Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR004W6.22ON56356328440.0
Ecym_30276.22ON54954620280.0
KLLA0D01221g6.22ON56653319140.0
KAFR0A050706.22ON56454818760.0
KNAG0F028906.22ON56355918750.0
Kpol_1037.276.22ON54654618510.0
SAKL0E01364g6.22ON54152818490.0
KLTH0C11176g6.22ON53653518440.0
Kwal_56.224376.22ON53653318360.0
TBLA0G009706.22ON55954618280.0
YOR002W (ALG6)6.22ON54453718130.0
Smik_15.1716.22ON54453718080.0
Suva_15.1776.22ON54453718040.0
CAGL0E02629g6.22ON54854718050.0
NCAS0D021606.22ON56355018050.0
Skud_15.1636.22ON54453718000.0
TDEL0G044706.22ON54253617940.0
NDAI0C026306.22ON58053317960.0
ZYRO0C07744g6.22ON54754817690.0
TPHA0J003506.22ON55952917540.0
Kpol_1018.735.669ON6212653015e-28
Kwal_55.217425.669ON5552682916e-27
Smik_15.2475.669ON5773732881e-26
Skud_15.2345.669ON5772682836e-26
TPHA0J013805.669ON5752672811e-25
YOR067C (ALG8)5.669ON5773822766e-25
TBLA0A093105.669ON5462682757e-25
Suva_8.1185.669ON5762682757e-25
KLLA0F16621g5.669ON5612852731e-24
NCAS0G004505.669ON5702592712e-24
KLTH0F17666g5.669ON5552702694e-24
ADR210C5.669ON5722692685e-24
CAGL0L10450g5.669ON5502682676e-24
TDEL0B025405.669ON5692682676e-24
SAKL0G00836g5.669ON5612682642e-23
NDAI0F005105.669ON5702682614e-23
ZYRO0A11506g5.669ON5562682605e-23
KAFR0D024405.669ON5752702597e-23
Ecym_40515.669ON6042582402e-20
KNAG0L019205.669ON5682982293e-19
TDEL0A066708.723ON625104751.8
KNAG0G028308.723ON677159723.7
ABR166C7.504ON17752685.4
SAKL0C14014gsingletonON12073666.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR004W
         (563 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic ho...  1100   0.0  
Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON} s...   785   0.0  
KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {...   741   0.0  
KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa] ...   727   0.0  
KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {O...   726   0.0  
Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {O...   717   0.0  
SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} simila...   716   0.0  
KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} simila...   714   0.0  
Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {...   711   0.0  
TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.2...   708   0.0  
YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha...   702   0.0  
Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002...   701   0.0  
Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002...   699   0.0  
CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly...   699   0.0  
NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {O...   699   0.0  
Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002...   697   0.0  
TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.2...   695   0.0  
NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.2...   696   0.0  
ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly...   686   0.0  
TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON...   680   0.0  
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...   120   5e-28
Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {...   116   6e-27
Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {...   115   1e-26
Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {...   113   6e-26
TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {...   112   1e-25
YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON} ...   110   6e-25
TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON} Anc_5...   110   7e-25
Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON...   110   7e-25
KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]...   109   1e-24
NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669...   108   2e-24
KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]...   108   4e-24
ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}...   107   5e-24
CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa...   107   6e-24
TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.6...   107   6e-24
SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly s...   106   2e-23
NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.6...   105   4e-23
ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {...   104   5e-23
KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.6...   104   7e-23
Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar t...    97   2e-20
KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {...    93   3e-19
TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa] ...    33   1.8  
KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {O...    32   3.7  
ABR166C Chr2 complement(713729..714262) [534 bp, 177 aa] {ON} Sy...    31   5.4  
SAKL0C14014g Chr3 (1245903..1246265) [363 bp, 120 aa] {ON} some ...    30   6.6  

>ACR004W Chr3 (360904..362595) [1692 bp, 563 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR002W (ALG6)
          Length = 563

 Score = 1100 bits (2844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/563 (95%), Positives = 539/563 (95%)

Query: 1   MNQGRLRDKPRMEGAPPSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAA 60
           MNQGRLRDKPRMEGAPPSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAA
Sbjct: 1   MNQGRLRDKPRMEGAPPSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAA 60

Query: 61  KYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGL 120
           KYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGL
Sbjct: 61  KYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGL 120

Query: 121 DYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLY 180
           DYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLY
Sbjct: 121 DYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLY 180

Query: 181 FTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYA 240
           FTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYA
Sbjct: 181 FTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYA 240

Query: 241 LAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPL 300
           LAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPL
Sbjct: 241 LAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPL 300

Query: 301 YLLGNISAIFQSIHRVFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSA 360
           YLLGNISAIFQSIHRVFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSA
Sbjct: 301 YLLGNISAIFQSIHRVFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSA 360

Query: 361 AMLPSLIITFLYPKKFMLPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVL 420
           AMLPSLIITFLYPKKFMLPYALAACSMSFFLFGFQVHEK            YTSTDWNVL
Sbjct: 361 AMLPSLIITFLYPKKFMLPYALAACSMSFFLFGFQVHEKTILVPLLPITLLYTSTDWNVL 420

Query: 421 SMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVS 480
           SMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVS
Sbjct: 421 SMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVS 480

Query: 481 DVADGYRRRSLLPSNXXXXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSS 540
           DVADGYRRRSLLPSN            CVGAIHIAELWYPPSQRLPDIWVLANCLVGCSS
Sbjct: 481 DVADGYRRRSLLPSNIIWRIIIVVSYICVGAIHIAELWYPPSQRLPDIWVLANCLVGCSS 540

Query: 541 FALFWMWNNYKMFAMRNSTISDL 563
           FALFWMWNNYKMFAMRNSTISDL
Sbjct: 541 FALFWMWNNYKMFAMRNSTISDL 563

>Ecym_3027 Chr3 complement(52360..54009) [1650 bp, 549 aa] {ON}
           similar to Ashbya gossypii ACR004W
          Length = 549

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/546 (67%), Positives = 440/546 (80%), Gaps = 5/546 (0%)

Query: 18  SKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGL 77
           + E GQ     D ++  ++E+FFASPLYDFLYPLRPV NQW+AKYII+IFALI+RLAVGL
Sbjct: 9   ASEKGQ-----DTRRSCVEESFFASPLYDFLYPLRPVANQWSAKYIILIFALIVRLAVGL 63

Query: 78  GGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG 137
           GGYSG GK P+FGDFEAQRHWME+T  +P+S+WYF+ L+YWGLDYPPLTAYHSY+LG+LG
Sbjct: 64  GGYSGKGKGPLFGDFEAQRHWMEITTCLPISRWYFYDLEYWGLDYPPLTAYHSYILGRLG 123

Query: 138 SYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQY 197
           S+++  WF L+ SRG+ES DLKS+MR+TV+LSEL  YIPAV+YFTRWIGR R QSPIGQY
Sbjct: 124 SFVNATWFKLNTSRGFESIDLKSFMRITVLLSELVCYIPAVMYFTRWIGRHRNQSPIGQY 183

Query: 198 IAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMAL 257
           +A AAILFQP+LILIDHGHFQYNCVMLGL V  INNLLD++Y  AA+ FV SLGFKQMAL
Sbjct: 184 VACAAILFQPSLILIDHGHFQYNCVMLGLVVYTINNLLDEFYGFAAICFVLSLGFKQMAL 243

Query: 258 YYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVF 317
           YY+PV+F YL SRS YYPR N PRF  +A+ATL+ FG LYAPL L G+   I QS++RVF
Sbjct: 244 YYSPVIFAYLFSRSAYYPRFNFPRFAGIAIATLLTFGALYAPLCLFGDFRNIIQSVYRVF 303

Query: 318 PFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFM 377
           PF RG+FEDKVANFWCVTNV++KY+  YT  QL+F+ L+ T+ A  P+ II FLYPKKF+
Sbjct: 304 PFSRGIFEDKVANFWCVTNVIIKYRELYTQKQLQFYCLLTTAIAQFPAFIIIFLYPKKFL 363

Query: 378 LPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPL 437
           LPYALAACSM+FFLF FQVHEK            + ST+W+VLSMVAWINN+ALFTLWPL
Sbjct: 364 LPYALAACSMAFFLFSFQVHEKTILVPLLPITLLHISTNWDVLSMVAWINNVALFTLWPL 423

Query: 438 LKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXX 497
           LKKDGL LQYAIMFLLSNWL+GNFSF+TPTFLPK LTPGPSVSDVAD YRRRSLLP N  
Sbjct: 424 LKKDGLLLQYAIMFLLSNWLLGNFSFVTPTFLPKFLTPGPSVSDVADDYRRRSLLPKNIF 483

Query: 498 XXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRN 557
                     C+  IH+ +L+  P +  PDIWVLA C +G + F  FW+WN Y+++ MRN
Sbjct: 484 WRIIIVSSYVCMAFIHLLDLYVQPPRNYPDIWVLATCALGFACFTAFWLWNYYQLYRMRN 543

Query: 558 STISDL 563
           S++++L
Sbjct: 544 SSLNEL 549

>KLLA0D01221g Chr4 complement(106736..108436) [1701 bp, 566 aa] {ON}
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease,
          Length = 566

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/533 (65%), Positives = 413/533 (77%)

Query: 31  KKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFG 90
           KK    EAFFASP+YDFL P RPV NQW AKY+IVIFALIIR AVGLGGYSGM  PPMFG
Sbjct: 34  KKVESVEAFFASPMYDFLTPFRPVGNQWCAKYVIVIFALIIRCAVGLGGYSGMNTPPMFG 93

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150
           DFEAQRHWME+TQH+PV +WY++ LQYWGLDYPPLTAYHSYLLGKLGS+    WF L +S
Sbjct: 94  DFEAQRHWMEITQHLPVREWYWYDLQYWGLDYPPLTAYHSYLLGKLGSFFREGWFDLESS 153

Query: 151 RGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALI 210
           RGYES +LKSYMR TVI+SEL  YIPAV+YFT+W+G+ R QSPIGQYIA AAILFQPALI
Sbjct: 154 RGYESLNLKSYMRFTVIISELLLYIPAVIYFTKWVGKYRSQSPIGQYIAAAAILFQPALI 213

Query: 211 LIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSR 270
           L+DHGHFQYNCVMLG+TV  +NNLLD +YA+ A+ FV SL FKQMALYY+P+ F YLLS+
Sbjct: 214 LVDHGHFQYNCVMLGMTVYTLNNLLDGFYAMGAICFVLSLCFKQMALYYSPIFFAYLLSK 273

Query: 271 SIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVAN 330
           S Y P +N+PR  A++V+T +AF   + P+Y+ G    + QS+HR+FPF RG+FEDKVAN
Sbjct: 274 STYSPGINLPRLFAISVSTALAFIGSFGPIYIFGGYKNLVQSMHRIFPFARGIFEDKVAN 333

Query: 331 FWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFF 390
           FWCV+N+ +KY+  +T   L+ +SL+ T   +LPS IITFLYPK+ +LPYALAACSMSFF
Sbjct: 334 FWCVSNIFIKYRNLFTQKDLQLYSLLATVIGLLPSFIITFLYPKRHLLPYALAACSMSFF 393

Query: 391 LFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIM 450
           LF FQVHEK            YTS DWNVLS+V WINN+ALFTLWPLLKKD L LQY +M
Sbjct: 394 LFSFQVHEKTILLPLLPITLLYTSRDWNVLSLVCWINNVALFTLWPLLKKDNLVLQYGVM 453

Query: 451 FLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXXCVG 510
           F+ SNWLIGNFSF+TP FLPK LTPGPS+SD+   YRR SLLP +             +G
Sbjct: 454 FMFSNWLIGNFSFVTPRFLPKFLTPGPSISDIDVDYRRASLLPKSLIWRLIIVGSYIAMG 513

Query: 511 AIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
            IH  + +  P  + PD+WVLANC +G S F  FW+WNNYK+F MRNST+ DL
Sbjct: 514 IIHFLDYYVSPPSKYPDLWVLANCSLGFSCFVTFWIWNNYKLFEMRNSTLQDL 566

>KAFR0A05070 Chr1 complement(1007657..1009351) [1695 bp, 564 aa]
           {ON} Anc_6.22 YOR002W
          Length = 564

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/548 (61%), Positives = 413/548 (75%), Gaps = 2/548 (0%)

Query: 18  SKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGL 77
           +K       A+      ++E F+ASPLYDFLYP RP  NQW A+YIIV FALIIR A+GL
Sbjct: 17  AKSKSNPKKASKLNNEAIEEVFYASPLYDFLYPFRPAGNQWLAQYIIVTFALIIRCAIGL 76

Query: 78  GGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG 137
           G YSGMG  PMFGDFEAQRHWME+TQH+P+SKWY+  LQYWGLDYPPLTAYHSY+LGK+G
Sbjct: 77  GSYSGMGHSPMFGDFEAQRHWMEITQHLPISKWYWFDLQYWGLDYPPLTAYHSYILGKIG 136

Query: 138 SYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQY 197
           S+I P+WF+L+ SRG E E +KSYMR TV++SE  FY PA++YF++W G+ R QSPIGQY
Sbjct: 137 SFIYPKWFTLNDSRGIEMEGIKSYMRTTVLISEAVFYFPAIIYFSKWFGKHRNQSPIGQY 196

Query: 198 IAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMAL 257
           IA  AILFQP+L+LIDHGHFQYN VMLGLTV AINNLLD +Y++A+V FV S+ FKQM+L
Sbjct: 197 IAATAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDDFYSVASVCFVLSICFKQMSL 256

Query: 258 YYAPVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLL-GNISAIFQSIHR 315
           YYAP+ F YLLS+S+++PRL NIPR V +A  T++ F  +Y+PLY+  G +  + QS+HR
Sbjct: 257 YYAPIFFGYLLSKSLFFPRLFNIPRLVGIAAVTIVTFVAMYSPLYIFGGGLENLIQSVHR 316

Query: 316 VFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKK 375
           +FPF RG+FEDKVANFWCVTN+L+KYK K+T  QL+ +SL  T    LP+L+I  LYPKK
Sbjct: 317 IFPFARGIFEDKVANFWCVTNILIKYKIKFTQDQLQLYSLAATVLGFLPALVIIVLYPKK 376

Query: 376 FMLPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLW 435
            +LPYALAACSMSFFLF FQVHEK            YTSTDWNVLSMV WINN+ALFTLW
Sbjct: 377 HLLPYALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTDWNVLSMVCWINNVALFTLW 436

Query: 436 PLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSN 495
           PLLKKDGL LQYA+ F LSNWL+GNFSF+TP FLPK+LTPGPS+S + + Y RRSLLP N
Sbjct: 437 PLLKKDGLILQYAVCFALSNWLLGNFSFVTPKFLPKMLTPGPSISAIHENYHRRSLLPHN 496

Query: 496 XXXXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAM 555
                        +   H  + +  P    PDIW+  NC++G  SF  FWMW  Y +F +
Sbjct: 497 ILWKVVIVSSYLSMAVFHYLDFFVEPPTNYPDIWITLNCVIGFGSFVFFWMWTYYMLFTL 556

Query: 556 RNSTISDL 563
           RN T+ DL
Sbjct: 557 RNKTLMDL 564

>KNAG0F02890 Chr6 complement(547204..548895) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/559 (60%), Positives = 421/559 (75%), Gaps = 2/559 (0%)

Query: 7   RDKPRMEGAP-PSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIV 65
           + +P+ E A   +K   +     D   P ++E F+ASP+YDFLYP R   +QW  +YIIV
Sbjct: 5   KKEPQGEDASSKTKSLSKLQRNKDEAAPEVEECFYASPIYDFLYPFRSPGSQWVTEYIIV 64

Query: 66  IFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPL 125
           +F LII+ A+GLG YSG   PPMFGDFEAQRHWME+TQH+PVS+WY+  LQYWGLDYPP 
Sbjct: 65  VFLLIIKSAIGLGSYSGFQTPPMFGDFEAQRHWMEITQHLPVSQWYWFDLQYWGLDYPPF 124

Query: 126 TAYHSYLLGKLGSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWI 185
           TAYHSYLLGK+G++I P WF L ASRG E++ +KSYMR TV+LSE  FYIPA++YFT+W+
Sbjct: 125 TAYHSYLLGKIGTFIYPPWFELDASRGMETDGIKSYMRFTVLLSECIFYIPAIVYFTKWV 184

Query: 186 GRRRQQSPIGQYIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVN 245
           GRR++QSPIGQ++A AAILFQP L+LIDHGHFQYNCVMLGLTV AINNLLD +YA+AAV 
Sbjct: 185 GRRKKQSPIGQFVAAAAILFQPTLMLIDHGHFQYNCVMLGLTVYAINNLLDGFYAMAAVC 244

Query: 246 FVFSLGFKQMALYYAPVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLG 304
           FV S+ FKQMALYYAP+ F  LLS+S+++PRL NIPRF++VA ATL +  V++APLY+ G
Sbjct: 245 FVLSICFKQMALYYAPIFFAVLLSKSLFFPRLFNIPRFLSVAFATLASLFVMFAPLYIFG 304

Query: 305 NISAIFQSIHRVFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLP 364
            +  + QSIHR+FPF RG+FEDKVANFWCVTNV  KYKT +T S+L+F+SLV T     P
Sbjct: 305 GVGNVLQSIHRIFPFARGIFEDKVANFWCVTNVFFKYKTMFTQSELQFYSLVATVVGFFP 364

Query: 365 SLIITFLYPKKFMLPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVA 424
           + +I   YPKKF++PY LAACSM+FFLF FQVHEK            +TST+WN LSMV 
Sbjct: 365 AFMIMIFYPKKFLIPYGLAACSMAFFLFSFQVHEKTILVPLLPATLLFTSTNWNNLSMVF 424

Query: 425 WINNIALFTLWPLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVAD 484
           W+NN+ALFTLWPLLKKDGL LQY +  ++ NWL+GNFSFITP FLPK+LTPGPS+S++A+
Sbjct: 425 WVNNVALFTLWPLLKKDGLWLQYCVCLVMYNWLLGNFSFITPRFLPKILTPGPSISNIAE 484

Query: 485 GYRRRSLLPSNXXXXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALF 544
            YRRRSLLP N            C+  IH+ E       + PD+WV  NC VG   F LF
Sbjct: 485 NYRRRSLLPHNIIWKIIILVSYLCMLMIHVLEYTIAAPSQYPDLWVQLNCTVGFGCFVLF 544

Query: 545 WMWNNYKMFAMRNSTISDL 563
           WMW  YK+  +RN TI +L
Sbjct: 545 WMWTYYKLITLRNKTIQEL 563

>Kpol_1037.27 s1037 complement(65544..67184) [1641 bp, 546 aa] {ON}
           complement(65544..67184) [1641 nt, 547 aa]
          Length = 546

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/546 (62%), Positives = 416/546 (76%), Gaps = 5/546 (0%)

Query: 22  GQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYS 81
             K   +   KP ++E+FFASPLYDFL P RPV+NQW  +YIIVIFALI+R A+GLG YS
Sbjct: 2   ASKKKISRINKP-VEESFFASPLYDFLSPFRPVSNQWLTEYIIVIFALIVRCAIGLGSYS 60

Query: 82  GMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYIS 141
           GMG PPMFGDFEAQRHWME+TQH+P+SKWYF  L+YWGLDYPPLTAYHSY+LG +GS+++
Sbjct: 61  GMGNPPMFGDFEAQRHWMEITQHLPISKWYFFDLEYWGLDYPPLTAYHSYVLGVIGSFLN 120

Query: 142 PEWFSLHASRGYESE--DLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIA 199
             WF+L+ SRGYESE  DLK+YMR TVI+SE+ FYIP V+YFT+W+GR RQQS IGQYIA
Sbjct: 121 KSWFALNDSRGYESENNDLKTYMRTTVIISEIIFYIPGVIYFTKWVGRHRQQSLIGQYIA 180

Query: 200 GAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYY 259
            AAILFQP+L+LIDHGHFQYN VMLGLTV AINNLLD++YA AA+ FV S+ FKQMALYY
Sbjct: 181 AAAILFQPSLMLIDHGHFQYNSVMLGLTVYAINNLLDEFYAPAAMCFVLSICFKQMALYY 240

Query: 260 APVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVF 317
           AP+ F YLL RS++  +  NI RF+++A++T+ AF  +YAPLY+ G  +  + QS+HR+F
Sbjct: 241 APIFFGYLLGRSLFSRKFFNISRFLSIAISTVFAFFSMYAPLYVFGGGLRNVIQSVHRIF 300

Query: 318 PFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFM 377
           PF RGLFEDKVANFWCVTN+ +KYK  YT  +L+ +SL+ T    LP+++    YPKK +
Sbjct: 301 PFARGLFEDKVANFWCVTNIFIKYKILYTQKELQLYSLIATVVGFLPAVVTILFYPKKHL 360

Query: 378 LPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPL 437
           LPYALAACSMSF+LF FQVHEK            YTSTDWNVLS V+W+NN+ LFTLWPL
Sbjct: 361 LPYALAACSMSFYLFSFQVHEKTILVPLLPITLLYTSTDWNVLSFVSWVNNVGLFTLWPL 420

Query: 438 LKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXX 497
           LKKDGL+LQY + F LSNWLIGNFSFITP FLPK+LTPGP V +  D Y RRSLLP N  
Sbjct: 421 LKKDGLTLQYGVCFFLSNWLIGNFSFITPKFLPKMLTPGPPVQNTEDTYHRRSLLPHNIL 480

Query: 498 XXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRN 557
                      +  IH+ E++  P    PDIWVL NC +G   F LFW+WN YK+F + N
Sbjct: 481 WKIIIVSSYIVMLLIHLGEIFVSPPPEYPDIWVLMNCCLGFGCFVLFWLWNYYKIFTLAN 540

Query: 558 STISDL 563
            T+  L
Sbjct: 541 KTLQYL 546

>SAKL0E01364g Chr5 (103009..104634) [1626 bp, 541 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 541

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/528 (65%), Positives = 407/528 (77%)

Query: 35  LKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEA 94
           +KE+FFASPL+DFL P RPV NQW AKYIIV+FALIIR  VGLG +SGM  PPM GDFEA
Sbjct: 13  VKESFFASPLFDFLSPFRPVANQWCAKYIIVLFALIIRCGVGLGSFSGMNVPPMHGDFEA 72

Query: 95  QRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYE 154
           QRHWME+T ++P+S+WY++ L YWGLDYPPLTAYHSY+LGKLG    P WF L  SRG E
Sbjct: 73  QRHWMELTTNLPLSQWYWYDLPYWGLDYPPLTAYHSYILGKLGDIFDPTWFQLGVSRGQE 132

Query: 155 SEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDH 214
           S DLKSYMR TV+LSEL  YIP V+YF +WIG+ R Q+PIGQYIA AAILFQP+LILIDH
Sbjct: 133 SMDLKSYMRFTVLLSELLLYIPGVIYFAKWIGKHRGQTPIGQYIAAAAILFQPSLILIDH 192

Query: 215 GHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYY 274
           GHFQYN VMLGLTV AINNLLD+YYA AA+ FV S+ FKQMALYYAP+ F YLLS+S++ 
Sbjct: 193 GHFQYNSVMLGLTVYAINNLLDEYYAPAAICFVLSVCFKQMALYYAPIFFSYLLSKSLFS 252

Query: 275 PRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVANFWCV 334
           P  N+PR +AVA ATLI+F  ++ PLY+ G I  + QSIHR+FPF RG+FEDKVANFWC 
Sbjct: 253 PLFNLPRLLAVAAATLISFAAMFFPLYMWGGIRNVLQSIHRIFPFSRGIFEDKVANFWCF 312

Query: 335 TNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLFGF 394
           +N+ +KYK  YT SQL+ +SL  T+   LP+ I+ F YPKK ++PYAL ACSMSFFLF F
Sbjct: 313 SNIFIKYKVLYTQSQLQMYSLCATALGFLPAFILIFFYPKKHLIPYALTACSMSFFLFSF 372

Query: 395 QVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLS 454
           QVHEK            YTSTDWNVLSMV+WINN+A FTLWPLLKKDGL LQYA + LLS
Sbjct: 373 QVHEKTILVPLLPITLLYTSTDWNVLSMVSWINNMAFFTLWPLLKKDGLVLQYATLLLLS 432

Query: 455 NWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXXCVGAIHI 514
           NWLIGNFSF+TP FLPK LTPGPS SDV++ YRRRSLLP N             +G +H+
Sbjct: 433 NWLIGNFSFVTPRFLPKFLTPGPSTSDVSENYRRRSLLPDNIFWKLIIVASYISMGILHL 492

Query: 515 AELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISD 562
            + +  P  + PD+WVL NC +G  SF LFW+WN YKMF +RN T+ D
Sbjct: 493 LDFYVQPPAKYPDLWVLLNCSLGFFSFFLFWVWNYYKMFTLRNKTLYD 540

>KLTH0C11176g Chr3 (917419..919029) [1611 bp, 536 aa] {ON} similar
           to uniprot|Q12001 Saccharomyces cerevisiae YOR002W ALG6
           Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 536

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/535 (62%), Positives = 416/535 (77%)

Query: 29  DAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPM 88
           DA+K   KE+FFASPLYDFL P RPV NQ+ A+Y+IVIFAL+IR AVGLG +SG    PM
Sbjct: 2   DARKSLPKESFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGEATVPM 61

Query: 89  FGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH 148
            GDFEAQRHWME+T ++P+S+WY+  LQYWGLDYPPLTAYHSY LGKLGS ++PEWF+L 
Sbjct: 62  HGDFEAQRHWMELTTNLPLSQWYWFDLQYWGLDYPPLTAYHSYALGKLGSVLNPEWFALG 121

Query: 149 ASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208
           +SRG E+ +LK+YMR TVILSE   YIPAVLYFT+W G +R+QSPIGQYIA AAILFQP+
Sbjct: 122 SSRGNETPELKAYMRFTVILSEAALYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPS 181

Query: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268
           LILIDHGHFQYN VMLGLTV AINNLLD ++  AA+ F+ SL FKQMAL+Y+P+ F YLL
Sbjct: 182 LILIDHGHFQYNSVMLGLTVYAINNLLDGFHGPAAICFMLSLCFKQMALFYSPIFFAYLL 241

Query: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKV 328
           SRS++ P     RF++VA++T+I F ++++PLY+ G +  + QSIHR+FPF RG+FEDKV
Sbjct: 242 SRSLFSPSFKFSRFMSVALSTVITFCLMFSPLYVFGGMKNVLQSIHRIFPFSRGIFEDKV 301

Query: 329 ANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMS 388
           ANFWCV+NV+VKY   +T  QL+  S   T+A  LPS  +  LYPKK M+PY LAACSM+
Sbjct: 302 ANFWCVSNVIVKYADNFTQDQLQKLSTFATAAGFLPSFALVVLYPKKHMIPYGLAACSMA 361

Query: 389 FFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYA 448
           FFLFGFQVHEK            + STDWNVL++V+WINN+ALFTLWPLLKKD L+LQY 
Sbjct: 362 FFLFGFQVHEKSILVPLLPISLLFCSTDWNVLAIVSWINNVALFTLWPLLKKDKLALQYG 421

Query: 449 IMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXXC 508
           IM LLSNWLIGNFSF+TP FLP  +TPGPS+S+VA+ YRRRS LP+N             
Sbjct: 422 IMMLLSNWLIGNFSFVTPRFLPGFITPGPSMSNVAETYRRRSFLPNNIVWKILIITSYIV 481

Query: 509 VGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
           +  IHI +L+  P  +LPD+WVL NC +G + F++FW+WNNYK+F MRN +I DL
Sbjct: 482 MAVIHILDLFVQPPAKLPDLWVLMNCALGFTCFSVFWLWNNYKLFTMRNKSILDL 536

>Kwal_56.22437 s56 complement(127493..129103) [1611 bp, 536 aa] {ON}
           YOR002W (ALG6) - glucosyltransferase [contig 185] FULL
          Length = 536

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/533 (63%), Positives = 410/533 (76%)

Query: 30  AKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMF 89
            KK    E FFASPLYDFL P RPV NQ+ A+Y+IVIFAL+IR AVGLG +SG    P+ 
Sbjct: 3   GKKVSKNEPFFASPLYDFLSPFRPVANQYYAEYVIVIFALVIRCAVGLGSFSGENSGPIH 62

Query: 90  GDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA 149
           GDFEAQRHWME+T H+P+S+WY++ LQYWGLDYPPLTAYHSY+LGKLGS ++ EWF+L +
Sbjct: 63  GDFEAQRHWMELTNHLPLSQWYWYDLQYWGLDYPPLTAYHSYVLGKLGSLLNSEWFALLS 122

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
           SRG E+ D+K+YMR TVILSE   YIPAVLYFT+W G +R+QSPIGQYIA AAILFQP+L
Sbjct: 123 SRGIENPDIKAYMRFTVILSEAGLYIPAVLYFTKWFGIKRRQSPIGQYIAAAAILFQPSL 182

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ILIDHGHFQYN VMLGLTV +INNLLD YY  AA+ FV SL FKQMALYY+PV F YLLS
Sbjct: 183 ILIDHGHFQYNSVMLGLTVYSINNLLDGYYGPAAICFVLSLCFKQMALYYSPVFFAYLLS 242

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPFERGLFEDKVA 329
             +  P LN+PRF++VA +T+I+F ++++PLY+ G    + QSIHR+FPF RG+FEDKVA
Sbjct: 243 ECLISPSLNVPRFLSVAFSTVISFCIIFSPLYVFGGTKNVLQSIHRIFPFSRGIFEDKVA 302

Query: 330 NFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSF 389
           NFWCV+NVL KY   YT  +L+ FS++ T+A  LPS ++   YPKK M+P+ALAACSM+F
Sbjct: 303 NFWCVSNVLFKYAQNYTQQELQRFSIIATAAGFLPSFLVVLCYPKKHMIPFALAACSMAF 362

Query: 390 FLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAI 449
           FLF FQVHEK            Y STDWNVLSMV+WINN+ALFTLWPLLKKD L+LQY I
Sbjct: 363 FLFSFQVHEKSILVPLLPITLLYCSTDWNVLSMVSWINNVALFTLWPLLKKDHLTLQYGI 422

Query: 450 MFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXXCV 509
           + LLSNWLIGNFSF+TP FLPK +TPGPS+S V++ YRRRS LP N             +
Sbjct: 423 LMLLSNWLIGNFSFVTPRFLPKFITPGPSISVVSETYRRRSFLPDNNFWKLIIVASYLIM 482

Query: 510 GAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISD 562
            AIHI + + P  + LPD+WVL NC +G   F +FW+W +YK+F MRN+ + D
Sbjct: 483 AAIHILDFFVPTPEGLPDLWVLLNCALGFFCFTIFWLWMHYKLFTMRNTNLQD 535

>TBLA0G00970 Chr7 (246516..248195) [1680 bp, 559 aa] {ON} Anc_6.22
           YOR002W
          Length = 559

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/546 (62%), Positives = 422/546 (77%), Gaps = 15/546 (2%)

Query: 33  PGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDF 92
           PG +EAF+ASPL+DFLYP RPV +QW  +Y+I+IFA+IIR A+ LG YSG G PPMFGDF
Sbjct: 14  PGEEEAFYASPLFDFLYPFRPVGSQWLTEYVIIIFAIIIRCAISLGSYSGKGTPPMFGDF 73

Query: 93  EAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRG 152
           EAQRHWME+TQH+P+SKWY+  LQYWGLDYPP TAYHSY  GKLGS+ +P+WF+L++SRG
Sbjct: 74  EAQRHWMEITQHLPISKWYWFDLQYWGLDYPPFTAYHSYFFGKLGSFFNPDWFALNSSRG 133

Query: 153 YESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALI 210
           YES+D  LK+YMR TVILSE  FYIPAV+YFT+W+G+ R QSPIGQ+IA AAILFQP+L+
Sbjct: 134 YESDDNGLKTYMRFTVILSEAVFYIPAVVYFTKWLGKHRNQSPIGQFIAAAAILFQPSLM 193

Query: 211 LIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSR 270
           LIDHGHFQYN VMLGLTV AINNLLD++Y  AA+ FV SL FKQMALYY+P+ F YLLS+
Sbjct: 194 LIDHGHFQYNSVMLGLTVYAINNLLDEFYGPAAICFVLSLCFKQMALYYSPIFFGYLLSK 253

Query: 271 SIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISA-------------IFQSIHRVF 317
           S+ +P  NI RF+ VA++T+++F V++ P+YL G+ S+             + Q I R+F
Sbjct: 254 SLVHPSCNISRFIIVAISTVVSFVVMFGPIYLFGSSSSDDEIIADVSGLNNLIQCIRRIF 313

Query: 318 PFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFM 377
           PF RG+FEDKVANFWCVTNV++KY+  +T  QL+F+SLV T    LPS+I  FLYP+KF+
Sbjct: 314 PFARGIFEDKVANFWCVTNVVIKYRELFTQEQLQFYSLVATLIGFLPSMITIFLYPRKFL 373

Query: 378 LPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPL 437
           +PYALAACSMSFFLF FQVHEK            YTSTDWNVLS+V WINN+ALFTLWPL
Sbjct: 374 IPYALAACSMSFFLFSFQVHEKSILLPLMPITLLYTSTDWNVLSLVCWINNVALFTLWPL 433

Query: 438 LKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXX 497
           L+KDGL LQY + + LSNWLIGNFSFITP FLP  LTPGPS+S++ D YRR SLLP N  
Sbjct: 434 LRKDGLVLQYFVCYFLSNWLIGNFSFITPKFLPSFLTPGPSISNIDDDYRRGSLLPHNIL 493

Query: 498 XXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRN 557
                      +GA+ I +L++ P    PD+W++ NC VG   F LFW+WNNYK+  MRN
Sbjct: 494 WKIIIISSYIVMGAVQILDLFFQPPTNYPDLWIILNCTVGFGCFMLFWLWNNYKIIQMRN 553

Query: 558 STISDL 563
            T++DL
Sbjct: 554 KTLNDL 559

>YOR002W Chr15 (329417..331051) [1635 bp, 544 aa] {ON}  ALG6Alpha
           1,3 glucosyltransferase, involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation; mutations in human ortholog are
           associated with disease
          Length = 544

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/537 (62%), Positives = 410/537 (76%), Gaps = 4/537 (0%)

Query: 30  AKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMF 89
             KP  +E+F+ASP+YDFLYP RPV NQW  +YII + A+I+R  +GLG YSG G PP++
Sbjct: 9   VNKPA-EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVILRCTIGLGPYSGKGSPPLY 67

Query: 90  GDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA 149
           GDFEAQRHWME+TQH+P+SKWY++ LQYWGLDYPPLTA+HSYLLG +GS+ +P WF+L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALEK 127

Query: 150 SRGYESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQP 207
           SRG+ES D  LK+YMR TVI+S++ FY PAV+YFT+W+GR R QSPIGQ IA +AILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQP 187

Query: 208 ALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYL 267
           +L+LIDHGHFQYN VMLGLT  AINNLLD+YYA+AAV FV S+ FKQMALYYAP+ F YL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYL 247

Query: 268 LSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVFPFERGLFED 326
           LSRS+ +P+ NI R   +A ATL  F +++APLY LG  +  I Q IHR+FPF RG+FED
Sbjct: 248 LSRSLLFPKFNIARLTVIAFATLATFAIIFAPLYFLGGGLKNIHQCIHRIFPFARGIFED 307

Query: 327 KVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACS 386
           KVANFWCVTNV VKYK ++T  QL+ +SL+ T    LP++I+T L+PKK +LPY L ACS
Sbjct: 308 KVANFWCVTNVFVKYKERFTIQQLQLYSLIATVIGFLPAMIMTLLHPKKHLLPYVLIACS 367

Query: 387 MSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQ 446
           MSFFLF FQVHEK            Y+STDWNVLS+V+WINN+ALFTLWPLLKKDGL LQ
Sbjct: 368 MSFFLFSFQVHEKTILIPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQ 427

Query: 447 YAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXX 506
           YA+ FLLSNWLIGNFSFITP FLPK LTPGPS+S +   YRRRSLLP N           
Sbjct: 428 YAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTY 487

Query: 507 XCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
             +G  H  + +  P  + PD+WVL NC VG   F++FW+W+ YK+F   + ++ DL
Sbjct: 488 IAMGFYHFLDQFVAPPSKYPDLWVLLNCAVGFICFSIFWLWSYYKIFTSGSKSMKDL 544

>Smik_15.171 Chr15 (296715..298349) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/537 (61%), Positives = 411/537 (76%), Gaps = 4/537 (0%)

Query: 30  AKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMF 89
             KP  +E+F+ASP+YDFLYP RPV NQW  +YII + A+I+R  +GLG YSG G PP+ 
Sbjct: 9   VNKPA-EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCTIGLGPYSGKGSPPLH 67

Query: 90  GDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA 149
           GDFEAQRHWME+TQH+P+SKWY++ LQYWGLDYPPLTA+HSYLLG +GS+ +P WF+L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGSFFNPSWFALDK 127

Query: 150 SRGYESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQP 207
           SRG+ES D  LK+YMR TVI+S++ FY PAV+YFT+W+GR R QSPIGQ IA +AILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAASAILFQP 187

Query: 208 ALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYL 267
           +L+LIDHGHFQYN VMLGLT  AINNLLD+YYA+AA+ FV S+ FKQMALYYAP+ F YL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYL 247

Query: 268 LSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVFPFERGLFED 326
           LSRS+ +P+ NI R   ++ ATL  F ++ APLY LG  +  I+Q IHR+FPF RG+FED
Sbjct: 248 LSRSLLFPKFNIARLTVISFATLATFALMLAPLYFLGGGLKNIYQCIHRIFPFARGIFED 307

Query: 327 KVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACS 386
           KVANFWCVTNV VKYK +++  QL+ +SLV T    LP++++T L+PKK +LPY L ACS
Sbjct: 308 KVANFWCVTNVFVKYKERFSVQQLQLYSLVATVIGFLPAMVMTLLHPKKHLLPYVLIACS 367

Query: 387 MSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQ 446
           MSFFLF FQVHEK            Y+STDWNVLS+V+WINN+ALFTLWPLLK+DGL LQ
Sbjct: 368 MSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKRDGLHLQ 427

Query: 447 YAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXX 506
           YA+ FLLSNWLIGNFSFITP FLPK LTPGPS+S +   YRRRSLLP N           
Sbjct: 428 YAVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTY 487

Query: 507 XCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
             +G  H  +L+  P  + PD+WVL NC VG + F++FW+W+ YK+F   + ++ DL
Sbjct: 488 IAMGLYHFLDLFVAPPSKYPDLWVLLNCTVGFTCFSIFWVWSYYKIFTSGSKSMKDL 544

>Suva_15.177 Chr15 (303845..305479) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/537 (61%), Positives = 412/537 (76%), Gaps = 4/537 (0%)

Query: 30  AKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMF 89
             KP  +E+F+ASP+YDFLYP RPV NQW  +YII + A+I+R A+GLG YSG   PP+ 
Sbjct: 9   VNKPA-EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKATPPLH 67

Query: 90  GDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA 149
           GDFEAQRHWME+TQH+P+SKWY++ LQYWGLDYPPLTA+HSYLLG +G++ +P WF+L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSYLLGLIGTFFNPSWFALDK 127

Query: 150 SRGYESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQP 207
           SRG+ES D  LK+YMR TVI+S++ FY PAV+YFT+W+GR R QSPIGQ IA AAILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQP 187

Query: 208 ALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYL 267
           +L+LIDHGHFQYN VMLGLT  AINNLLD+YYA+AA+ FV S+ FKQMALYYAP+ F YL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAMCFVLSICFKQMALYYAPIFFAYL 247

Query: 268 LSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVFPFERGLFED 326
           LSRS+++P+ NI R   +A ATL  F +++APLY LG  +  I+Q IHR+FPF RG+FED
Sbjct: 248 LSRSLFFPKFNIARLTVIAFATLATFSLMFAPLYFLGGGLRNIYQCIHRMFPFARGIFED 307

Query: 327 KVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACS 386
           KVANFWCV+N+ VKYK +++  QL+ +SLV T    LP++++T L+PKK +LPY L ACS
Sbjct: 308 KVANFWCVSNIFVKYKERFSIQQLQLYSLVATVLGFLPAMMMTLLHPKKHLLPYVLIACS 367

Query: 387 MSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQ 446
           MSFFLF FQVHEK            Y+STDWNVLS+V+WINN+ALFTLWPLLKKDGL LQ
Sbjct: 368 MSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQ 427

Query: 447 YAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXX 506
           Y + FLL+NWLIGNFSFITP FLPK LTPGPS+S +   YRRRSLLP N           
Sbjct: 428 YVVSFLLTNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTY 487

Query: 507 XCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
             +G  H  +L+  P ++ PD+WVL NC VG   F++FW+W+ YK+F   N ++ DL
Sbjct: 488 IAMGLYHFLDLFVAPPKKYPDLWVLLNCAVGFICFSIFWIWSYYKIFTSGNKSMKDL 544

>CAGL0E02629g Chr5 (250010..251656) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002w ALG6 glucosyltransferase
          Length = 548

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/547 (58%), Positives = 419/547 (76%), Gaps = 2/547 (0%)

Query: 18  SKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGL 77
           S++  +K ++    + G +E+F+ASPLYDFL+P RP  +QW  ++II++FA+IIR A+GL
Sbjct: 3   SEKKDKKAVSKFESEQG-EESFYASPLYDFLFPFRPAGSQWLTEWIIIMFAMIIRCAIGL 61

Query: 78  GGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG 137
           G YSG    PM GDFEAQRHWME+TQH+P+SKWY++ L+YWGLDYPPLTA+HSYLLGKLG
Sbjct: 62  GPYSGYKDGPMHGDFEAQRHWMEITQHLPISKWYYYDLKYWGLDYPPLTAFHSYLLGKLG 121

Query: 138 SYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQY 197
           ++ +P+WF+L +SRG E++ LK+YMR TV+LSE  FY+PAV+YFT+W+GRRR QSPIGQ+
Sbjct: 122 TFCNPDWFALDSSRGIETQGLKNYMRFTVLLSEAIFYMPAVVYFTKWLGRRRNQSPIGQF 181

Query: 198 IAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMAL 257
           IA AAILFQP+L+LIDHGHFQYN +MLG TV AINNLLD++YA AA+ FV S+ FKQM+L
Sbjct: 182 IAAAAILFQPSLMLIDHGHFQYNSIMLGFTVYAINNLLDEFYAPAAICFVLSICFKQMSL 241

Query: 258 YYAPVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316
           YYAP+ F YLL RS+++P+L NIPRF+++++ATL+ F  +++P Y+ G +  + Q++ R+
Sbjct: 242 YYAPIFFAYLLGRSMFFPKLFNIPRFISISIATLVTFTAMFSPFYIFGGLDGLAQTVRRI 301

Query: 317 FPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKF 376
           FPF RG+FEDKVANFWCV N +VK+K  +T  QL+ +SL+LT     P++I+  LYP+K 
Sbjct: 302 FPFARGIFEDKVANFWCVVNTIVKFKVLFTNDQLRMYSLILTVVGFAPAMILIILYPRKH 361

Query: 377 MLPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWP 436
           +LPYALAACSMSF+LF FQVHEK            +TS DWNVLSMV+WINN+ALFTLWP
Sbjct: 362 LLPYALAACSMSFYLFSFQVHEKTILVPLLPITLLFTSRDWNVLSMVSWINNVALFTLWP 421

Query: 437 LLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNX 496
           LLK++GL LQY + F LSNWLIGNFSFITP FLPK +TPGPS+S V+D YRRRSLLP + 
Sbjct: 422 LLKREGLYLQYFVCFFLSNWLIGNFSFITPRFLPKFITPGPSISSVSDNYRRRSLLPHSI 481

Query: 497 XXXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMR 556
                       + A H  +L+     R PD+WV+ NC +G  SF+LFW+W  YK   + 
Sbjct: 482 FWKLIIVSSYIGMTAYHFLDLFIEAPPRFPDLWVILNCTIGFVSFSLFWLWTYYKFCTLL 541

Query: 557 NSTISDL 563
              I DL
Sbjct: 542 KKNIQDL 548

>NCAS0D02160 Chr4 complement(401973..403664) [1692 bp, 563 aa] {ON}
           Anc_6.22 YOR002W
          Length = 563

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/550 (60%), Positives = 419/550 (76%), Gaps = 4/550 (0%)

Query: 18  SKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGL 77
           S++   K   T  K    +E+F+ASPLYD LYP RP  +QW  +Y IV+F+LIIR AVGL
Sbjct: 14  SQKKSGKTKETSKKHDIPEESFYASPLYDLLYPFRPAGSQWMTEYTIVLFSLIIRCAVGL 73

Query: 78  GGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG 137
           G +SG G PPMFGDFEAQRHWME+TQH+P+ KWY+  L+YWGLDYPPLTAYHSY+ GK+G
Sbjct: 74  GPFSGYGVPPMFGDFEAQRHWMEITQHLPIHKWYWFDLKYWGLDYPPLTAYHSYICGKIG 133

Query: 138 SYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQY 197
           S+ +P WF+L +SRGYE++DLK++MRLTV++SE  FYIP V+YF +W+G+ R+QSPIGQ+
Sbjct: 134 SFFNPNWFALDSSRGYEAQDLKTFMRLTVLVSEALFYIPGVVYFVKWLGKHRRQSPIGQF 193

Query: 198 IAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMAL 257
           IA AAIL QP+LILIDHGHFQYN V LGLTV AINNLLD++YA+AAV FV S+ FKQM L
Sbjct: 194 IAAAAILLQPSLILIDHGHFQYNSVALGLTVYAINNLLDEFYAMAAVCFVLSICFKQMTL 253

Query: 258 YYAPVMFVYLLSRSIYYPRL-NIPRFVAVAVATLIAFGVLYAPLYLLG---NISAIFQSI 313
           YY+P+ F YLLS+S++ P+L NIPRF+A+A+AT+ +F ++Y PLY+ G    ++ + QSI
Sbjct: 254 YYSPIFFAYLLSKSLFTPKLFNIPRFLAIAIATVCSFLLMYGPLYVFGGDQGLNNVLQSI 313

Query: 314 HRVFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYP 373
           HR+FPF RG+FEDKVANFWCVTNV+ KYK  +T  +L+ +SLVLT    LP+++I   YP
Sbjct: 314 HRIFPFARGIFEDKVANFWCVTNVIFKYKMLFTQQELQLYSLVLTVVGFLPAMMIILFYP 373

Query: 374 KKFMLPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFT 433
           KK++LPYAL+ACSM+F+LF FQVHEK            YTSTD NVLS V+W+NNI LFT
Sbjct: 374 KKYLLPYALSACSMAFYLFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFT 433

Query: 434 LWPLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLP 493
           LWPLLKKDGL+LQY +  LLSNWLIGNFSFITP FLPKVLTPGPSVS + + Y  RSLLP
Sbjct: 434 LWPLLKKDGLTLQYWVCLLLSNWLIGNFSFITPNFLPKVLTPGPSVSMIGENYHYRSLLP 493

Query: 494 SNXXXXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMF 553
            N             +GAIH+ + +  P    PD+WV+ NC +G   F LFW+WN YK+F
Sbjct: 494 RNIFWKVIIVLSYIAMGAIHVLDAFVNPPVAYPDLWVILNCTLGFGCFFLFWIWNYYKLF 553

Query: 554 AMRNSTISDL 563
           +M   ++  L
Sbjct: 554 SMIKKSLHHL 563

>Skud_15.163 Chr15 (289416..291050) [1635 bp, 544 aa] {ON} YOR002W
           (REAL)
          Length = 544

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/537 (62%), Positives = 408/537 (75%), Gaps = 4/537 (0%)

Query: 30  AKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMF 89
             KP  +E+F+ASP+YDFLYP RPV NQW  +YII + A+I+R A+GLG YSG   PP+ 
Sbjct: 9   VNKPA-EESFYASPMYDFLYPFRPVGNQWLPEYIIFVCAVIVRCAIGLGPYSGKDSPPLH 67

Query: 90  GDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA 149
           GDFEAQRHWME+TQH+P+SKWY++ LQYWGLDYPPLTA+HS L G +G++ +P WF+L  
Sbjct: 68  GDFEAQRHWMEITQHLPLSKWYWYDLQYWGLDYPPLTAFHSCLFGLIGTFFNPSWFALDK 127

Query: 150 SRGYESED--LKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQP 207
           SRG+ES D  LK+YMR TVI+S++ FY PAV+YFT+W+GR R QSPIGQ IA AAILFQP
Sbjct: 128 SRGFESPDNGLKTYMRSTVIISDILFYFPAVIYFTKWLGRYRNQSPIGQSIAAAAILFQP 187

Query: 208 ALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYL 267
           +L+LIDHGHFQYN VMLGLT  AINNLLD+YYA+AAV FV S+ FKQMALYYAP+ F YL
Sbjct: 188 SLMLIDHGHFQYNSVMLGLTAYAINNLLDEYYAMAAVCFVLSICFKQMALYYAPIFFAYL 247

Query: 268 LSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIFQSIHRVFPFERGLFED 326
           LSRS+ +P+ NI R   +A ATL  F V+ APLY LG  +  I Q I+R+FPF RG+FED
Sbjct: 248 LSRSLLFPKFNIARLTVIAFATLATFSVILAPLYFLGGGLRNIHQCIYRIFPFSRGIFED 307

Query: 327 KVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACS 386
           KVANFWCVTN+ VKYK ++T  QL+ +SLV T    LP++I+T L+PKK +LPY L ACS
Sbjct: 308 KVANFWCVTNIFVKYKDRFTIQQLQLYSLVATVIGFLPAMIMTLLHPKKHLLPYVLIACS 367

Query: 387 MSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQ 446
           MSFFLF FQVHEK            Y+STDWNVLS+V+WINN+ALFTLWPLLKKDGL LQ
Sbjct: 368 MSFFLFSFQVHEKTILVPLLPITLLYSSTDWNVLSLVSWINNVALFTLWPLLKKDGLHLQ 427

Query: 447 YAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXX 506
           Y + FLLSNWLIGNFSFITP FLPK LTPGPS+S +   YRRRSLLP N           
Sbjct: 428 YTVSFLLSNWLIGNFSFITPRFLPKSLTPGPSISSINSDYRRRSLLPYNVVWKSFIIGTY 487

Query: 507 XCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
             +G  H+ +L+  P  + PD+WVL NC VG + F++FW+W+ YK+F   N ++ DL
Sbjct: 488 IAMGVYHLLDLFVVPPSKYPDLWVLLNCAVGFTCFSIFWIWSYYKIFTSGNKSVKDL 544

>TDEL0G04470 Chr7 (810734..812362) [1629 bp, 542 aa] {ON} Anc_6.22
           YOR002W
          Length = 542

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/536 (60%), Positives = 408/536 (76%), Gaps = 1/536 (0%)

Query: 29  DAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPM 88
           +AK+  ++E+F+ASPLYDFLYP RP  +QW  +Y+IV+FALII  AVG G YSG   PPM
Sbjct: 7   EAKRNTVEESFYASPLYDFLYPFRPAGSQWLTEYVIVLFALIIGCAVGHGSYSGQFSPPM 66

Query: 89  FGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH 148
           FGDFEAQRHWME+TQH+  S+WY+  L+YWGLDYPPLTAYHSY+LGK+GS+I PEWF L+
Sbjct: 67  FGDFEAQRHWMEITQHLAPSQWYWFDLEYWGLDYPPLTAYHSYVLGKIGSFIKPEWFELN 126

Query: 149 ASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208
            SRG E+ DLK++MR TV+LSE  FYIPAV+YFT+W+G+ RQ+SPIGQ+I+ AAILFQP+
Sbjct: 127 ESRGIETPDLKTFMRFTVLLSEGLFYIPAVVYFTKWLGKHRQKSPIGQFISAAAILFQPS 186

Query: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268
           L+LIDHGHFQYNCVMLGLTV AIN+L +++YA+AA+ FV S+ FKQMALYYAP+ F YLL
Sbjct: 187 LMLIDHGHFQYNCVMLGLTVYAINSLFEEFYAVAAICFVLSICFKQMALYYAPIFFAYLL 246

Query: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLL-GNISAIFQSIHRVFPFERGLFEDK 327
           S+S++ PR N PR  A+AVAT+++F  +YAPLY+  G ++ + QS+HR+FPF RG+FEDK
Sbjct: 247 SKSLFSPRFNFPRLFAIAVATVLSFAAMYAPLYIFGGGLANVIQSVHRIFPFARGIFEDK 306

Query: 328 VANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSM 387
           VANFWCVTNV  KYK  +   QL+ +SL+ T    LP++I+ FLYPKK ++ YALA CSM
Sbjct: 307 VANFWCVTNVFFKYKNIFPQEQLQLYSLIATMLGFLPAVIVIFLYPKKHIICYALATCSM 366

Query: 388 SFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQY 447
           SF+LF FQVHEK            YTS++W+VLSM  WINN+ LFTL+PLLKKDGL+LQY
Sbjct: 367 SFYLFSFQVHEKTILVPLLPITLLYTSSNWDVLSMANWINNVGLFTLYPLLKKDGLTLQY 426

Query: 448 AIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXX 507
            + F LSNWL+GNFSF+TP FLPK LTPGPSVS V   YRRRS LPSN            
Sbjct: 427 FVCFTLSNWLLGNFSFVTPKFLPKFLTPGPSVSSVDINYRRRSFLPSNVIWKIIIVSSYT 486

Query: 508 CVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
            +G +H+ +    P    PD+WVL NC +G   F LFW+W+ Y +F M   T+  L
Sbjct: 487 AMGVLHVVDFVMGPPVSYPDLWVLLNCALGFGCFTLFWLWSYYMLFTMPRKTLQQL 542

>NDAI0C02630 Chr3 (609993..611735) [1743 bp, 580 aa] {ON} Anc_6.22
           YOR002W
          Length = 580

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/533 (61%), Positives = 407/533 (76%), Gaps = 5/533 (0%)

Query: 36  KEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQ 95
           KE+F+ASPLYDFLYP RP  +QW  +YIIV+FA+IIR AVGLG YSG   PPMFGDFEAQ
Sbjct: 48  KESFYASPLYDFLYPFRPAGSQWMTEYIIVLFAIIIRCAVGLGPYSGFNTPPMFGDFEAQ 107

Query: 96  RHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYES 155
           RHWME+TQ++P+S+WY+  LQYWGLDYPPLTA+HSYL GK+GS+  P WF+L  SRGYE 
Sbjct: 108 RHWMEITQYLPISQWYWFDLQYWGLDYPPLTAFHSYLCGKIGSFFQPNWFTLGDSRGYEG 167

Query: 156 EDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHG 215
           +DLK++MRLTV+ SE   YIPAV+YFT+W+G+RR QSPIGQ+IA AAILFQP+LILIDHG
Sbjct: 168 QDLKTFMRLTVLASESLCYIPAVVYFTKWLGKRRNQSPIGQFIAVAAILFQPSLILIDHG 227

Query: 216 HFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYP 275
           HFQ+N VMLGLTV  +NNLLD++YA AAV FV S+ FKQMALYY+P+ F YLLS+S+++P
Sbjct: 228 HFQFNSVMLGLTVYTLNNLLDEFYAFAAVCFVLSICFKQMALYYSPIFFAYLLSKSLFHP 287

Query: 276 RL-NIPRFVAVAVATLIAFGVLYAPLYLL----GNISAIFQSIHRVFPFERGLFEDKVAN 330
           RL NIPRF A++ AT+  F  ++ P+Y      G I+ + QSI R+FPF RG+FEDKVAN
Sbjct: 288 RLFNIPRFAAISFATICTFASMFGPIYFFGGENGGITNLLQSIKRIFPFARGIFEDKVAN 347

Query: 331 FWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFF 390
           FWCVTNV+ KYK  +T  QL+ +SL+LT  A LP++++  LYP+K++L YAL+ACSMSF+
Sbjct: 348 FWCVTNVIFKYKANFTQEQLQLYSLILTIIAFLPAMLVILLYPRKYLLLYALSACSMSFY 407

Query: 391 LFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIM 450
           LF FQVHEK            YTSTD NVLS V+W+NNI LFTLWPLLKKDGLSLQY + 
Sbjct: 408 LFSFQVHEKTILMPLLPITLLYTSTDRNVLSRVSWMNNIGLFTLWPLLKKDGLSLQYWVC 467

Query: 451 FLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXXCVG 510
            +LSNWLIGNFSFITP FLPKVLTPGPS+  + + YRR +LLPSN             +G
Sbjct: 468 LILSNWLIGNFSFITPRFLPKVLTPGPSIIQLGENYRRPTLLPSNWIWKVIIVLSYVMMG 527

Query: 511 AIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
            IH  + +  P    PD+WV+ NC +G   F LFW+WN YK+F+M    I  L
Sbjct: 528 VIHFVDYFIEPPSAYPDLWVILNCTLGFGCFVLFWLWNYYKLFSMTKKNIHQL 580

>ZYRO0C07744g Chr3 (587374..589017) [1644 bp, 547 aa] {ON} highly
           similar to uniprot|Q12001 Saccharomyces cerevisiae
           YOR002W ALG6 Glucosyltransferase involved in transfer of
           oligosaccharides from dolichyl pyrophosphate to
           asparagine residues of proteins during N-linked protein
           glycosylation mutations in human ortholog are associated
           with disease
          Length = 547

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/548 (59%), Positives = 416/548 (75%), Gaps = 3/548 (0%)

Query: 17  PSKEPGQKGIATDAKKPGLKEAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVG 76
           PSK    K +         +E+F+ASPLYDFLYP +PV +QW  +YII++FA+IIR A+G
Sbjct: 2   PSKT--SKKVEKAQADNTAEESFYASPLYDFLYPFKPVGSQWLPEYIIILFAVIIRCAIG 59

Query: 77  LGGYSGMGKPPMFGDFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKL 136
           LG YSG    PM GDFEAQRHW+E+TQH+P+S+WY+  L+YWGLDYPPLTAYHSY+LGKL
Sbjct: 60  LGPYSGQSVKPMHGDFEAQRHWLEITQHLPISQWYYFDLEYWGLDYPPLTAYHSYILGKL 119

Query: 137 GSYISPEWFSLHASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQ 196
           GS I+P+WF+L+ SRG ES DLK+YMR TVILSE+ FYIPAV+YFT+W+GR R  SP+GQ
Sbjct: 120 GSLINPDWFALNVSRGLESNDLKTYMRFTVILSEVIFYIPAVVYFTKWVGRHRGLSPVGQ 179

Query: 197 YIAGAAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMA 256
           +IA AAILFQPAL+LIDHGHFQYNCVMLG TV AIN+L+D++YA AA  FV S+ FKQMA
Sbjct: 180 FIAAAAILFQPALMLIDHGHFQYNCVMLGFTVYAINSLMDEFYAPAAACFVLSICFKQMA 239

Query: 257 LYYAPVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISA-IFQSIHR 315
           LYY+P+ F YLL R ++   +  PRF+++A+AT+  F V+Y PLY++G+ S  + QS+HR
Sbjct: 240 LYYSPIFFAYLLGRCVFKTGIRFPRFLSIAMATIATFLVMYIPLYIMGSGSQNVLQSVHR 299

Query: 316 VFPFERGLFEDKVANFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKK 375
           +FPF RG+FEDKVANFWCVTN+ VKYK  +T  QL+ +SL+ T+   LP++++  LYPKK
Sbjct: 300 IFPFARGIFEDKVANFWCVTNIFVKYKQLFTQQQLQLYSLLATALGFLPAVVLVLLYPKK 359

Query: 376 FMLPYALAACSMSFFLFGFQVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLW 435
            ++P+ALAACSMSFFLF FQVHEK            YTST+W+VLS+V+WINN+ LFTLW
Sbjct: 360 HLVPFALAACSMSFFLFSFQVHEKTILVPLLPITLLYTSTNWDVLSLVSWINNVGLFTLW 419

Query: 436 PLLKKDGLSLQYAIMFLLSNWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSN 495
           PLLKKDGL+LQY + F   NWLIGNFSF+TPTFLPK LTPGPSVS V   YRRRSLLP +
Sbjct: 420 PLLKKDGLALQYCVCFAFCNWLIGNFSFVTPTFLPKFLTPGPSVSSVDSNYRRRSLLPKS 479

Query: 496 XXXXXXXXXXXXCVGAIHIAELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAM 555
                        +GAIH+ +++  P    PD+WV+ NC +G   F LFW+WN YK+F++
Sbjct: 480 IIWKLIIVGSYISMGAIHVLDMFVAPPLNYPDLWVILNCTLGFGCFMLFWLWNYYKLFSL 539

Query: 556 RNSTISDL 563
              ++  L
Sbjct: 540 AGQSLQQL 547

>TPHA0J00350 Chr10 complement(77974..79653) [1680 bp, 559 aa] {ON}
           Anc_6.22 YOR002W
          Length = 559

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/529 (60%), Positives = 402/529 (75%), Gaps = 2/529 (0%)

Query: 37  EAFFASPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQR 96
           E F+ASPLY FL P +  TNQW + YIIV+FALIIR A+GLG YSGM + PMFGDFEAQR
Sbjct: 31  EPFYASPLYTFLSPFKSTTNQWLSVYIIVLFALIIRCAIGLGPYSGMNEAPMFGDFEAQR 90

Query: 97  HWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESE 156
           HWME+TQH+P+S+WYF+ LQYWGLDYPPLTAYHSY+ G +G + +P WF L  SRG E +
Sbjct: 91  HWMEITQHLPISQWYFYDLQYWGLDYPPLTAYHSYICGLIGKFFNPAWFELETSRGMEMK 150

Query: 157 DLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPALILIDHGH 216
           +LK++MRLT I+SE+ FYIPA++YFT W+G++R+QSP+GQYIA AAILFQP L+LIDHGH
Sbjct: 151 ELKTFMRLTAIVSEVIFYIPAIIYFTTWVGKQRKQSPMGQYIAAAAILFQPCLMLIDHGH 210

Query: 217 FQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLSRSIYYPR 276
           FQYN VMLGLTV AINNLLD  YA AA++FV S+ FKQM+LYYAP+ F YLL RS++  +
Sbjct: 211 FQYNSVMLGLTVYAINNLLDDMYAPAAISFVMSICFKQMSLYYAPIFFAYLLGRSLFKKQ 270

Query: 277 -LNIPRFVAVAVATLIAFGVLYAPLYLL-GNISAIFQSIHRVFPFERGLFEDKVANFWCV 334
             N+ RF+ +A+AT+++F  ++APLY+  G    I QS+HR+FPF RG+FEDKVANFWCV
Sbjct: 271 FFNVSRFLNIAIATMVSFFTVFAPLYVFGGGKRNIIQSVHRIFPFARGIFEDKVANFWCV 330

Query: 335 TNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKFMLPYALAACSMSFFLFGF 394
           TNV++KYK  YT  +L+ +SL+LT    LP+++    +PKK +LPY+LAAC+MSFFLF F
Sbjct: 331 TNVIMKYKVNYTQDELQLYSLILTVVGFLPAMVTILWFPKKHLLPYSLAACAMSFFLFSF 390

Query: 395 QVHEKXXXXXXXXXXXXYTSTDWNVLSMVAWINNIALFTLWPLLKKDGLSLQYAIMFLLS 454
           QVHEK            YTSTDWNVLS+V+WINN+ALFTLWPLLKKDG+ LQY + F+LS
Sbjct: 391 QVHEKTILVPLLPITLLYTSTDWNVLSLVSWINNVALFTLWPLLKKDGVVLQYGVCFILS 450

Query: 455 NWLIGNFSFITPTFLPKVLTPGPSVSDVADGYRRRSLLPSNXXXXXXXXXXXXCVGAIHI 514
           NWLIGNFSF TP FLPK+LTPGP + +V   YRRRSLLP+N             + AI  
Sbjct: 451 NWLIGNFSFFTPRFLPKILTPGPPIQNVNTHYRRRSLLPNNIIWKIIIVLSYIVMVAIQG 510

Query: 515 AELWYPPSQRLPDIWVLANCLVGCSSFALFWMWNNYKMFAMRNSTISDL 563
            EL+  P  + PDI+VL NC +G   F  FW+WN YK+F + +  +  L
Sbjct: 511 LELFVEPPPQYPDIFVLLNCTLGFCCFTSFWLWNYYKLFTLTSKNLQYL 559

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score =  120 bits (301), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 123/265 (46%), Gaps = 24/265 (9%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+WM +T  +P+SKWYF     W LDYPP  AY  + L +    I  +   L   
Sbjct: 109 DFDVHRNWMAITNALPISKWYFENTSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 168

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI+SE+C +     Y        R QS    ++  ++I+  P  
Sbjct: 169 EVGQFGWPTVVFQRLTVIISEICLFAVLQYYINTSNLNERTQS----FVVASSIVLSPGF 224

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + + +I     + Y   AV +  +L FK + LY AP  FV+LL 
Sbjct: 225 LIVDHIHFQYNAFLFSILIASIVAAKQKKYIACAVFYTIALCFKHIFLYLAPCYFVFLLR 284

Query: 270 RSI----------YYPRLNI---PRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316
             +          Y   + I    R + +    L  FG+ +AP      I  + Q + R+
Sbjct: 285 AYVLNFKDFKFKSYKDLIFIVQWRRLLKLGSIVLGIFGICFAPF-----IFQMPQVLSRL 339

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVK 340
           FPF RGL     A NFW + + L K
Sbjct: 340 FPFSRGLTHAYWAPNFWAIYSFLDK 364

>Kwal_55.21742 s55 complement(960476..962143) [1668 bp, 555 aa] {ON}
           YOR067C (ALG8) - glycosyl transferase [contig 126] FULL
          Length = 555

 Score =  116 bits (291), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 126/268 (47%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150
           DF+  R+W+ +T  +P+ +WYF     W LDYPP  AY  + L +L   I  +   L   
Sbjct: 44  DFDVHRNWLAITNKLPLKQWYFENTSQWTLDYPPFFAYFEWALSQLVPNIVRQDGCLDIV 103

Query: 151 R-GYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
           + G        + RLTVI SE+  ++   +Y    I +         ++  ++I+  P  
Sbjct: 104 KVGQFGMPTIVFQRLTVIASEILLFVVLQVY----INKSHISERSANFVVASSIVLSPGF 159

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I    +Q Y L  + F  ++ FK + LY AP  FV+LL 
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKEQRYLLCGLFFSIAICFKHIFLYLAPSFFVFLLR 219

Query: 270 RSI----------YYPRLNIPR---FVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316
             +          Y   ++I +      +    L  FGV +AP      IS   Q + R+
Sbjct: 220 VYVLDFSNFHFKSYNDLISIVQWRNLFKLGSVVLCVFGVCFAPF-----ISQWPQLLSRL 274

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + ++L K  T
Sbjct: 275 FPFSRGLTHAYWAPNFWAMYSLLDKVLT 302

>Smik_15.247 Chr15 complement(417710..419443) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 159/373 (42%), Gaps = 73/373 (19%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T  +P+S+WY+     W LDYPP  AY  + L +    +  +   L   
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI SE+  Y    +Y        R QS    ++  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLYAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I    ++ Y L A  +  ++ FK + LY AP  FV+LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLLCAFLYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
             +    LN+  F   +    + F + +A L+ LG+I   IF            Q + R+
Sbjct: 242 AYV----LNVNNFKFKSYKDFL-FLIRWANLFKLGSIVIGIFTICFVPFAHQMPQVLSRL 296

Query: 317 FPFERGLFEDKVA-NFWC--------VTNVLVK------YKTKYTTSQL----------- 350
           FPF RGL     A NFW         +T V++K      + TK+    L           
Sbjct: 297 FPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIPQNIKEINER 356

Query: 351 -------------KFFSLVLTSAAMLPSLIITFLYPKKFMLPY-----------ALAACS 386
                          F ++L       + I+T  Y    +LP            +L  C 
Sbjct: 357 LAANNNGSKGLVQDVFFVILPQIPPKLTFILTLFYQNLAVLPLLFDPSFKRFVGSLTLCG 416

Query: 387 MSFFLFGFQVHEK 399
           ++ FLFG+ VHEK
Sbjct: 417 LASFLFGWHVHEK 429

>Skud_15.234 Chr15 complement(413571..415304) [1734 bp, 577 aa] {ON}
           YOR067C (REAL)
          Length = 577

 Score =  113 bits (283), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 127/268 (47%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T  +P+SKWY+     W LDYPP  AY  + L +    +  +   L   
Sbjct: 66  DFDVHRNWLAITNKLPISKWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI S++  ++   +Y        R QS    ++  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSDILLFVVLQVYINTTDLSERSQS----FVVASSIVLSPGF 181

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
            +IDH HFQYN  +  + + +I     + Y L A+ +  ++ FK + LY AP  FV+LL 
Sbjct: 182 FMIDHIHFQYNGFLFAILIGSIVAAKKKRYILCAILYTTAICFKHIFLYLAPCYFVFLLR 241

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
             +    LN+  F   +    + F + +A L+ LG+I   IF            Q + R+
Sbjct: 242 AYV----LNVNNFKFKSYKDFL-FLIRWANLFKLGSIVIGIFTICFLPFAHQMPQVLSRL 296

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + + + K  T
Sbjct: 297 FPFSRGLTHAYWAPNFWALYSFMDKILT 324

>TPHA0J01380 Chr10 complement(321431..323158) [1728 bp, 575 aa] {ON}
           Anc_5.669 YOR067C
          Length = 575

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 121/267 (45%), Gaps = 22/267 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T ++P+SKWY+     W LDYPP  AY  ++L +    I      L   
Sbjct: 64  DFDVHRNWLAITSNLPISKWYYENTSEWTLDYPPFFAYFEWVLSRFAPEIVKNDGCLDIV 123

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI+SE+  +     Y      + R Q     ++  ++I+  P  
Sbjct: 124 EVGQFGLPTIVFQRLTVIISEILLFAVLQYYINTSNSKERGQC----FVVASSIVLSPGF 179

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I     + Y   AV +  SL FK + LY AP  FV+LL 
Sbjct: 180 LIIDHIHFQYNGFLFAIFIASIVAAKQKKYLACAVFYSISLCFKHIFLYLAPCYFVFLLR 239

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIF------------QSIHRVF 317
             +    LN   F   +   L +         L G +S IF            Q + R+F
Sbjct: 240 AYV----LNFENFKFKSYMDLQSVIQWKRLFKLAGIVSGIFTICFAPFIFQLPQVLSRLF 295

Query: 318 PFERGLFEDKVA-NFWCVTNVLVKYKT 343
           PF RGL     A NFW + + + K  T
Sbjct: 296 PFSRGLTHAYWAPNFWAMYSFIDKVLT 322

>YOR067C Chr15 complement(451729..453462) [1734 bp, 577 aa] {ON}
           ALG8Glucosyl transferase, involved in N-linked
           glycosylation; adds glucose to the dolichol-linked
           oligosaccharide precursor prior to transfer to protein
           during lipid-linked oligosaccharide biosynthesis;
           similar to Alg6p
          Length = 577

 Score =  110 bits (276), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 159/382 (41%), Gaps = 91/382 (23%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150
           DF+  R+W+ +T  +P+S+WY+     W LDYPP  AY  + L +         F   + 
Sbjct: 66  DFDVHRNWLAITNKLPISEWYYEHTSQWTLDYPPFFAYFEWFLSQ---------FVPKSV 116

Query: 151 RGYESEDLKS----------YMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAG 200
           R     D+            + RLTVI SE+  ++   +Y        R QS    ++  
Sbjct: 117 RDDGCLDIVEIGKFGLPTIVFQRLTVIFSEILLFVILQIYINTTKLSERSQS----FVVA 172

Query: 201 AAILFQPALILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYA 260
           ++I+  P  ++IDH HFQYN  +  + + +I    ++ Y L AV +  ++ FK + LY A
Sbjct: 173 SSIVLSPGFLIIDHIHFQYNGFLFAILIGSIVAAKNKRYILCAVLYTTAICFKHIFLYLA 232

Query: 261 PVMFVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGN-ISAIF--------- 310
           P  FV+LL   +    LN+  F   +    + F + +A L  L   +  IF         
Sbjct: 233 PCYFVFLLRAYV----LNVNNFKFKSYKDFL-FLIRWANLLKLATVVVGIFTICFLPFAH 287

Query: 311 ---QSIHRVFPFERGLFEDKVA-NFWC--------VTNVLVK------YKTKYTTSQL-- 350
              Q + R+FPF RGL     A NFW         +T V++K      + TK+    L  
Sbjct: 288 QMPQVLSRLFPFSRGLTHAYWAPNFWALYSFMDKILTTVMLKLPYVHTFATKFIKPPLIP 347

Query: 351 ----------------------KFFSLVLTSAAMLPSLIITFLYPKKFMLPY-------- 380
                                   F ++L       + I+T  Y    +LP         
Sbjct: 348 QNIKEINERLAANNNGSKGLVQDVFFVILPQIPPKLTFILTIFYQVLAVLPLLFDPSFKR 407

Query: 381 ---ALAACSMSFFLFGFQVHEK 399
              +L  C ++ FLFG+ VHEK
Sbjct: 408 FVGSLTLCGLASFLFGWHVHEK 429

>TBLA0A09310 Chr1 (2297508..2299148) [1641 bp, 546 aa] {ON}
           Anc_5.669 YOR067C
          Length = 546

 Score =  110 bits (275), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 123/268 (45%), Gaps = 30/268 (11%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHA- 149
           DF+  R+W+ +T  +P+ +WY+     W LDYPP  AY  + L +       E   L   
Sbjct: 43  DFDVHRNWLAITNKLPLREWYYENTSQWTLDYPPFFAYFEWFLSQFVPKFVKEDGCLDIL 102

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI+SE+  ++   ++        + QS    ++  ++I+  P  
Sbjct: 103 PEGEFGWSTIVFQRLTVIISEILLFVVLQVFINNSGSNEKTQS----FVVASSIILSPGF 158

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  + G+ + +I    ++ Y L  + +  +L FK + LY AP  FV+LL 
Sbjct: 159 LMIDHIHFQYNGFLFGILIASIVAAKNKRYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 218

Query: 270 RSIY---------YPRL-------NIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSI 313
             +          Y  L       N+ +   + V  +   GV + P +   N     Q +
Sbjct: 219 AYVLNFQDFKFKSYKDLILVVQWGNLMKLGGIVVCVM---GVCFGPFWRDMN-----QLL 270

Query: 314 HRVFPFERGLFEDKVA-NFWCVTNVLVK 340
            R+FPF RGL     A NFW + + + K
Sbjct: 271 SRLFPFSRGLTHAYWAPNFWAIYSFVDK 298

>Suva_8.118 Chr8 complement(214797..216527) [1731 bp, 576 aa] {ON}
           YOR067C (REAL)
          Length = 576

 Score =  110 bits (275), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 126/268 (47%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T  +P+S+WY+     W LDYPP  AY  + L +    +  +   L   
Sbjct: 66  DFDVHRNWLAITNKLPMSEWYYEHTSQWTLDYPPFFAYFEWFLSQFVPKVVRDDGCLDIV 125

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI SE+  +    +Y        R QS    ++  ++I+  P  
Sbjct: 126 EVGKFGLPTIVFQRLTVIFSEILLFAVLQIYINTTKLSERSQS----FVVASSIVLSPGF 181

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I    ++ Y   AV +  S+ FK + LY AP  FV+LL 
Sbjct: 182 LMIDHIHFQYNGFLFAILIGSIVAAKNKKYLWCAVLYTTSICFKHIFLYLAPCYFVFLLR 241

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
             +    LN+  F   +    + F + +  L+ LG+I   IF            Q + R+
Sbjct: 242 AYV----LNVNNFKFKSYKDFL-FLIRWTNLFKLGSIVIGIFTICFLPFAHQMPQVLSRL 296

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + + + K  T
Sbjct: 297 FPFSRGLTHAYWAPNFWALYSFMDKILT 324

>KLLA0F16621g Chr6 complement(1531745..1533430) [1686 bp, 561 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 561

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/285 (30%), Positives = 129/285 (45%), Gaps = 23/285 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150
           DF+  R+W+ +T  +P++KWY      W LDYPP  AY  + L +       E   L   
Sbjct: 52  DFDVHRNWLAITNKLPLNKWYVESTSQWTLDYPPFFAYFEWFLSQFVPKSVAEDGCLDIV 111

Query: 151 R-GYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
           + G        + R+TVILSEL  Y    ++    I           ++  ++I+  P L
Sbjct: 112 KVGSFGLPTIIFQRITVILSELVLYAALQVF----INTSDISEKSANFVVASSIVLSPGL 167

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  + G+ + +I    ++ Y L A  F  +L FK + LY AP  FV+LL 
Sbjct: 168 LIVDHIHFQYNGFLFGILISSIVAAKNKRYILCAAFFSIALCFKHIFLYLAPAYFVFLLR 227

Query: 270 RSI----------YYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRVFPF 319
             +          Y   ++I ++  +     +  G+    L  L  I+   Q + R+FPF
Sbjct: 228 AYVLDFSSFKFRSYKDLISIVQWSNLLKLASVVMGIF--SLAFLPFITTWQQLLARLFPF 285

Query: 320 ERGLFEDKVA-NFWCV----TNVLVKYKTKYTTSQLKFFSLVLTS 359
            RGL     A N W V      VL     K    Q K  S+VLTS
Sbjct: 286 SRGLTHAYWAPNVWAVYSFTDKVLTVLVLKLPYLQ-KILSIVLTS 329

>NCAS0G00450 Chr7 (77781..79493) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  108 bits (271), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 120/259 (46%), Gaps = 24/259 (9%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150
           DF+  R+W+ VT  +P+ +WY+     W LDYPP  AY  +++ +    +  +   L   
Sbjct: 56  DFDVHRNWLAVTNKLPLKQWYYEHTSQWTLDYPPFFAYFEWIISQFVPQVVRDDGCLDIV 115

Query: 151 R-GYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G   E    + RL+VI SE+  ++    +      + R QS    +I   +I+  P  
Sbjct: 116 EIGKFGEPTVIFQRLSVITSEILLFVVLQWFINTSNVKERTQS----FIVATSIILSPGF 171

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + + +I     + Y L AV +  +L FK + LY AP  FV+LL 
Sbjct: 172 LIVDHIHFQYNGFLFSILIASIVAAKQKRYILCAVFYTTALCFKHIFLYLAPCYFVFLLR 231

Query: 270 RSI-------YYPRLNIPRFVA------VAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316
             +       +    ++ R V       +A   L   GV + P      I  + Q + R+
Sbjct: 232 AYVLNVKGFQFKSYKDLVRLVQWTNLFRLAGVVLSIVGVCFGPF-----IFDMPQLLTRL 286

Query: 317 FPFERGLFEDKVA-NFWCV 334
           FPF RGL     A NFW +
Sbjct: 287 FPFSRGLTHAYWAPNFWAI 305

>KLTH0F17666g Chr6 complement(1425802..1427469) [1668 bp, 555 aa]
           {ON} highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 555

 Score =  108 bits (269), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 123/270 (45%), Gaps = 24/270 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGK-LGSYISPEWFSLHA 149
           DF+  R+W+ +T  +P+ KWY+     W LDYPP  AY  +LL + +   +  +      
Sbjct: 44  DFDVHRNWLAITNKLPLHKWYYESTSQWTLDYPPFFAYFEWLLSQFVPQRVQDDGCLDIV 103

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
           + G        + R+TVI+SE+  ++   +Y    I +         ++  ++I+  P  
Sbjct: 104 AVGQFGLPTIVFQRVTVIVSEILLFVVLQVY----INKSHISDRSANFVVASSIVLSPGF 159

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I     Q Y L    F  +L FK + LY AP  F +LL 
Sbjct: 160 LIIDHIHFQYNGFLFAILIASIVAAKHQRYLLCGFFFSTALCFKHIFLYLAPSFFAFLLR 219

Query: 270 RSI----------YYPRLNIPR---FVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316
             I          Y   +++ R      +    L  F V +AP      I  + Q + R+
Sbjct: 220 VYILDFSNFRFRTYNDLISMVRWKNLFKLGTVVLSVFAVCFAPF-----IYQLPQLMSRL 274

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKTKY 345
           FPF RGL     A NFW + + L K  T +
Sbjct: 275 FPFSRGLTHAYWAPNFWALYSALDKVLTLF 304

>ADR210C Chr4 complement(1070234..1071952) [1719 bp, 572 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR067C
           (ALG8)
          Length = 572

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 125/269 (46%), Gaps = 26/269 (9%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKL--GSYISPEWFSLH 148
           DFE  R+W+ VT  +P+ KWY      W +DYPPL A+  + L ++  G+        L 
Sbjct: 59  DFEVHRNWLAVTHRLPLRKWYVDATSQWTMDYPPLFAWLEWALSQVVPGAVRRDGCLKLV 118

Query: 149 ASRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPA 208
           A   Y    +  + RLTVI SE+  Y+   +Y +    + R  +    ++   ++   PA
Sbjct: 119 AEGRYGWPTV-VFQRLTVIASEVLLYVVLQVYVSSSAAQERTVN----FVVTTSVALSPA 173

Query: 209 LILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLL 268
            +L+DH HFQYN  +  + V +I    ++ Y L    F  +L  K + LY AP  FV+LL
Sbjct: 174 FLLVDHIHFQYNGFLFAVLVASIVAARERRYVLCGALFTVALCLKHIFLYLAPAYFVFLL 233

Query: 269 SRSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNI-------------SAIFQSIHR 315
              +    L++  F   +   L+ F V +  L  LG +               + Q + R
Sbjct: 234 RAYV----LDLGEFRFRSYRDLV-FAVRWGNLCRLGGVVLAIMAVTFAPFAGVMPQLMAR 288

Query: 316 VFPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           +FPF RGL     A NFW + + + K  T
Sbjct: 289 LFPFSRGLTHAYWAPNFWAIYSFVDKVLT 317

>CAGL0L10450g Chr12 complement(1117959..1119611) [1653 bp, 550 aa]
           {ON} similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067c ALG8 Glucosyltransferase
          Length = 550

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 125/268 (46%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGK-LGSYISPEWFSLHA 149
           DF+  R+W+ +T  +P+ +WY+     W LDYPP  AY  + L + + SY+  +      
Sbjct: 36  DFDVHRNWLAITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIV 95

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI SE+  ++   +Y        R QS    ++  ++I   P  
Sbjct: 96  EVGQFGMPTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQS----FVVASSIAISPGF 151

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I    ++ Y      +  +L FK + LY AP  FV+LL 
Sbjct: 152 LIIDHIHFQYNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLR 211

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
             +    LN+  F   +   LI F V +  L  LG++  A F            Q + R+
Sbjct: 212 AYV----LNLKDFKFKSYRDLI-FIVKWRHLVKLGSVVIATFAVAFGPFIFDLPQLLTRL 266

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + + + K  T
Sbjct: 267 FPFSRGLTHAYWAPNFWAIYSTIDKILT 294

>TDEL0B02540 Chr2 (459825..461534) [1710 bp, 569 aa] {ON} Anc_5.669
           YOR067C
          Length = 569

 Score =  107 bits (267), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 125/268 (46%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHAS 150
           DF+  R+W+ +T  +P+ +WY+ +   W LDYPP  AY  +LL +    I  E  +L   
Sbjct: 55  DFDVHRNWLAITNELPLKEWYYEKTSQWTLDYPPFFAYFEWLLSQFVPKIVKEDGALDIV 114

Query: 151 R-GYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI SE+  ++   ++        + +S    ++  ++I+  P  
Sbjct: 115 EIGQFGWPTVVFQRLTVIFSEVLLFVVLQVFVNTSSATEKTRS----FVVASSIVLSPGF 170

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +    + +I     + Y   A  +  +L FK + LY AP  FV+LL 
Sbjct: 171 LMIDHIHFQYNGFLFAPLIASIVAAKHKKYMWCATFYAIALCFKHIFLYLAPCYFVFLLR 230

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
             +    LN   F   +   LI F V +  L+ + ++   IF            Q + R+
Sbjct: 231 AYV----LNFKNFEFKSYKDLI-FIVQWKHLFKMASVVLGIFFICFGPFLYDLPQVMTRL 285

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + + L K  T
Sbjct: 286 FPFSRGLTHAYWAPNFWAIYSFLDKILT 313

>SAKL0G00836g Chr7 (77387..79072) [1686 bp, 561 aa] {ON} highly
           similar to uniprot|P40351 Saccharomyces cerevisiae
           YOR067C ALG8 adds glucose to the dolichol- linked
           oligosaccharide precursor prior to transfer to protein
           glycosyl transferase
          Length = 561

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 123/268 (45%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T  +P+ +WY      W LDYPP  AY  + L +    I  +   L   
Sbjct: 48  DFDVHRNWLAITNKLPLREWYIEATSQWTLDYPPFFAYFEWFLSQFVPKIVRDDGCLDIV 107

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + R+TVI+SE+  ++   ++    I +         +I  ++I+  P  
Sbjct: 108 EVGNFGMPTIIFQRITVIVSEVLLFVVLQIF----INKSATNEKSANFIVASSIVLSPGF 163

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + + AI       Y L    F  +L FK + LY AP  FV+LL 
Sbjct: 164 LIVDHIHFQYNGFLFAILIAAIVAAKHHRYLLCGAFFATALCFKHIFLYLAPSFFVFLLR 223

Query: 270 RSI----------YYPRLNI---PRFVAVAVATLIAFGVLYAPLYLLGNISAIFQSIHRV 316
             I          Y   ++I    R + + +  L  F V +AP      IS + Q + R+
Sbjct: 224 AYILDFTNFKFKSYKDLVSIVKWQRALKLGLVVLGIFAVCFAPF-----ISEMPQLLERL 278

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + ++L K  T
Sbjct: 279 FPFSRGLTHAYWAPNFWALYSLLDKVLT 306

>NDAI0F00510 Chr6 (118893..120605) [1713 bp, 570 aa] {ON} Anc_5.669
           YOR067C
          Length = 570

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 122/268 (45%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T  +P+ +WY+     W LDYPP  AY  + + +    +  +   L   
Sbjct: 54  DFDVHRNWLAITNKLPLKEWYYEHTSQWTLDYPPFFAYFEWFMSQFVPKVVRDDGCLDIV 113

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + R +VI+SE+  ++    +  +     R QS    +I   +I+  P  
Sbjct: 114 PVGQFGWATVVFQRTSVIISEILLFVVLQWFINKSKDNERTQS----FIVATSIILSPGF 169

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           ++IDH HFQYN  +  + + +I     + Y L  + +  +L FK + LY AP  FV+LL 
Sbjct: 170 LIIDHIHFQYNGFLFAILIASIVAAKQERYLLCGLFYSIALCFKHIFLYLAPCYFVFLLR 229

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
             +    LN+  F   +   LI   + +  L+ LG I  +IF            Q   R+
Sbjct: 230 AYV----LNVKNFKFKSYKDLILL-IQWNNLFKLGGIVLSIFGICFLPFIYHLPQVFTRL 284

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + +   K  T
Sbjct: 285 FPFGRGLTHAYWAPNFWAIYSFTDKIAT 312

>ZYRO0A11506g Chr1 complement(925282..926952) [1671 bp, 556 aa] {ON}
           highly similar to uniprot|P40351 Saccharomyces
           cerevisiae YOR067C ALG8 adds glucose to the dolichol-
           linked oligosaccharide precursor prior to transfer to
           protein glycosyl transferase
          Length = 556

 Score =  104 bits (260), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 124/268 (46%), Gaps = 24/268 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           DF+  R+W+ +T ++P+ +WY+     W LDYPP  AY  + L +       +   L   
Sbjct: 45  DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLEIV 104

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
            +G        + R TVILSE+  ++   ++        R QS    ++  ++I+  PA 
Sbjct: 105 DKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQS----FVIASSIVLSPAF 160

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + + +I       Y   A  +  +L FK + LY AP  FV+LL 
Sbjct: 161 LIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFLLR 220

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNIS-AIF------------QSIHRV 316
                  LN   F   +   LI F V +  L+ LG+I   +F            Q + R+
Sbjct: 221 AYC----LNFQDFKFKSYKDLI-FIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTRL 275

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKT 343
           FPF RGL     A NFW + + L K  T
Sbjct: 276 FPFSRGLTHAYWAPNFWALYSFLDKILT 303

>KAFR0D02440 Chr4 (489816..491543) [1728 bp, 575 aa] {ON} Anc_5.669
           YOR067C
          Length = 575

 Score =  104 bits (259), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 124/270 (45%), Gaps = 24/270 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLG-SYISPEWFSLHA 149
           DF+  R+W+ +T  + +  WY+     W LDYPP  AY  + +  L  S++  +      
Sbjct: 64  DFDVHRNWLAITNGMHLKDWYYEHTSQWTLDYPPFFAYFEWFISHLVPSFVRRDGCLDIV 123

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        + RLTVI SE   ++   +Y        R QS    +I  ++I+  P  
Sbjct: 124 EVGQFGWPTVLFQRLTVIFSESLLFLVLQIYINTSEVEERTQS----FIVASSIVLSPGF 179

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + V +I    ++ Y L A+ +  +L FK + LY AP  FV+LL 
Sbjct: 180 LIVDHIHFQYNGFLFAILVASIVAARNKRYLLCALFYSIALCFKHIFLYLAPCYFVFLLR 239

Query: 270 RSIYYPRLNIPRFVAVAVATLIAFGVLYAPLYLLGNISA----------IF---QSIHRV 316
             +    LN   F   +   LI F + +  L  LG I            IF   Q + R+
Sbjct: 240 VYV----LNFENFKFRSYKDLI-FLIRWKNLCQLGMIVVGVFSLCFGPFIFDMPQLLSRL 294

Query: 317 FPFERGLFEDKVA-NFWCVTNVLVKYKTKY 345
           FPF RGL     A NFW + + L K  T +
Sbjct: 295 FPFSRGLTHAYWAPNFWALYSFLDKVLTVF 324

>Ecym_4051 Chr4 (109310..111124) [1815 bp, 604 aa] {ON} similar to
           Ashbya gossypii ADR210C
          Length = 604

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 112/258 (43%), Gaps = 22/258 (8%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLH-A 149
           D E  R+W+ +T  +P+  WY      W LDYPP  AY  ++L +    +  +   L   
Sbjct: 93  DLEVHRNWLALTNKLPLLDWYREATSQWTLDYPPFFAYFEWVLSQFVPAVVRDDGCLDIV 152

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
             G        ++RLTVI +E+  ++   ++    I    +      +I  ++I   P  
Sbjct: 153 KEGKFGWPTVVFLRLTVIGTEILLFVVLQVF----INTSDESERTVNFIIASSIALSPGF 208

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + + +I     + Y L    F   L FK + LY AP  F +LL 
Sbjct: 209 LIVDHMHFQYNGFLFAILIASIVAAKKERYLLCGAFFTTVLCFKHIFLYLAPAYFTFLLR 268

Query: 270 RSIYYPRLNIPRFVAVAVATLIA----FGVLYAPLYLLGNISAIF--------QSIHRVF 317
             +    LN   F       LI     F +L   + ++  ++  F        Q I R+F
Sbjct: 269 AYV----LNFSNFSFRTYRDLIFVVRWFNLLKLGVIIVSILAVCFVPFIPVLPQLISRLF 324

Query: 318 PFERGLFEDKVA-NFWCV 334
           PF RGL     A NFW V
Sbjct: 325 PFSRGLTHAYWAPNFWAV 342

>KNAG0L01920 Chr12 complement(344454..346160) [1707 bp, 568 aa] {ON}
           Anc_5.669 YOR067C
          Length = 568

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 138/298 (46%), Gaps = 29/298 (9%)

Query: 91  DFEAQRHWMEVTQHIPVSKWYFHQLQYWGLDYPPLTAYHSYLLGK-LGSYISPEWFSLHA 149
           DF+  R+W+ +T  +P+ +WY+ +   W LDYPP  AY  ++L + + + +  +      
Sbjct: 53  DFDVHRNWLAITNALPLREWYYEKTSQWTLDYPPFFAYFEWVLSQFVPAAVRADGCLDIV 112

Query: 150 SRGYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIGQYIAGAAILFQPAL 209
            +G        + R TVI SE+  ++   +Y        + QS    ++  ++I+  P L
Sbjct: 113 PQGVFGALTVLFQRCTVIASEVLLFVVLQVYINTSPPAEKTQS----FVVASSIVLSPML 168

Query: 210 ILIDHGHFQYNCVMLGLTVCAINNLLDQYYALAAVNFVFSLGFKQMALYYAPVMFVYLLS 269
           +++DH HFQYN  +  + + +I     + + L A  +  +L FK + LY AP  F++LL 
Sbjct: 169 LIVDHIHFQYNGFLFAILIASIVAARKRKFLLCAFFYSTALCFKHIFLYLAPCYFMFLLR 228

Query: 270 RSIYYPRLNIPRFVAVA-VATLIAFGVLYAPLYLLGNISAIF---------QSIHRVFPF 319
              Y  +    RF +   +  +I +G L+    ++  ++ +          Q + R+FPF
Sbjct: 229 T--YVLQFEGFRFKSYKDLFRIIHWGRLFKLGGVVLGVAVVCFAPFARDMPQLLSRLFPF 286

Query: 320 ERGLFEDKVA-NFWCVTNVLVKYKTKYTTSQLKFFSLVLTSAAMLPSLIITFLYPKKF 376
            RGL     A NFW + ++  K  T           + L    +   LI+  L PK F
Sbjct: 287 SRGLTHAYWAPNFWALYSLCDKVLT-----------VALLKVPLFHRLILKVLSPKIF 333

>TDEL0A06670 Chr1 complement(1163596..1165473) [1878 bp, 625 aa]
           {ON} Anc_8.723 YOR273C
          Length = 625

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 7/104 (6%)

Query: 97  HWME-VTQHIPVS----KWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASR 151
           HWM  V   +P        +F  + Y+ + YPPL          L  Y++   F L   +
Sbjct: 432 HWMAPVAAGVPFGFGLILIFFSVIIYFSMCYPPLFVASCLAANSLLRYVTSSVFPLFTIQ 491

Query: 152 GYESEDLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIG 195
            YE+  +K    L  ++  +   IP +  F RW G+ RQ+S  G
Sbjct: 492 MYENLKIKWASTLFALICVVMIPIPWI--FERWGGKIRQKSMFG 533

>KNAG0G02830 Chr7 complement(625263..627296) [2034 bp, 677 aa] {ON}
           Anc_8.723 YOR273C
          Length = 677

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 21/159 (13%)

Query: 42  SPLYDFLYPLRPVTNQWAAKYIIVIFALIIRLAVGLGGYSGMGKPPMFGDFEAQRHWME- 100
            P+ + L PL+P       ++++V     + L + L   +   +P +        HWM  
Sbjct: 408 DPVTNELLPLKP------ERFLLVCKVGSVSLPIALFWQAWTARPDV--------HWMAP 453

Query: 101 VTQHIPVS----KWYFHQLQYWGLDYPPLTAYHSYLLGKLGSYISPEWFSLHASRGYESE 156
           +   +P        +F  + Y+   YPPL    +     L  Y++   F L   + YE  
Sbjct: 454 IAAGVPFGFGLILIFFSVIMYFSTCYPPLIVASTLAANNLLRYVTSSVFPLFTIQMYERM 513

Query: 157 DLKSYMRLTVILSELCFYIPAVLYFTRWIGRRRQQSPIG 195
            +K    L  ++  +   IP +  F RW    RQ+S  G
Sbjct: 514 KIKWASTLFALICVVMLPIPWI--FERWGKSMRQKSQFG 550

>ABR166C Chr2 complement(713729..714262) [534 bp, 177 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR118C
           (ILM1)
          Length = 177

 Score = 30.8 bits (68), Expect = 5.4,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 264 FVYLLSRSIYYPRLNIPRFVAVAVATLIAFGVLYAP--LYLLGNISAIFQSI 313
           F+ +L+R++Y P L+IPR  A      + F +L A   L LL N  A F S+
Sbjct: 36  FIIILARAMYLPELHIPRHSAQLGMVSVLFFLLAASDLLPLLENNLAYFDSV 87

>SAKL0C14014g Chr3 (1245903..1246265) [363 bp, 120 aa] {ON} some
           similarities with uniprot|Q7SGN2 Neurospora crassa
           NCU08051 Hypothetical protein NCU08051.1
          Length = 120

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 203 ILFQPALILIDHGHFQYNCVMLGL----TVCAINNLLDQYYALAAVNFVFSLGFK-QMAL 257
           +L    LI + H  F Y+ V LGL    T+C  N  L  Y+ L  +      GF+ +  L
Sbjct: 15  VLNATHLITMQHNRFAYSSVALGLRVTHTLCDSNVFLQLYWDLDELYRALKPGFENEFIL 74

Query: 258 YYAPVMFVYLLSR 270
             AP +  Y+L +
Sbjct: 75  GQAPYIEPYILDK 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,520,485
Number of extensions: 2240416
Number of successful extensions: 5600
Number of sequences better than 10.0: 55
Number of HSP's gapped: 5636
Number of HSP's successfully gapped: 58
Length of query: 563
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 448
Effective length of database: 40,294,809
Effective search space: 18052074432
Effective search space used: 18052074432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)