Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR002CsingletonON1661668821e-123
NCAS0F007607.121ON58765662.6
Suva_5.255singletonON15745643.8
Suva_13.21singletonOFF8941613.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR002C
         (166 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR002C Chr3 complement(359134..359634) [501 bp, 166 aa] {ON} NO...   344   e-123
NCAS0F00760 Chr6 (153333..155096) [1764 bp, 587 aa] {ON} Anc_7.1...    30   2.6  
Suva_5.255 Chr5 complement(410226..410699) [474 bp, 157 aa] {ON}...    29   3.8  
Suva_13.21 Chr13 complement(26016..26078,26082..26087,26091..261...    28   3.9  

>ACR002C Chr3 complement(359134..359634) [501 bp, 166 aa] {ON}
           NOHBY316; No homolog in Saccharomyces cerevisiae
          Length = 166

 Score =  344 bits (882), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/166 (100%), Positives = 166/166 (100%)

Query: 1   MLITILAPHPESCRPPHIEDFRLPLYTYLFRTGRAQTSYHFAELRNLSRKSVGTRYRQPE 60
           MLITILAPHPESCRPPHIEDFRLPLYTYLFRTGRAQTSYHFAELRNLSRKSVGTRYRQPE
Sbjct: 1   MLITILAPHPESCRPPHIEDFRLPLYTYLFRTGRAQTSYHFAELRNLSRKSVGTRYRQPE 60

Query: 61  PYGLAYWCHSTFTSSATEHVAATRLYAGINFRPAVNPPLRYVYKYNDWRRHTEEAVKKGG 120
           PYGLAYWCHSTFTSSATEHVAATRLYAGINFRPAVNPPLRYVYKYNDWRRHTEEAVKKGG
Sbjct: 61  PYGLAYWCHSTFTSSATEHVAATRLYAGINFRPAVNPPLRYVYKYNDWRRHTEEAVKKGG 120

Query: 121 QKILFFVNWGYIIIIIRLLVCVTVRFVKAEEGFFVGRLRFACFTVP 166
           QKILFFVNWGYIIIIIRLLVCVTVRFVKAEEGFFVGRLRFACFTVP
Sbjct: 121 QKILFFVNWGYIIIIIRLLVCVTVRFVKAEEGFFVGRLRFACFTVP 166

>NCAS0F00760 Chr6 (153333..155096) [1764 bp, 587 aa] {ON} Anc_7.121
           YIR016W
          Length = 587

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 16/65 (24%)

Query: 37  TSYH------FAELRNLSRKSVGTRYRQPEPYGLAYWCHSTFTSSATEHVAATRLYAGIN 90
           +S+H      F + RN S  S+GTR R+          +STF ++ + +V A  +  GIN
Sbjct: 287 SSFHPKWSNLFEKKRNSSISSIGTRTRK----------NSTFKNNNSTNVFAEPIGIGIN 336

Query: 91  FRPAV 95
            +P +
Sbjct: 337 IKPVM 341

>Suva_5.255 Chr5 complement(410226..410699) [474 bp, 157 aa] {ON}
           (NOVEL)
          Length = 157

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 3/45 (6%)

Query: 53  GTRYRQPEPYGL--AYWCHSTFTSSATEHVA-ATRLYAGINFRPA 94
           G RYR+P+  G   AY+C +   S++T H   ++ +Y  I+ +P+
Sbjct: 109 GLRYREPDNGGSVGAYYCTTDDRSTSTSHTKLSSIIYGIIDGKPS 153

>Suva_13.21 Chr13
          complement(26016..26078,26082..26087,26091..26126,
          26130..26135,26139..26150,26154..26174,26178..26300)
          [267 bp, 89 aa] {OFF}  YML122C (PSEUDO)
          Length = 89

 Score = 28.1 bits (61), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 4/41 (9%)

Query: 8  PHPESCRPPHIEDFRLPL----YTYLFRTGRAQTSYHFAEL 44
          P P + RPPH    R+P+    + Y F  GR  T   + +L
Sbjct: 17 PGPSNTRPPHRSAARVPILASTWVYFFHVGRKATVNLWPQL 57

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.142    0.465 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,717,825
Number of extensions: 637999
Number of successful extensions: 1439
Number of sequences better than 10.0: 5
Number of HSP's gapped: 1454
Number of HSP's successfully gapped: 5
Length of query: 166
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 65
Effective length of database: 41,900,133
Effective search space: 2723508645
Effective search space used: 2723508645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)