66 (6%)

Query: 118 EVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK-YAL-GRHE 175
           E LP +A+ +   A  Y ++Q+  +A +   K++ +D +++  +  +G++  +AL G H+
Sbjct: 428 ENLPKNAITWFGVATYYMTVQKISEARKYFSKSSILDPNFAPSW--IGFSHTFALEGEHD 485

Query: 176 EALEAY 181
           +A+ AY
Sbjct: 486 QAISAY 491

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 171 LGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEE 209
           L + EE L + K  LD  G+N  +A+R DYE AKR  +E
Sbjct: 237 LAKAEEILRSSKSNLDYHGENM-KALREDYEHAKRLFKE 274

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEK 149
           GN A    ++  A+  Y  AI   PT+ V Y+N A A   L  Y  A +  ++
Sbjct: 11  GNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQR 63

>KNAG0E00680 Chr5 complement(122876..124795) [1920 bp, 639 aa] {ON}
           Anc_5.72 YHR166C
          Length = 639

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 31/57 (54%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++   +  ++ +G+    L     A+E Y+R +DI
Sbjct: 415 ANYYSARQEHEKSIMYFRRALVLNKKSTSAWTLMGHEFVELKNSHAAIECYRRAVDI 471

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 47/107 (43%), Gaps = 3/107 (2%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           G   M   DY  A   +  A+     + +++ +    Y  + QY  A++   +A +++  
Sbjct: 318 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 377

Query: 157 YSKGFSRLGYAKYALGRH-EEALEAYKRVLDIEGDNATEAMRRDYES 202
            S+ +  LG           +AL+AYK+   ++ +N    +R+  ES
Sbjct: 378 ISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENI--HIRKRLES 422

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 35/75 (46%)

Query: 105 DYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRL 164
           DY+  I  +  A+ V P D + +    A+ ++  + E+AV    +A  +  S+ +    L
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNL 567

Query: 165 GYAKYALGRHEEALE 179
             +   +G  +EA E
Sbjct: 568 AVSSINIGCFKEAAE 582

>TPHA0G00430 Chr7 complement(77860..80046) [2187 bp, 728 aa] {ON}
           Anc_5.689 YOR080W
          Length = 728

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 28/56 (50%)

Query: 127 YANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYK 182
           Y N +A Y  LQ  +KA + +++   VD    KG+  +G       + + A +AYK
Sbjct: 75  YGNLSATYDKLQNLDKASDCSQRMINVDPYNLKGYIMMGKILQKQNKDKLAYKAYK 130

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLD 186
           A+ Y +   + KA +  E+A  +D S S  ++ LG+    L   ++A  AY++ L+
Sbjct: 205 ASLYRARDMFHKASQLYERALAIDPSLSDIWATLGHCYLMLDDLQKAYNAYQQALN 260

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 48/99 (48%), Gaps = 4/99 (4%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKV--D 154
           G   M    Y+ A+  +  A  + P++A+      +A   L   EKA+   E A  +  +
Sbjct: 693 GTCCMRLGQYDQALLYFEKAKMINPSNAILLCCCGSALEKLNFNEKALNYYELACNLQPN 752

Query: 155 SSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNAT 193
           SS++K   +L    Y++ R+  ALE  ++V+++  +  T
Sbjct: 753 SSFAKF--KLAKLLYSMSRYNLALEILEQVIEMAPEEVT 789

>TDEL0G00960 Chr7 (191061..192929) [1869 bp, 622 aa] {ON} Anc_5.72
           YHR166C
          Length = 622

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%)

Query: 131 AAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDI 187
           A  YS+ Q++EK++    +A  ++ + +  ++ +G+    L     A+E Y+R +D+
Sbjct: 399 ANYYSARQEHEKSIMYFRRALTLNKNCTNAWTLMGHEFVELRNSHAAIECYRRAVDM 455

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 30.0 bits (66), Expect = 9.2,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 3/83 (3%)

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGYAK 168
           +IQ +  A+ + PTD   +     +Y +  + E +++  E+A  +D  +S          
Sbjct: 698 SIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDLDEHHSYALYYKAVCH 757

Query: 169 YALGRHEEALEAYKRVLDIEGDN 191
             LG +EE+L   K + ++ G+N
Sbjct: 758 SQLGEYEESL---KLMYNLVGEN 777

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 30.0 bits (66), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 171 LGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEE 209
           L R E  L + K  LD+  DN  +A+R DY+ AKR  +E
Sbjct: 237 LKRAETILRSSKNNLDLHADNV-KALREDYDHAKRLFKE 274

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
            (SKI3) - Contains 8 copies of the TPR domain [contig 8]
            FULL
          Length = 1410

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 9/73 (12%)

Query: 128  ANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSR---------LGYAKYALGRHEEAL 178
            A  A  Y  ++ YE A+E+A+ +  + S +    ++         +G A Y L   +  L
Sbjct: 1165 AQLARVYLGMKNYEAAIENADLSLGILSEHDNEIAKKNVISNHVVMGLAFYFLDDFDSTL 1224

Query: 179  EAYKRVLDIEGDN 191
            E +K +L+  GD+
Sbjct: 1225 EHFKTILEYPGDS 1237

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVD--SSYSKGFSRLGY 166
           +++ + +A+ V P D   +     AY +  + E + +  EKA ++D    Y++ F+ L  
Sbjct: 704 SVEWFHSALRVDPNDVESWVALGQAYFACGRVEASTKVFEKAIEIDPLHLYAQYFNSLSL 763

Query: 167 AKYALGRHEEALEAYKRV 184
           A+  +G  EE +E  K +
Sbjct: 764 AE--MGCFEECIEILKNI 779

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 43/96 (44%)

Query: 97  GNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSS 156
           GN     +D++ AI+    A  + P  A  Y  +   YS+   ++ A     KA  ++ +
Sbjct: 464 GNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPN 523

Query: 157 YSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNA 192
           +      LG +   LG+++EAL  +++   I   N 
Sbjct: 524 HYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNV 559

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 30.0 bits (66), Expect = 9.7,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 109 AIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKV--DSSYSKGFSRLGY 166
           +I+ + +A+ V P D   +     AY +  + E +++  EKA ++  D +Y+K F+ +  
Sbjct: 703 SIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYFNSVAL 762

Query: 167 AKYALGRHEEALEAYKRVLDIE 188
           A+  +   E A++  + VL  E
Sbjct: 763 AQ--MDEFERAIDILRHVLKDE 782

>Ecym_3433 Chr3 (813903..815513) [1611 bp, 536 aa] {ON} similar to
           Ashbya gossypii AAR041W
          Length = 536

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)

Query: 266 PQVMQAAQ-KMMQNPSAIQEMMS 287
           PQ+MQ AQ K+ QNPS ++ MMS
Sbjct: 465 PQLMQQAQQKLKQNPSMMKNMMS 487

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.125    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,775,625
Number of extensions: 807987
Number of successful extensions: 3207
Number of sequences better than 10.0: 273
Number of HSP's gapped: 3066
Number of HSP's successfully gapped: 447
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)