Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACR001C6.26ON34634616890.0
Ecym_30296.26ON3513549211e-123
SAKL0E01408g6.26ON3072277561e-98
Kpol_1037.306.26ON3672667445e-96
KLLA0D01287g6.26ON3452307356e-95
TDEL0G044306.26ON3472397331e-94
Skud_15.1616.26ON2932737132e-92
YOL001W (PHO80)6.26ON2932427028e-91
Smik_15.1696.26ON2912767002e-90
ZYRO0C07634g6.26ON3822377073e-90
Kwal_56.224436.26ON2802306974e-90
KLTH0C11110g6.26ON2802396974e-90
Suva_15.1746.26ON2952396933e-89
CAGL0E02541g6.26ON3422816825e-87
KNAG0I017506.26ON3242496693e-85
TPHA0J003806.26ON3562436505e-82
TBLA0A071606.26ON2682366365e-81
NCAS0D021506.26ON3692195523e-67
NDAI0C026406.26ON4272264921e-57
Smik_9.1407.240ON2851822112e-18
Suva_9.1497.240ON2861852033e-17
YIL050W (PCL7)7.240ON2851562006e-17
Skud_9.1197.240ON2851561989e-17
NCAS0E032207.240ON3411891851e-14
KNAG0D016307.240ON4382071842e-14
CAGL0M12342g7.240ON4571381737e-13
NCAS0A134807.240ON4481541692e-12
Ecym_43367.240ON3851011692e-12
SAKL0F08602g7.240ON4741231692e-12
Kwal_23.58077.240ON4651511682e-12
KLTH0A04268g7.240ON5801101692e-12
ADL075W7.240ON2071371613e-12
KLLA0C08305g7.240ON4091821656e-12
KAFR0L008807.240ON3131401628e-12
KAFR0I018407.240ON3251151583e-11
NDAI0A025607.240ON5031561522e-10
TPHA0C010907.240ON3851491513e-10
KNAG0L014707.240ON3541371399e-09
TDEL0H020207.240ON3631441372e-08
TBLA0D040707.240ON661601382e-08
Kpol_1033.137.240ON250681342e-08
ZYRO0C08118g7.240ON4051461353e-08
Suva_5.1677.240ON424601301e-07
Smik_5.1897.240ON415601292e-07
YER059W (PCL6)7.240ON420731292e-07
Skud_5.1737.240ON420681282e-07
Kpol_2000.147.289ON3101091211e-06
Kpol_1020.87.289ON2961091165e-06
NDAI0E047707.240ON303571157e-06
NCAS0A137707.289ON3121061149e-06
YDL127W (PCL2)7.289ON3081121141e-05
TBLA0C048507.289ON368991131e-05
KNAG0A014903.70ON2621351121e-05
ZYRO0C09284g7.289ON3111021112e-05
CAGL0J09328g7.289ON2971021094e-05
Smik_4.1107.289ON3081121094e-05
CAGL0E02233g3.70ON2661361085e-05
Suva_4.687.289ON3051071077e-05
Suva_14.503.70ON2791061069e-05
TDEL0H015507.289ON3091121061e-04
TPHA0P008107.289ON247981041e-04
Skud_4.797.289ON309981051e-04
Skud_4.1287.289ON3081091042e-04
YDL179W (PCL9)7.289ON3041051032e-04
SAKL0F09856g7.289ON3351011032e-04
Kwal_23.60067.289ON304991023e-04
Suva_4.1187.289ON3091091023e-04
NDAI0A022707.289ON3301141024e-04
Ecym_80387.289ON3141111014e-04
Smik_4.607.289ON3051051005e-04
AFR159C7.289ON308110997e-04
Smik_14.423.70ON279106980.001
Skud_14.483.70ON279106980.001
YNL289W (PCL1)3.70ON279106960.001
TBLA0A078903.70ON361106970.001
TBLA0J006507.289ON36394970.002
KNAG0B029307.289ON312102960.002
KLTH0A05346g7.289ON30199940.003
Kwal_56.241516.236ON480117910.009
ZYRO0C02068g3.70ON330113900.011
TPHA0A005803.70ON289113890.013
Kpol_1020.163.70ON282107880.016
TPHA0A032507.289ON289144860.028
KLLA0E13223g3.70ON282135850.042
KAFR0A082803.70ON241112820.071
TDEL0E007903.70ON25497820.075
CAGL0J06336g7.289ON314152820.11
SAKL0C12100g3.70ON31499810.13
NCAS0A098703.70ON29496810.13
TDEL0E028005.347ON199176790.15
KAFR0C015603.70ON26791790.19
NDAI0A060503.70ON28699780.27
KLLA0F05654g7.289ON31199780.30
KNAG0F018706.236ON48394780.31
NDAI0C019805.347ON226117770.31
ZYRO0B14410g4.333ON57491760.65
NDAI0C043005.347ON240107730.99
AGR140C8.203ON20171721.1
KNAG0A035108.573ON850159741.2
AEL195W3.70ON237108721.5
KAFR0K022805.347ON23191693.1
KLLA0B04906g4.333ON55562703.7
CAGL0J10846g5.347ON229100675.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACR001C
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   655   0.0  
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   359   e-123
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   295   1e-98
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   291   5e-96
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   287   6e-95
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   286   1e-94
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   279   2e-92
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   275   8e-91
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   274   2e-90
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   276   3e-90
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   273   4e-90
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   273   4e-90
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   271   3e-89
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   267   5e-87
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   262   3e-85
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   254   5e-82
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   249   5e-81
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     217   3e-67
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   194   1e-57
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    86   2e-18
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    83   3e-17
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    82   6e-17
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    81   9e-17
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    76   1e-14
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    75   2e-14
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    71   7e-13
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    70   2e-12
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    70   2e-12
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    70   2e-12
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    69   2e-12
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    70   2e-12
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    67   3e-12
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    68   6e-12
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    67   8e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    65   3e-11
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    63   2e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    63   3e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    58   9e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    57   2e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    58   2e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    56   2e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    57   3e-08
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    55   1e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    54   2e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    54   2e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    54   2e-07
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    51   1e-06
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    49   5e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    49   7e-06
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    49   9e-06
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    49   1e-05
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    48   1e-05
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    48   1e-05
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    47   2e-05
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    47   4e-05
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    47   4e-05
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    46   5e-05
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    46   7e-05
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    45   9e-05
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    45   1e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    45   1e-04
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    45   1e-04
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    45   2e-04
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    44   2e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    44   2e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   3e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    44   3e-04
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      44   4e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    44   4e-04
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    43   5e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    43   7e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.001
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    42   0.001
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    42   0.001
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    42   0.001
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    42   0.002
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    42   0.002
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    41   0.003
Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {...    40   0.009
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    39   0.011
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    39   0.013
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    39   0.016
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    38   0.028
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    37   0.042
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    36   0.071
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    36   0.075
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    36   0.11 
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    36   0.13 
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    36   0.13 
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    35   0.15 
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    35   0.19 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    35   0.27 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    35   0.30 
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    35   0.31 
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    34   0.31 
ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]...    34   0.65 
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                33   0.99 
AGR140C Chr7 complement(1013247..1013852) [606 bp, 201 aa] {ON} ...    32   1.1  
KNAG0A03510 Chr1 complement(444243..446795) [2553 bp, 850 aa] {O...    33   1.2  
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    32   1.5  
KAFR0K02280 Chr11 (465010..465705) [696 bp, 231 aa] {ON} Anc_5.3...    31   3.1  
KLLA0B04906g Chr2 (446132..447799) [1668 bp, 555 aa] {ON} highly...    32   3.7  
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    30   5.2  

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/346 (92%), Positives = 320/346 (92%)

Query: 1   MSVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRF 60
           MSVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRF
Sbjct: 1   MSVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRF 60

Query: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTAT 120
           HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTAT
Sbjct: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTAT 120

Query: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER 180
           TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER
Sbjct: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER 180

Query: 181 IFSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNS 240
           IFSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNS
Sbjct: 181 IFSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNS 240

Query: 241 IQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGSECQLASKEESRSLRSAHMDXXXXXX 300
           IQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGSECQLASKEESRSLRSAHMD      
Sbjct: 241 IQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGSECQLASKEESRSLRSAHMDNNSSVN 300

Query: 301 XXXXXXXXRKRNYSDSSINHLGMCTQLILXXXXXXXXXXXXPREIV 346
                   RKRNYSDSSINHLGMCTQLIL            PREIV
Sbjct: 301 NSSPQSFSRKRNYSDSSINHLGMCTQLILSKKHSNSQNSHSPREIV 346

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  359 bits (921), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 200/354 (56%), Positives = 243/354 (68%), Gaps = 20/354 (5%)

Query: 2   SVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFH 61
           +V+  +  ++ V E  LPR+FL CSRT+LVVLISRML+SLI +NDA  + S  ++LTRFH
Sbjct: 9   NVEVENRKAQPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTE-SNTLQLTRFH 67

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATT 121
           SRVPP+ISVY+YLIRLTKYSSLEHCVLLASVYYIDLL++V+PEFRLDSLTVHRFLLTATT
Sbjct: 68  SRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATT 127

Query: 122 VASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERI 181
           VASKGLCDSFCTNTHYAKVGGVQC+ELNVLENEFL RVNYRILPRD+NI+RCS E QE  
Sbjct: 128 VASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGT 187

Query: 182 FSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESP--TN 239
           FS++NIP D +   +   N F VLE YYHRMIHLIG+ + SPDKS +L+FTL E     +
Sbjct: 188 FSFANIPADAEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTLEEPELVID 247

Query: 240 SIQKTLPGGND------FQTAYPGNIDDGSKSCPNITSNNGSECQLASKEESRSLRSAHM 293
            I  TL   ND      +   Y  N D+G         N+     L +K+ + ++  A +
Sbjct: 248 PITFTLNKANDNNNSSYYSNNYSNNTDNGGNIRNINNDNDDKRLTLDTKDRNPAISEADI 307

Query: 294 DXXXXXXXXXXXXXXRKRNYSDSSINHLGMCTQL-ILXXXXXXXXXXXXPREIV 346
                          +KRNYSDS+ N +G+C Q+ I             P EIV
Sbjct: 308 ----------SPQTSKKRNYSDSNPNCIGLCNQIPITKKRSNGQTKHPSPSEIV 351

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  295 bits (756), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 151/227 (66%), Positives = 178/227 (78%), Gaps = 7/227 (3%)

Query: 11  ESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISV 70
           ++ +++ LP +FL CSRT LVVLISRML+SLI MND+   K K +KLTRFHSRVPP ISV
Sbjct: 42  QTSSQIMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMC-KDKNLKLTRFHSRVPPGISV 100

Query: 71  YNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDS 130
           YNYLIRL KYSSLE  VL+A+VYYIDLL++VYP F L+SLTVHRFLLTATTVASKGL DS
Sbjct: 101 YNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLSDS 160

Query: 131 FCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNIPM- 189
           FCTN HYAKVGGVQCSELNVLE EFL+RVNYRI+PRDDNI  C  E Q+ +F     P+ 
Sbjct: 161 FCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVF--ITFPLA 218

Query: 190 DKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAES 236
           DK   ++  NNGF VL+ YY +MI L+G  N SPDK+  +S+ L  S
Sbjct: 219 DK---IKGPNNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPS 262

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  291 bits (744), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 145/266 (54%), Positives = 189/266 (71%), Gaps = 24/266 (9%)

Query: 11  ESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMND----------AQGDKSKPIKLTRF 60
           E++  + LP +F+ CSR+ LV LI+RML+ LI MND           + +    + LTRF
Sbjct: 41  ENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRF 100

Query: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTAT 120
           HSRVPP ISVYNYLIRLTKYSSLEHCVLL++VYYIDLL++VYPEF+++SLTVHRFLLTAT
Sbjct: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTAT 160

Query: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER 180
           T+ASKGLCDSFCTN+HY+KVGGV CSELN+LE EFL RVNYRI+PRDDNI+ C +E Q+ 
Sbjct: 161 TIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQN 220

Query: 181 IFS--YSNIPM-DKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESP 237
            F+  +S++ M         +N+GF +L+ YYH+++ L+G F+ S DKS   ++TL    
Sbjct: 221 KFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTL---- 276

Query: 238 TNSIQKTLPGGNDFQTAYPGNIDDGS 263
                  L  GN+ +     NI + S
Sbjct: 277 -------LLSGNNMEKEVSNNIKENS 295

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  287 bits (735), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 140/230 (60%), Positives = 179/230 (77%), Gaps = 3/230 (1%)

Query: 16  MELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISVYNYLI 75
           + LP ++L CSRT+LVV+ISRML+ LI +NDA    ++ ++LTRFHS+  P+I+VY YLI
Sbjct: 19  IPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNAGNQTMELTRFHSKAAPSITVYQYLI 78

Query: 76  RLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNT 135
           RLTKYSSLEH VLL++VYYIDLL+ VYPEF L+SLTVHRFLLTATT+ASKGLCDSFCTNT
Sbjct: 79  RLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLTATTIASKGLCDSFCTNT 138

Query: 136 HYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNIPMDKDCAL 195
           HY+KVGGVQCSELN+LENEFLERV YRI+PRDDNI  C +E  +++ S   IPM K+ + 
Sbjct: 139 HYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIE--QKLGSNMLIPM-KNASQ 195

Query: 196 QDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNSIQKTL 245
           +  +NGF VL+ YY +++ L+G+   SPDK+    F + +     I  TL
Sbjct: 196 RGPDNGFNVLQNYYRKIVQLVGNPLNSPDKTSTYFFKMVDPMNPGIGGTL 245

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  286 bits (733), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 182/239 (76%), Gaps = 7/239 (2%)

Query: 4   QTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIK---LTRF 60
           ++S E ++ ++ + LPR+F  CSRT L VLISRMLT LI +ND+    SKP     LTRF
Sbjct: 21  ESSKEGTDEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLA-LSKPENARGLTRF 79

Query: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTAT 120
           HSRVPP ISVYNYLIRLTKYSSLEHCVLL +VYYIDLL++VYP F L SLTVHRFLLTAT
Sbjct: 80  HSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTAT 139

Query: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER 180
           TVASKGLCDSFCTNTHYAKVGGV  SELN+LE EFL+RVNYRILPRDDNI  C LE + +
Sbjct: 140 TVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQ 199

Query: 181 IFS-YSNIPMDKDCALQD--RNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAES 236
            F+ Y    M ++   Q+  +N+G+ VL+ Y+ +++ L+G +  SPDKS  +++ L  S
Sbjct: 200 KFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVLRPS 258

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  279 bits (713), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 184/273 (67%), Gaps = 31/273 (11%)

Query: 11  ESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKP---IKLTRFHSRVPPA 67
           + + ++ LP +F  CSRT LVVLISRML SLI +N+    K KP   I LTR+HS+VPP 
Sbjct: 16  QGIPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTK-KPDDQITLTRYHSKVPPN 74

Query: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGL 127
           IS++NY IRLTK+SSLEHCVL+ S+YYIDLL   YP+F L+SLT HRFLLTATTVA+KGL
Sbjct: 75  ISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGL 134

Query: 128 CDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF-SYSN 186
           CDSF TN HYAKVGGV+C ELN+LEN+FL+RVNYRI+PRD NI  CS+E++++ F +  N
Sbjct: 135 CDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKN 194

Query: 187 IP----MDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNSIQ 242
            P    +D    +    +G+ VL+KYY R++ L+G FN SPDKS  + + L         
Sbjct: 195 APGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVL--------- 245

Query: 243 KTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGS 275
                        P NID  ++S P I    G+
Sbjct: 246 -------------PSNIDKDTESGPQIQQQKGT 265

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  275 bits (702), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 176/242 (72%), Gaps = 13/242 (5%)

Query: 5   TSHETSESVTEME------LPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSK--PIK 56
           TS E SE++ E +      LP  F  CSRT LVVLISRML SLI +N+    K     I 
Sbjct: 4   TSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQIT 63

Query: 57  LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFL 116
           LTR+HS++PP IS++NY IRLTK+SSLEHCVL+ S+YYIDLL  VYP+F L+SLT HRFL
Sbjct: 64  LTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFL 123

Query: 117 LTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLE 176
           LTATTVA+KGLCDSF TN HYAKVGGV+C ELN+LEN+FL+RVNYRI+PRD NI  CS+E
Sbjct: 124 LTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIE 183

Query: 177 RQERIF-----SYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSF 231
           ++++ F     +  ++ +D    +    +G+ VL+KYY R++ L+G FN SPDKS  + +
Sbjct: 184 QKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDY 243

Query: 232 TL 233
            L
Sbjct: 244 VL 245

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  274 bits (700), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 140/276 (50%), Positives = 181/276 (65%), Gaps = 30/276 (10%)

Query: 7   HETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDK--SKPIKLTRFHSRV 64
           HE  + + ++ LP  F  CSRT LVVLISRML SLI +N+    K     I LTR+HS++
Sbjct: 13  HE-DQGIQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIPENQITLTRYHSKI 71

Query: 65  PPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVAS 124
           PP IS++NY IRLTK+SSLEHCVL+ S+YYIDLL   YP+F L+SLT HRFLLTATT+A+
Sbjct: 72  PPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIAT 131

Query: 125 KGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF-- 182
           KGLCDSF TN HYAKVGGV+C ELN+LEN+FL+RVNYRI+PRD NI  CS+E++++ F  
Sbjct: 132 KGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVI 191

Query: 183 ---SYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTN 239
              +  +  +D         +G+ VL+KYY R++ L+G FN SPDKS  + + L      
Sbjct: 192 DKNALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVL------ 245

Query: 240 SIQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGS 275
                           P NID  ++S P I    GS
Sbjct: 246 ----------------PSNIDKDNESGPQINEQRGS 265

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  276 bits (707), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 140/237 (59%), Positives = 175/237 (73%), Gaps = 10/237 (4%)

Query: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKS--KPIKLTRFHSRVPPAISV 70
           V  + LP++F  CSRT LV+LISRMLT LI MND+    +      LT+FHS+VPP ISV
Sbjct: 42  VPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTNLTKFHSKVPPGISV 101

Query: 71  YNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDS 130
           YNYL+RLTKYSSL+HCVL+A+VYYIDL+++VYP F L+SLTVHRFLLTATTVASKGLCDS
Sbjct: 102 YNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKGLCDS 161

Query: 131 FCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSN---- 186
           FCTNTHYAKVGGV CSELNVLE E L R+NYRI+PRDDNI  C+LE Q R F        
Sbjct: 162 FCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDTQDGD 221

Query: 187 --IPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAES--PTN 239
              P+  + +    N+G+ VL+ YY++++ L+G    + DKS  +++T A +  PTN
Sbjct: 222 DWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFANTLKPTN 278

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  273 bits (697), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 175/230 (76%), Gaps = 13/230 (5%)

Query: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDA-QGDKSKPIKLTRFHSRVPPAISVY 71
           V E+ LP  F  CSRT LV+LISRML+ L  +ND+   D +K  +LTRFHSRVPP ISVY
Sbjct: 29  VPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPKDDAK--ELTRFHSRVPPQISVY 86

Query: 72  NYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLCDSF 131
           +Y++RLT+YSSLE  VL+ASVYYIDLL+ +YP F L+SLTVHRFLLTATTVASKGLCDSF
Sbjct: 87  DYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSF 146

Query: 132 CTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF---SYSNIP 188
           CTN+HYAKVGGVQCSEL+VLE+EFL++VNYRILPRDDNI  C  E++  +F   +YS   
Sbjct: 147 CTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGLFVTPTYS--- 203

Query: 189 MDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPT 238
             K C  +  NNGF VL+ YY ++I ++G F+ SPDK+    + +  S T
Sbjct: 204 --KSC--RGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVMINSNT 249

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  273 bits (697), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 139/239 (58%), Positives = 174/239 (72%), Gaps = 6/239 (2%)

Query: 1   MSVQTSHETSES-VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTR 59
           ++  T  +T E  V E+ LP  F  C RT LV+LISRML+ LI +ND+   K    +LTR
Sbjct: 16  LTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSI-PKDNSSELTR 74

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTA 119
           FHSRVPP ISVY+YL+RLT+YSSLE  VL+ASVYYIDLL+ +Y  F L+SLTVHRFLLTA
Sbjct: 75  FHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLTA 134

Query: 120 TTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQE 179
           TTV SKGLCDSFCTN+HYAKVGGVQCSEL+VLE+EFL+RVNYRILPRDDNI  C  ER+E
Sbjct: 135 TTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERRE 194

Query: 180 RIFSYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPT 238
            +F  +    +     +  NNGF VL+ YY ++I ++G ++ SPDK+    + +   P 
Sbjct: 195 GLFVTATYAKEN----RGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVMKTPPA 249

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  271 bits (693), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 131/239 (54%), Positives = 175/239 (73%), Gaps = 10/239 (4%)

Query: 8   ETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDK--SKPIKLTRFHSRVP 65
           +  +S+ ++ LP +F  CSRT LVVLISRML SLI +N+    K     I LTR+HS++P
Sbjct: 13  QEDQSIPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPDDQITLTRYHSKIP 72

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASK 125
           P IS++NY IRLTK+SSLEHCVL+ S+YYIDLL   YP+F L+SLT HRFLLTATTVA+K
Sbjct: 73  PNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAK 132

Query: 126 GLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIF--- 182
           GLCDSF TN HY+KVGGV+C ELN+LEN+FL+RVNYRILPRD NI  CS+E++++ F   
Sbjct: 133 GLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVID 192

Query: 183 --SYSNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTN 239
             +  ++ +          +G+ VL+KYY R++ L+G F+ SPDKS  +++ L   P+N
Sbjct: 193 KNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYAL---PSN 248

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  267 bits (682), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 140/281 (49%), Positives = 187/281 (66%), Gaps = 27/281 (9%)

Query: 9   TSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQ-GDKSKPIKLTRFHSRVPPA 67
           T E +  ++LPR FL C +  LV+LI+RML  +I +ND+   +  +   LTRFHS++ P 
Sbjct: 10  TDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIKENERKYGLTRFHSKIAPN 69

Query: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGL 127
           ISV+NY  RLTKYS LEH VLL++VYYIDLL+NVYP F L+SLT HRFLLTATT+ASKGL
Sbjct: 70  ISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATTIASKGL 129

Query: 128 CDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNI 187
           CDSFCTNTHY+KVGGVQC+ELNVLENEFL +VNYRI+PRD+NI  C +E Q+  F     
Sbjct: 130 CDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNFFILPE- 188

Query: 188 PMDKDCALQDR-------NNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLAESPTNS 240
            ++ D A   R       N G+ VL +YY+++I ++G ++ SPDK+  +++ +       
Sbjct: 189 SIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNYDI------- 241

Query: 241 IQKTLPGGNDFQTAYPGNIDDGSKSCPNITSNNGSECQLAS 281
               +P     +T +    +D  K+C    SNN S  Q AS
Sbjct: 242 ---DMPA----KTLHEHQQNDAVKNC----SNNNSNYQTAS 271

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  262 bits (669), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 165/249 (66%), Gaps = 25/249 (10%)

Query: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMND--------------------AQGDKS 52
           +  + LP  F  CSR  L+ LISRML  LI +ND                    A  D S
Sbjct: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80

Query: 53  KPIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTV 112
              KLTRFHS VPP ISVYNYLIRLTKYS+LE  VLL S+YYIDLL++VYP F ++SLTV
Sbjct: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140

Query: 113 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRR 172
           HRFLLTATTVASKGLCDSFCTN HYAKVGGVQ SELN+LE+EFL+++NYR+LPRDDNI  
Sbjct: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200

Query: 173 CSLERQERIFSYSNIP----MDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCN 228
           C  E +   F+  N      + K    Q RN+G+ VL+ YYH++I L+G F+ S DKS  
Sbjct: 201 CKYEHRAHEFTIYNKAALTNVSKPTHTQ-RNSGYNVLQMYYHKIIQLVGKFSSSLDKSKK 259

Query: 229 LSFTLAESP 237
            ++     P
Sbjct: 260 ANYVFENVP 268

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  254 bits (650), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 169/243 (69%), Gaps = 22/243 (9%)

Query: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMND--------------AQGD-----KSK 53
           +  + LP  FL CSR+ LVVLISRMLT LI +ND               Q D      + 
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTENNSAMIPTQTDVNNKNNNN 91

Query: 54  PIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVH 113
            I LTRFHSRVPP ISV NYLIRLTKY+SLEH VLL+S+YYIDLL++VYPEF+++SLTVH
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 114 RFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           RFLL ATTVASKGL DSFCTN+HYAKVGGV+CSELN+LE +FL R+NYRI+PRDDNI+ C
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 174 SLERQERIFSY---SNIPMDKDCALQDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLS 230
            LE++   F+      +  +    L   N+G+ VL  YY +M+ ++G    S DKS  ++
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271

Query: 231 FTL 233
           + +
Sbjct: 272 YII 274

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  249 bits (636), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 125/236 (52%), Positives = 171/236 (72%), Gaps = 15/236 (6%)

Query: 9   TSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQG-------DKSKPIKLTRFH 61
           + E    + L + F+ CS+  L+ LISRML+  I +ND+         ++  P+ LTRFH
Sbjct: 5   SGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFH 64

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATT 121
           S+VPP IS+++YLIRLTKYSSLE  VL+ SVYYIDLL+NVYPEF L+SLTVHR+LLTATT
Sbjct: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATT 124

Query: 122 VASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERI 181
           +ASKGLCDSFCTN+HYAKVGG++C+ELNVLE EFLERV YR++PRD+ I+ C LE     
Sbjct: 125 IASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLE----- 179

Query: 182 FSYSNIP-MDKDCALQD--RNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLA 234
           + YS I  ++ D  + D  +N+G+ VL  YY++M+ L+G+   S +   N+++  +
Sbjct: 180 YKYSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFS 235

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  217 bits (552), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 142/219 (64%), Gaps = 12/219 (5%)

Query: 10  SESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMND-----AQGDKSKPIKLTRFHSRV 64
           +  +  +E+P +++ CSR+ LVVL+SRML  LI  ND     +       + LTRFHSR+
Sbjct: 23  TSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNTSNSSSDSNMHLTRFHSRI 82

Query: 65  PPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVAS 124
           PP IS++NYL RLTKY  +EHCVLL+ +YYIDL T  YP F  +SLT HRFLLTA TVA 
Sbjct: 83  PPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAG 142

Query: 125 KGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSY 184
           KGLCDSFCT   YAK+GGVQ  ELN+LE  FL  VNYRI+PR  N+    LER  ++F+ 
Sbjct: 143 KGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTL 202

Query: 185 SNIPMDKDCALQDR------NNGFGVLEKYYHRMIHLIG 217
            ++ M KD  L         +NG+ VL  YY  ++ + G
Sbjct: 203 DHLDM-KDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG 240

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  194 bits (492), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 143/226 (63%), Gaps = 14/226 (6%)

Query: 6   SHETSESVTEME--------LPRQFLSCSRTYLVVLISRMLTSLIGMNDAQG-DKSKPIK 56
           SH T   +T+ E        LP +F+ C R  LVVLISRML +LI +ND +  D + P  
Sbjct: 39  SHSTPNVITDAENPKHVKITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSN 98

Query: 57  -LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRF 115
             TRFHSRV P IS+ NYL+RLTK+  L+  VLL +VYYIDLL+ V+P F  +SLT HRF
Sbjct: 99  YATRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRF 158

Query: 116 LLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSL 175
           +LTA  VASK LCDS  + THYAK GGVQ +EL +LE  FL+ + YR+LPRD N   CS+
Sbjct: 159 ILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSM 218

Query: 176 ERQERIFSYSNIPMDKDCA----LQDRNNGFGVLEKYYHRMIHLIG 217
           E     F+ ++  + +        Q  ++G+ VL  YY R+I +IG
Sbjct: 219 EYHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 94/182 (51%), Gaps = 27/182 (14%)

Query: 4   QTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIK------- 56
           +T+ E+SE+V  +      +      L++++S +L  +I +NDA  D S+ +        
Sbjct: 90  ETNGESSENVLNI------VDFPTDELIIMVSALLNKIITVNDATTDISQQVPGDTEEKF 143

Query: 57  ---LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVY---PE------ 104
              +  F+ +  P I V  YL R+ KY    + + L+ + Y D ++  Y   PE      
Sbjct: 144 LTPILAFYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSK 203

Query: 105 --FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYR 162
             F +DS  +HR L+T  T+ +K L D F +N+ YAKVGG+   ELN LE +FL   +++
Sbjct: 204 QLFVMDSGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFK 263

Query: 163 IL 164
           +L
Sbjct: 264 LL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 92/185 (49%), Gaps = 27/185 (14%)

Query: 1   MSVQTSHETSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPI----- 55
           M  +TS E  ESV  +      +      L++++S +L  ++  ND   D S+ +     
Sbjct: 88  MEEETSREDGESVLNI------VDFPTDELILMVSALLNKIVKANDETTDPSQQVVEDGE 141

Query: 56  -----KLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVY---PE--- 104
                 +  F+ +  P I+V  YL R+ KY    + + L+ + Y D ++  Y   P+   
Sbjct: 142 DELLAPVLAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNG 201

Query: 105 -----FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERV 159
                F +DS  +HR L+T  T+ +K + D F +N+ YAKVGG+   ELN LE +FL   
Sbjct: 202 HVRQIFVMDSGNIHRLLITGITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLC 261

Query: 160 NYRIL 164
           ++++L
Sbjct: 262 DFKLL 266

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 81.6 bits (200), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 80/156 (51%), Gaps = 21/156 (13%)

Query: 30  LVVLISRMLTSLIGMNDAQGDKSKPIK----------LTRFHSRVPPAISVYNYLIRLTK 79
           L+++IS +L  +I  ND   D S+ +           +  F+ +  P I+V  YL R+ K
Sbjct: 110 LILMISALLNRIITANDETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQK 169

Query: 80  YSSLEHCVLLASVYYIDLLTNVYPE-----------FRLDSLTVHRFLLTATTVASKGLC 128
           Y    + + L+ + Y D ++  Y             F +DS  +HR L+T  T+ +K L 
Sbjct: 170 YCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTKFLS 229

Query: 129 DSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 230 DFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 79/156 (50%), Gaps = 21/156 (13%)

Query: 30  LVVLISRMLTSLIGMNDAQGDKSKPIK----------LTRFHSRVPPAISVYNYLIRLTK 79
           L+ +IS +L  ++  ND   + S+ +           +  F+ +  P ISV  YL R+ K
Sbjct: 110 LIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPILAFYGKSVPEISVVQYLERIQK 169

Query: 80  YSSLEHCVLLASVYYIDLLTNVYPEFR-----------LDSLTVHRFLLTATTVASKGLC 128
           Y    + + L+ + Y D ++  Y  F            +DS  +HR L+T  T+ +K L 
Sbjct: 170 YCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLITGITICTKFLS 229

Query: 129 DSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 230 DFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 83/189 (43%), Gaps = 44/189 (23%)

Query: 30  LVVLISRMLTSLIGMND-------------AQGDKSKPIKLTR----FHSRVPPAISVYN 72
           L+ +IS +L  LI  ND                D S   KL R    F  +  P I +  
Sbjct: 137 LIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHIPPIKLEQ 196

Query: 73  YLIRLTKYSSLEHCVLLASVYYIDLLTNVY---------------------------PEF 105
           Y  R+ KY    + VLLA + Y D ++ V                             +F
Sbjct: 197 YFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYDCKIEDKF 256

Query: 106 RLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILP 165
            LDS  +HR +++A TV++K   D F +N+ YAKVGG+   E+N LE +FL   N+ ++ 
Sbjct: 257 LLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLISNFDLII 316

Query: 166 RDDNIRRCS 174
             + I+R S
Sbjct: 317 SSEEIQRYS 325

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 97/207 (46%), Gaps = 38/207 (18%)

Query: 4   QTSHETSESVTEMELPRQFLSCSRTYLVVL-ISRMLTSLI-----------------GMN 45
           Q +++   +  E   P+++ S S   L +  I +MLT+L+                 G  
Sbjct: 212 QNTNDQPHAPQETNCPKRYESISIATLPIDDILQMLTALLDKIVSSNDELNNGGPPAGCE 271

Query: 46  DAQGDKSKPIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT---NVY 102
           D Q D      +T F+ +  P I++  YL+R+ KY    + + L+ + + D ++   N++
Sbjct: 272 DKQQDHDTINAITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIH 331

Query: 103 PE-----------------FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQC 145
            +                 F +DS  +HR L+   TV++K   D F +N  YA+VGG+  
Sbjct: 332 QQKQQSNVSDSDEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISL 391

Query: 146 SELNVLENEFLERVNYRILPRDDNIRR 172
            E+N LE +FL   ++++L   D ++R
Sbjct: 392 QEMNHLELQFLILCDFKLLIPIDELQR 418

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 71/138 (51%), Gaps = 15/138 (10%)

Query: 50  DKSKPIK-LTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT--------- 99
           DK K +K +  F  +  P I++Y Y  R+ KY    + V L+ + Y D ++         
Sbjct: 294 DKEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSE 353

Query: 100 --NVYPE---FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENE 154
             +  P    F +DS  +HR ++   TV +K   D F +N+ YA+VGG+  SELN LE +
Sbjct: 354 SADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQ 413

Query: 155 FLERVNYRILPRDDNIRR 172
           FL   ++ +L   D ++R
Sbjct: 414 FLVLCDFELLISVDKLQR 431

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 76/154 (49%), Gaps = 17/154 (11%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLL---------------TNVYPE 104
           F  +  P IS++ Y  R+ KY    + V L+ + Y D +               TN    
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           F +DS  +HR ++   TV +K   D F +N+ YA+VGGV   ELN LE +FL   ++ ++
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

Query: 165 PRDDNIRRCSLERQERIFSYSNIPMDKDC-ALQD 197
              + ++R + +   R +S   +P ++D   LQD
Sbjct: 403 IPTEELQRYA-DLLSRFWSTQPLPEEEDTKVLQD 435

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 59/101 (58%), Gaps = 5/101 (4%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTN----VYPE-FRLDSLTVHR 114
           F  +  PAI++ +Y  R+ KY  + + V L+ + Y D +      + P+ F +DS  +HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 115 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEF 155
            ++ A TV++K   D F +N+ YA+VGG+   ELN LE +F
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQF 334

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 10/123 (8%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT---NVYPE-------FRLDS 109
           F  +  PAIS+  Y  R+ KY    + V L+ + Y D +    N+  E       F +DS
Sbjct: 337 FRGKHVPAISLDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDS 396

Query: 110 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDN 169
             +HR ++ A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++   + 
Sbjct: 397 YNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELIISIEE 456

Query: 170 IRR 172
           ++R
Sbjct: 457 LQR 459

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 73/151 (48%), Gaps = 23/151 (15%)

Query: 21  QFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPI--KLTRFHSRVPPAISVYNYLIRLT 78
           QFL+ +RT                 DA  D    I  ++  F  +  PAI++  Y  R+ 
Sbjct: 299 QFLASART----------------EDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQ 342

Query: 79  KYSSLEHCVLLASVYYIDLLTNVYPE-----FRLDSLTVHRFLLTATTVASKGLCDSFCT 133
           KY    + V L+ + Y D +           F +DS  +HR +++A TV++K   D F +
Sbjct: 343 KYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYS 402

Query: 134 NTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 403 NSRYARVGGISLKELNHLELQFLVLCDFELI 433

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 63/110 (57%), Gaps = 5/110 (4%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT---NVYPE--FRLDSLTVHR 114
           F  +  PAI+++ Y  R+ KY    + V L+ + Y D +    N   E  F +DS  +HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 115 FLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
            +++A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 68/137 (49%), Gaps = 18/137 (13%)

Query: 37  MLTSLIGMNDAQGDKSKPIKLTR-------------FHSRVPPAISVYNYLIRLTKYSSL 83
           MLT L+       D+ KP    +             F  +  P I++ +Y  R+ KY  +
Sbjct: 29  MLTGLLYKIIKSNDRLKPFDQEKHDINNKYVAHVLSFRGKHIPTITLGDYFARIQKYCPI 88

Query: 84  EHCVLLASVYYIDLLTN----VYPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYA 138
            + V L+ + Y D +      + P+ F +DS  +HR ++ A TV++K   D F +N+ YA
Sbjct: 89  TNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYA 148

Query: 139 KVGGVQCSELNVLENEF 155
           +VGG+   ELN LE +F
Sbjct: 149 RVGGISLEELNRLELQF 165

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 86/182 (47%), Gaps = 39/182 (21%)

Query: 30  LVVLISRMLTSLIGMNDAQGD-------KSKPIKLTR----FHSRVPPAISVYNYLIRLT 78
           L+ +++ +LT +I  ND+ G        + K I L R    F  +  P I++  Y  R+ 
Sbjct: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258

Query: 79  KYSSLEHCVLLASVYYID---------------------------LLTNVYPE-FRLDSL 110
           KY    + VLL+ + + D                           L     P+ F +DS 
Sbjct: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318

Query: 111 TVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNI 170
            +HR ++ A TV++K + D F +N+ YA+VGG+   ELN LE +FL   ++R++   + +
Sbjct: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLIISVEEL 378

Query: 171 RR 172
           +R
Sbjct: 379 QR 380

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 23/140 (16%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNV-----------YPE-FRL 107
           F  +  P I++  Y  R+ KY    + V L+ + Y D + N             P+ F +
Sbjct: 175 FKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVM 234

Query: 108 DSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRD 167
           DS  +HR ++   TV++K L D F +N+ YAKVGG+   ELN LE +FL   ++ +L   
Sbjct: 235 DSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL--- 291

Query: 168 DNIRRCSLERQERIFSYSNI 187
                 S+E  ER   Y+N+
Sbjct: 292 -----ISIEEYER---YANL 303

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 61/115 (53%), Gaps = 10/115 (8%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLL-----TNVYPE-----FRLDS 109
           FH +  P I++  Y  R+ KY    + V L  +   D +     T+ +       F +DS
Sbjct: 181 FHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFVMDS 240

Query: 110 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
             +HRF++   TV +K L D F +N+ YAKVGG+   E+N LE +FL   +++++
Sbjct: 241 YNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 29/156 (18%)

Query: 30  LVVLISRMLTSLIGMNDAQGDKSKPI---------------KLTRFHSRVPPAISVYNYL 74
           L  L+ +++ S   +N +Q   S P                 +  F  +  P I+++ Y 
Sbjct: 307 LTALLDKIVKSNDKLNTSQSPTSPPPLNSNSENNNKNAYYNSILAFKGKHVPQITLHQYF 366

Query: 75  IRLTKYSSLEHCVLLASVYYIDLLT---NVYPE-----------FRLDSLTVHRFLLTAT 120
            R+ KY    + V L+ + Y D ++   N  P            F +DS  +HR ++   
Sbjct: 367 QRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMFVMDSYNIHRLIIAGI 426

Query: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFL 156
           TV +K   D F +N+ YA+VGG+   ELN LE +FL
Sbjct: 427 TVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFL 462

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 36/149 (24%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTN------------------- 100
           F  +  P IS+  Y  R+ KY  + + V L+ + Y D ++                    
Sbjct: 208 FRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADE 267

Query: 101 ----------------VYPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGV 143
                           V P+ F +DS  +HR ++TA TV++K   D F +N+ YA+VGG+
Sbjct: 268 SQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGI 327

Query: 144 QCSELNVLENEFLERVNYRILPRDDNIRR 172
              ELN LE +FL   +++++   + ++R
Sbjct: 328 SLQELNHLELQFLILCDFQLMISVEELQR 356

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 24/137 (17%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT---NVYPE------------ 104
           F  +  P I++  Y  R+ KY    + V L+ + Y D ++   N  P             
Sbjct: 211 FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTL 270

Query: 105 -FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRI 163
            F ++S  +HR ++    V++K   D F +N  YAKVGG+   E+N LE +FL   ++ +
Sbjct: 271 LFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSL 330

Query: 164 LPRDDNIRRCSLERQER 180
           L         S+E  ER
Sbjct: 331 L--------ISVEEMER 339

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 63/144 (43%), Gaps = 31/144 (21%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTN------------------- 100
           F  +  P IS+ +Y  R+ KY    + V L+ + Y D ++                    
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 101 ------------VYPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSEL 148
                           F +DS  +HR L+   TV++K   D F +N+ YA+VGG+   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 149 NVLENEFLERVNYRILPRDDNIRR 172
           N LE +FL   ++ +L   + ++R
Sbjct: 316 NHLELQFLVLCDFELLISVNELQR 339

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%)

Query: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           F +DS  +HR ++   TVA+K   D F +N  YAKVGG+   ELN LE +FL   ++++L
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLLLCDFKLL 637

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%)

Query: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           F +DS  +HR ++   TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

Query: 165 PRDDNIRR 172
              + ++R
Sbjct: 223 ISVEELQR 230

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 63/146 (43%), Gaps = 41/146 (28%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLT-------------------- 99
           F  +  P IS+ +Y  R+ KY    + V L+ + Y D ++                    
Sbjct: 234 FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAG 293

Query: 100 -------NVYPE--------------FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYA 138
                  NV  +              F +DS  +HR ++  TTV++K   D F +N+ YA
Sbjct: 294 NNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYA 353

Query: 139 KVGGVQCSELNVLENEFLERVNYRIL 164
           +VGG+   ELN LE +FL   ++ +L
Sbjct: 354 RVGGISLQELNYLELQFLILCDFELL 379

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 101 VYPE-FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERV 159
            +P+ F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   
Sbjct: 325 AHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLC 384

Query: 160 NYRILPRDDNIRR 172
           ++ +L   + ++R
Sbjct: 385 DFELLISVNELQR 397

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 43/68 (63%)

Query: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           F +DS  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

Query: 165 PRDDNIRR 172
              + ++R
Sbjct: 390 ISVNELQR 397

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 60/109 (55%), Gaps = 5/109 (4%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVASKG 126
           S++ ++  L K+S+++   L+AS  Y+  L ++ P   + ++S T HR  L    +A+K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 127 LCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           L DS   N H+ K   G +  +++N +E E L  +N+  + + +++  C
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC 151

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 5/109 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           P   +  ++  L   S+++   L+A+  Y+  L N+ P   + ++S T HR  L    +A
Sbjct: 45  PPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILA 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNI 170
           SK L DS   N H+A+   G +Q  E+N +E E LE  ++ I    D++
Sbjct: 104 SKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTDDL 152

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 107 LDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRI 163
           ++S TVHR +L   TV+SK L D   +N  YA+  G+   ELN LE +FL   N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 72  NYLIRLTKYSSLEHCVLLASVYYIDLLTNVYP--EFRLDSLTVHRFLLTATTVASKGLCD 129
           N++  L K+S+++   L+A+  Y+  L ++ P   + +++ T HR  L    +A+K L D
Sbjct: 52  NFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKTLND 110

Query: 130 SFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           S   N H+A+   G +Q  E+N +E E LE  ++ +  +  ++  C
Sbjct: 111 SSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 60/112 (53%), Gaps = 5/112 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA  +  ++ RL K+S+++   L+A+  Y+  L ++ P   + +++ T HR  L    +A
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           +K L DS   N H+A+   G +   E+N +E E LE  ++ +    D++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTA 119
           S +PP   +Y ++  L  +S+++   L+ +V Y+  L  + P   + +++ T HR  L  
Sbjct: 48  SNIPP---LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIET-TRHRMFLGC 103

Query: 120 TTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFL 156
             +A+K L DS   N H+AK   G +Q  E+N +E E L
Sbjct: 104 LIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREIL 142

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 66/135 (48%), Gaps = 3/135 (2%)

Query: 30  LVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLL 89
           ++  ++R+   ++    AQ   S P   T    + P   S+  ++ +L +Y+++    LL
Sbjct: 20  MIQYLTRVTLKVLPNTPAQQYPSPPSSPTELSGKEPRLPSLRTFITKLVRYTNVYTPTLL 79

Query: 90  ASVYYIDLLTNVYP-EFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCS 146
            +V Y++ L  + P + +    T+HR  L    +++K   DS   N H+AK   G     
Sbjct: 80  TTVCYLNKLKRILPKDAKGLPSTIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLE 139

Query: 147 ELNVLENEFLERVNY 161
           ++N++E + L  +N+
Sbjct: 140 DINLMERQLLNLLNW 154

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 5/102 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA  +  ++  L  YS+++   L+A+  Y+  L ++ P   F +++ T HR  L    +A
Sbjct: 43  PAPPLMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGCLILA 101

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           +K L DS   N H+A    G +   E+N +E E LE  ++ +
Sbjct: 102 AKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNV 143

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 56/102 (54%), Gaps = 5/102 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA  +  ++ +L KYS+++   L+A+  ++  L ++ P   + +++ T HR  L    ++
Sbjct: 45  PAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIET-TRHRIFLGCLILS 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           +K L DS   N H+A+   G +   E+N +E E LE  ++ +
Sbjct: 104 AKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 60/112 (53%), Gaps = 5/112 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA  +  ++ RL K+S+++   L+A+  Y+  L ++ P   + +++ T HR  L    +A
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIET-TRHRIFLGCLILA 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           +K L DS   N H+A+   G +   E+N +E E LE  ++ +    +++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 69/136 (50%), Gaps = 25/136 (18%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLLTATTVAS 124
           S+  ++ RL +Y+++    LLA+V Y++ L  + P+   D+     T+HR  L    ++S
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPK---DATGLPSTIHRLFLACLILSS 110

Query: 125 KGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI---------------LPRD 167
           K   DS   N H+A+   G     ++N++E + L+ +N+ I                P  
Sbjct: 111 KCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDLILDLRPLLEPIK 170

Query: 168 DNIRRCSLERQERIFS 183
           ++++R  L+R+ RI+S
Sbjct: 171 EDLQRSYLQRK-RIYS 185

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 58/107 (54%), Gaps = 7/107 (6%)

Query: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLT 118
           H   PP +S++  + ++   S+++   L+A+  Y++ L ++ P+  + +++ T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 119 ATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
              +A+K L DS   N H+     G ++  E+N +E E LE  N+ +
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 57/106 (53%), Gaps = 12/106 (11%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLL 117
           +R+P   S+  ++ RL +Y+++    LL +V Y++ L  + P+   D+     T+HR  L
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPK---DATGLPSTIHRIFL 103

Query: 118 TATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNY 161
               +++K   DS   N H+AK   G     ++N++E + L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA S+ N++  L  +S+++   L+A+  Y+  L ++ P   + +++ T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           +K L DS   N H+A    G +   E+N +E E LE  ++ +     ++  C
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTV-HRFLLTATTVASKGL 127
           S+ +++  + KYS ++   L+AS  +++ L  + P +     T  HR  L    +ASK L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 128 CDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
            DS   N H+ K   G +   E+N +E E LE +++ +
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 54/98 (55%), Gaps = 5/98 (5%)

Query: 70  VYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVASKGL 127
           ++ ++ ++   S+++   L+A+  Y++ L N+ P   + +++ T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 128 CDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
            DS   N H++    G ++  E+N +E E LE  N+ +
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA  +  ++  L K+S+++   L+A+  Y+  L ++ P   + +++ T HR  L    +A
Sbjct: 45  PAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNI 170
           +K L DS   N H+A+   G +   E+N +E E LE  ++ +    D++
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDL 152

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 11/105 (10%)

Query: 65  PPAISVY--NYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTAT 120
           PP +S++  N +I+    S+++   L+A+  Y++ L +V P+  + +++ T HR  L   
Sbjct: 46  PPDLSIFIKNVVIQ----SNVQTPTLMATSVYLNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 121 TVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
            +A+K L DS   N H+     G ++  E+N +E E LE +N+ +
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 57/101 (56%), Gaps = 5/101 (4%)

Query: 67  AISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVAS 124
            +S+ +++  L  +S+++   L+++V Y+  L ++ P   + +++ T HR  L    +A+
Sbjct: 41  VVSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAA 99

Query: 125 KGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           K L DS   N H+++   G +   E+N +E E LE  ++++
Sbjct: 100 KNLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVHRFLLTATTVASKG 126
           +S+ N++  L   S+++   L+++  Y+  L ++ P   L    T HR  L    +A+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 127 LCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           L DS   N H+A    G +   E+N +E E LE  ++ +
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNL 143

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVA 123
           PA  +  ++ RL K+S+++   L+A+  Y+  L ++ P   + +++ T HR  L    +A
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNI 170
           +K L DS   N H+A+   G +   E+N +E E L   ++ +    D++
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDL 152

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 8/114 (7%)

Query: 64  VPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATT 121
           +PP   + N++  L  +S+++   L+A+  Y+  L  + P+  + +++ T HR  L    
Sbjct: 50  IPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCLI 105

Query: 122 VASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
           +A+K L DS   N H+ K   G +   E+N +E E LE   + +      + +C
Sbjct: 106 LAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNVTITTSELIKC 159

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 66  PAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYP-EFRLDSLTVHRFLLTATTVAS 124
           P +S+ +++  L   S+++   L+++V Y+  L ++ P        T HR  L    +AS
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 125 KGLCDSFCTNTHYAKVGGVQCS--ELNVLENEFLERVNYRILPRDDNIRRC 173
           K L DS   N H+ +      S  E+N +E E LE  N+ +L  + ++  C
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 56/105 (53%), Gaps = 11/105 (10%)

Query: 65  PPAISVY--NYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTAT 120
           PP +S +  N +I+    S+++   L+A+  Y++ L N+ P   + +++ T HR  L   
Sbjct: 47  PPDLSTFIKNVVIQ----SNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCL 101

Query: 121 TVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
            +A+K L DS   N H+     G ++  E+N +E E LE  N+ +
Sbjct: 102 ILAAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTVASK 125
           +S+ +++  L K S+++   L+++V Y+  L ++ P   + +++ + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 126 GLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRC 173
            L DS   N H+ +   G +   E+N +E E LE  N+ +   + ++  C
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 12/106 (11%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLL 117
           +R+P   S+  ++ RL +Y+++    LL +  Y++ L  + P+   D+     T+HR  L
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPK---DATGLPSTIHRIFL 103

Query: 118 TATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNY 161
               +++K   DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 12/106 (11%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLL 117
           +R+P   S+  ++ RL +Y+++    LL +  Y++ L  + P+   D+     T+HR  L
Sbjct: 50  ARLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPK---DATGLPSTIHRIFL 103

Query: 118 TATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNY 161
               +++K   DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 55/106 (51%), Gaps = 12/106 (11%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLL 117
           +R+P   S+  ++ RL +Y+++    LL +  Y++ L  + P    D+     T+HR  L
Sbjct: 50  TRLP---SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPR---DATGLPSTIHRIFL 103

Query: 118 TATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNY 161
               +++K   DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 104 ACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 55/106 (51%), Gaps = 9/106 (8%)

Query: 64  VPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLLTA 119
           +P   S+  ++ R+ +Y++++   LL +V Y++ L  + P    D++    T+HR  L  
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPA---DAVGIPSTIHRLFLAC 111

Query: 120 TTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
             +++K   DS   N H+A    G     ++N++E + L  +++ +
Sbjct: 112 LILSAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 73  YLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVHRFLLTATTVASKGLCDSF 131
           ++ RL  +S+++   L++++ Y+  L  + P   +    T HR  +    +A+K L DS 
Sbjct: 50  FIKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSS 109

Query: 132 CTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
             N H+ +   G  +  E+N +E E LE  N+ +
Sbjct: 110 PLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 65  PPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVHRFLLTATTVA 123
           PP  ++  ++  L   S +    L+AS  Y+  L ++ P   +    T HR  L    +A
Sbjct: 44  PPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCLIIA 103

Query: 124 SKGLCDSFCTNTHYAKVGG--VQCSELNVLENEFLERVNYRI 163
           +K L D+   N H++K     +   E+N++E E L  + +R+
Sbjct: 104 AKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE-FRLDSLTVHRFLLTATTVASKG 126
           +S+ +++  L   S+++   L+++  Y+  L ++ P        T HR  L    +A+K 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 127 LCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           L DS   N H+A    G +   E+N +E E LE  ++ +
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNL 141

>Kwal_56.24151 s56 complement(874353..875795) [1443 bp, 480 aa] {ON}
           YPL219W (PCL8) - cyclin (Pho85p) [contig 165] FULL
          Length = 480

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 6/117 (5%)

Query: 54  PIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLL------TNVYPEFRL 107
           P +L  F+    P ++   YL RL    S    V L + + +  L        +  ++ L
Sbjct: 342 PPQLATFNMDSTPTLAYEEYLQRLHCKFSFAPIVYLTAAHLLQSLFLTRKDNKLCCKYHL 401

Query: 108 DSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           D+  VHR ++ +  +A+K L D   ++T ++++ G+    L  LE  FL  +N+  L
Sbjct: 402 DNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFEGL 458

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 62/113 (54%), Gaps = 8/113 (7%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFR--LDSLTVHRFLLTA 119
           S++P   S+ +++ RL +++++    LL +  Y++ L  + P+    L S T+HR  L  
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLAC 138

Query: 120 TTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNI 170
             +++K   DS   N H+AK   G     ++N++E + ++ +N+ +   +D++
Sbjct: 139 LILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDL 191

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFR--LDSLTVHRFLLTA 119
           S++P   S+  ++ +L +Y+++    LL +  Y+  L  + P+    L S T+HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPKDANGLPS-TIHRIFLAC 108

Query: 120 TTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNI 170
             +++K   DS   N H+A+   G     ++N++E + L  +N+ I  +++++
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 53/107 (49%), Gaps = 12/107 (11%)

Query: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFL 116
             R+P   S+  ++ +L +Y+++    LL +  Y+  L  + P+   D+     T+HR  
Sbjct: 49  QQRLP---SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPK---DATGLPSTIHRMF 102

Query: 117 LTATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNY 161
           L    +++K   DS   N H+A+   G     ++N++E + L  +N+
Sbjct: 103 LACLIISAKYHNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 66/144 (45%), Gaps = 19/144 (13%)

Query: 65  PPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPE--FRLDSLTVHRFLLTATTV 122
           PP ++   ++  +   S+++   L+A+   ++ L  + P   + ++S T HR  L    +
Sbjct: 46  PPPLA--KFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLIL 102

Query: 123 ASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQER 180
           ++K L DS   N H+AK     +   E+N +E E L   ++ +          S+ ++E 
Sbjct: 103 SAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV----------SISQEEL 152

Query: 181 I--FSYSNIPMDKDCALQDRNNGF 202
               SY   P+ +D  ++ R N  
Sbjct: 153 FSSLSYFLEPIKQDMMMKQRQNSL 176

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 64/135 (47%), Gaps = 14/135 (10%)

Query: 61  HSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVHRFLLTA 119
           H+ VP   S+  ++ RL +Y+++    LL +V Y++ L  + P        T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 120 TTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLER 177
             +++K   DS   N H+ K   G     ++N++E + L+   +       ++R  S E 
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW-------DLRVESEEL 162

Query: 178 QERIFSYSNIPMDKD 192
            + ++  +N P+ +D
Sbjct: 163 WDNLYDLAN-PIRRD 176

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 53/112 (47%), Gaps = 13/112 (11%)

Query: 65  PPAISVYN----------YLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVH 113
           PP+  +Y+          ++ +L +Y+ +    LL ++ Y++ L  + P+       T+H
Sbjct: 41  PPSSPLYDEEDELPTLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLH 100

Query: 114 RFLLTATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           R  L    +++K   DS   N H+ K   G     ++N++E   L+ +N+ +
Sbjct: 101 RIFLACLIISAKNHNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFR--LDSLTVHRFLLTATTVASKG 126
           S+ +++ RL +++++    LL +  Y++ L  + P+    L S TVHR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 127 LCDSFCTNTHYAKVGG--VQCSELNVLENEFLERVNY 161
             DS   N H+AK         ++N++E + ++ +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 70/152 (46%), Gaps = 17/152 (11%)

Query: 15  EMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISVYNYL 74
           E E+  +FL  + TY       MLT LI   ++       IK+ + +S  P  +S++  +
Sbjct: 14  EYEILVRFLKRNVTY------EMLTFLISKTNSM------IKIKKTNSPKPVELSLF--V 59

Query: 75  IRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVHRFLLTATTVASKGLCDSFCT 133
             L   S ++   L+A+  Y+D L+ + P        T HR  L    ++SK L DS   
Sbjct: 60  EELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRMFLGCLILSSKSLDDSSLF 119

Query: 134 NTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           N H+ K   G +   E+N +E E L   N+ I
Sbjct: 120 NKHWTKYCNGLLTLKEVNSIERELLSYFNWDI 151

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLLTATTVAS 124
           S+  ++ +L +Y+++    LL +V Y+  L  + P    D+     T HR  L    +++
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPR---DATGLPSTTHRIFLACLILSA 111

Query: 125 KGLCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNY 161
           K   DS   N H+++   G     ++N++E + L+ +++
Sbjct: 112 KFHNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW 150

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 49/96 (51%), Gaps = 12/96 (12%)

Query: 63  RVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRFLLT 118
           R+P   S+  ++ RL +Y+++    LL +V Y++ L  + P+   D+     T+HR  L 
Sbjct: 51  RLP---SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPK---DATGLPSTIHRIFLA 104

Query: 119 ATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLE 152
              +++K   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 78/176 (44%), Gaps = 25/176 (14%)

Query: 19  PRQFLSC-------SRTYLVVLISRMLTSLIGMNDAQGDKSKPIKLTRFHSRVPPAISVY 71
           PR+ LSC       S   L+V I+R+L            +++ I   +  + V       
Sbjct: 20  PRRKLSCPPTPISSSSEQLIVRITRVLCQ----------RTEKISTDKIRNDVKNVNEFL 69

Query: 72  NYLIRLTKYSSLEHCVLLA---SVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGLC 128
             ++R +K +     V LA    +Y   L     P+F   +    R  L+   +A K L 
Sbjct: 70  KEVLRRSKSNRKTALVALAYFNKIYDGQLWNGKLPDF---ARCSKRIFLSCLILAHKYLN 126

Query: 129 DSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRC--SLERQERIF 182
           D+  T   +  + G+  ++L ++E   LE+++YR+L  ++++ +   SL  ++R F
Sbjct: 127 DNSFTMKTWNMISGLSQNDLCLMERWGLEKLDYRLLVAEEDLTKLEDSLATKKRTF 182

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 65  PPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYP-EFRLDSLTVHRFLLTATTVA 123
           P   S+  ++ RL +Y+++    LL +V Y++ L  + P + +    T+HR  L    ++
Sbjct: 55  PRLPSLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLIIS 114

Query: 124 SKGLCDSFCTNTHYAKV--GGVQCSELNVLE 152
           +K   DS   N H+ +   G     ++N++E
Sbjct: 115 AKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 12/99 (12%)

Query: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSL----TVHRF 115
           +  R+P   S+  ++  L +Y+++    LL +V Y++ L  + P+   D+     T+HR 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPK---DATGLPSTIHRI 101

Query: 116 LLTATTVASKGLCDSFCTNTHYAKV--GGVQCSELNVLE 152
            L    +++K   DS   N H+ K   G     ++N++E
Sbjct: 102 FLACLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 68  ISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLD-SLTVHRFLLTATTVASKG 126
           +S+ +++  L ++S+++   L+A+  Y+  L ++ P        T HR  +    +A+K 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 127 LCDSFCTNTHYAKV--GGVQCSELNVLENEFLERVNYRI 163
           L DS   N H+     G     ++N +E E L   ++ +
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 58  TRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLL--------TNVYPEFRLDS 109
           +RF  +  P++S  +++ R+      +  V L++ Y + +L         ++  +F+L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 110 LTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGV 143
             +HR ++    +++K L D   ++ +++KV GV
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 16/117 (13%)

Query: 69  SVYNYLIRLTKYS-SLEHCVLLASVYYIDLLTNVY------PEFRLDSLTVH---RFLLT 118
           S+  YL+ + K S S  + V++AS Y+  L  +V       PEF      VH   R  L+
Sbjct: 87  SIKTYLMEILKRSQSSRNNVIVASFYFQKLYNSVQLNQDPNPEF------VHCSKRIFLS 140

Query: 119 ATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSL 175
              ++ K L D   +   ++ + G+   +L++LE   L R+NY ++     I + S 
Sbjct: 141 CLILSHKFLNDKTFSMKAWSLISGISKRDLSILERWCLMRLNYHLVVDVTEINKWSF 197

>ZYRO0B14410g Chr2 complement(1170689..1172413) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|Q04636 Saccharomyces
           cerevisiae YML069W POB3 facilitates RNA Polymerase II
           transcription elongation
          Length = 574

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 13/91 (14%)

Query: 111 TVHRFLLTAT---TVASKGLCDSF-----CTNTHYAKVGGVQCSELNVLENEFLERVNYR 162
           T   FLL AT   TV     C  F       N    ++ G    + N+++N+F  R N +
Sbjct: 41  TKQPFLLPATELSTVQWSRGCRGFELKVNTKNQGVVQLDGFAPDDFNLIKNDFHRRFNVQ 100

Query: 163 ILPRDDNIR-----RCSLERQERIFSYSNIP 188
           + P++ ++R     +  L R E +F+ +  P
Sbjct: 101 VEPKEHSLRGWNWGKADLARNEMVFALNGRP 131

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 32.7 bits (73), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 11/107 (10%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLASVYYIDLL--------TNVYPEFRLDSLTVHRFLLTAT 120
           S+ +++  +TK S  +  +LL + YY   L         +  PEF   +    R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 121 TVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRD 167
            +A K L DS  +   ++ + G+    L+ +E   L +++Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>AGR140C Chr7 complement(1013247..1013852) [606 bp, 201 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR078C
           (SHU2)
          Length = 201

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 133 TNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERIFSYSNIPMDK- 191
           TN +Y+K+     +E NVL NE +    Y++ PRD  +R  SL     +F Y  +P  K 
Sbjct: 4   TNFNYSKLLRNLVTEDNVL-NEVVVSFLYQLFPRDLFVRAFSLLESADMFIYVWMPTPKE 62

Query: 192 -DCALQDRNNG 201
            D  L+   NG
Sbjct: 63  ADELLESLYNG 73

>KNAG0A03510 Chr1 complement(444243..446795) [2553 bp, 850 aa] {ON}
           Anc_8.573 YBR179C
          Length = 850

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 63/159 (39%), Gaps = 35/159 (22%)

Query: 106 RLDSLTVHRFLLTATTVASKGLCDSF------------CTNTHYAKVGGVQCSELNVLEN 153
           R+D  +   F+           C+S             CTN        V C  L   EN
Sbjct: 174 RVDDTSSKVFITGDVNTGKSSFCNSLLQRNLLPEDQLPCTN--------VFCEVLEAREN 225

Query: 154 EFLERVNYRILPRDDNIRRCSLERQER-IFSYSNIPMDKDCALQDRNNGFGVLEKYYHRM 212
             +E V+  ++    N+R C+L+   R   +Y   P++K   L  +N  + +L+ Y    
Sbjct: 226 NDVEEVHAILMAPGSNVRDCALKYDIRNKTTYDTEPLEKLPELVFQNKKYSLLKVY---- 281

Query: 213 IHLIGDFNMSPDKSC----NLSFTLAESP---TNSIQKT 244
              I D  M P+KS      +  +L +SP    +SIQ T
Sbjct: 282 ---IRDDKMEPEKSLLRNGTVDISLIDSPGLNMDSIQTT 317

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 9/108 (8%)

Query: 69  SVYNYLIRLTKYSSLEHCVLLA-SVYYIDLLTNVYPEFRLDSLTVHRFLLTATTVASKGL 127
           S++ ++ RL +Y+++    LL  +VY   L   +  +      T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 128 CDSFCTNTHYAKV--GGVQCSELNVLENEFLE------RVNYRILPRD 167
            DS   N H+ K   G     ++N++E + L       RV +R L RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>KAFR0K02280 Chr11 (465010..465705) [696 bp, 231 aa] {ON} Anc_5.347
           YHR071W
          Length = 231

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 77  LTKYSSLEHCVLLASVYYIDLL---TNVYPEFRLDSLTVHRFLLTATTVASKGLCDSFCT 133
           L +  S +H  +LAS Y+  L    +   PEF   +    R  L    +A K   D   +
Sbjct: 97  LKRSKSNKHVAVLASFYFQKLHGLNSKDIPEF---AKCPKRIFLVCLILAHKFSNDVTFS 153

Query: 134 NTHYAKVGGVQCSELNVLENEFLERVNYRIL 164
           N  ++ + G++  +L+V+E   L ++NY + 
Sbjct: 154 NKSWSLISGLKSKDLSVMERFCLNQLNYDLF 184

>KLLA0B04906g Chr2 (446132..447799) [1668 bp, 555 aa] {ON} highly
           similar to uniprot|Q04636 Saccharomyces cerevisiae
           YML069W POB3 facilitates RNA Polymerase II transcription
           elongation
          Length = 555

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 132 CTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIR-----RCSLERQERIFSYSN 186
             N    ++ G Q  + N+L+N+F  R N ++  R+ ++R     +  L R E +FS + 
Sbjct: 70  TKNKGLIQMDGFQQEDFNLLKNDFQRRFNMQLEHREHSLRGWNWGKLDLARNEMVFSLNG 129

Query: 187 IP 188
            P
Sbjct: 130 KP 131

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 11/100 (11%)

Query: 69  SVYNYLIRLTKYSSLEH-CVLLASVYYIDLL------TNVYPEFRLDSLTVHRFLLTATT 121
           S+ N+L  +TK + +    +LLAS+Y+  L+       NV PEF   +    R LL    
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINV-PEF---AYCGKRLLLVCII 127

Query: 122 VASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNY 161
           +A K   D   +   + +V G+    + ++E   L+++NY
Sbjct: 128 LAHKFSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNY 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,689,504
Number of extensions: 1438295
Number of successful extensions: 3725
Number of sequences better than 10.0: 112
Number of HSP's gapped: 3776
Number of HSP's successfully gapped: 112
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)