Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL169W5.438ON1031035391e-72
KLLA0E02267g5.438ON1031033793e-48
SAKL0G02618g5.438ON1041043761e-47
Ecym_45095.438ON1031033716e-47
Kwal_55.214145.438ON1191033501e-43
KNAG0C048805.438ON1041043473e-43
NCAS0F034105.438ON1061043455e-43
CAGL0A02882g5.438ON1041033333e-41
KLTH0F15972g5.438ON1031033152e-38
TDEL0D026305.438ON1021043108e-38
ZYRO0F10120g5.438ON1051012926e-35
Kpol_1016.35.438ON971022916e-35
NDAI0B057005.438ON1041052734e-32
Kpol_1016.3asingletonON971022473e-28
TPHA0C00950singletonON991022014e-21
KAFR0D02490singletonON107941762e-17
TBLA0C05870singletonON1001011728e-17
KAFR0D02400singletonON114901338e-11
KAFR0D02500singletonON112901198e-09
SAKL0C03784g1.125ON64954623.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL169W
         (103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   212   1e-72
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   150   3e-48
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   149   1e-47
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   147   6e-47
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   139   1e-43
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   138   3e-43
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     137   5e-43
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   132   3e-41
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   125   2e-38
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   124   8e-38
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   117   6e-35
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   116   6e-35
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   109   4e-32
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   100   3e-28
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                 82   4e-21
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      72   2e-17
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    71   8e-17
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                56   8e-11
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      50   8e-09
SAKL0C03784g Chr3 (357131..359080) [1950 bp, 649 aa] {ON} simila...    28   3.0  

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  212 bits (539), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 103/103 (100%), Positives = 103/103 (100%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
           MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60

Query: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
           LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ
Sbjct: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  150 bits (379), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 86/103 (83%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
           MVEW  I+YDKPG DRS  R +HLA IP LVE GK+V AGAIYK+VVDG+P+ FAGS LT
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVDGKPANFAGSHLT 60

Query: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
           +VADS++E + ++++D FAK+ +WDV+N ++YPFGCAVRKEKQ
Sbjct: 61  IVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEKQ 103

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  149 bits (376), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 86/104 (82%), Gaps = 1/104 (0%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVV-DGRPSQFAGSQL 59
           MVEWC ++YDKP  DRS  R  HLA IP LVEQGKLV AGAI+ E+  +G+P  FAGSQL
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
           T+VADS+EEAL ++++D FAK G+WD+EN++++PFGCAVRKEK+
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEKK 104

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  147 bits (371), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 85/103 (82%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
           MVEWC  +YDKPG DRS +R  HL  IP+LV++GK+V AGAIYK++VDG+P  FAGS L 
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVDGKPGGFAGSHLI 60

Query: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
           LVAD+REE + +++ D +AK GVWD++N++++PFGCAVRKEKQ
Sbjct: 61  LVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEKQ 103

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 83/103 (80%), Gaps = 1/103 (0%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVV-DGRPSQFAGSQL 59
           MVEWC I+YDK G DRS+ R  HL  IPKLVE+GKLV AGAIY++V  +G+ S FAGS L
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102
            +VAD++EEAL I++ D FAK G+WD+EN+++YPFGCAVR+ K
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPK 118

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  138 bits (347), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (75%), Gaps = 1/104 (0%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKE-VVDGRPSQFAGSQL 59
           MVEWCA++YDKPG DRS  R EHLA IPKLV+QGKLV AGAIY E    G    FAGS L
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
            +VAD++EEAL +I  D FAK G+WD+ N++LY FGCAVR+ K+
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPKK 104

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  137 bits (345), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 79/104 (75%), Gaps = 1/104 (0%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEV-VDGRPSQFAGSQL 59
           MVEWC I+YDKPG DRS  R +HLA IP LVEQGKLV AGAIY E   +G    FAGS L
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
            ++AD++EEALAI+ +D FAK G+WD +N+++Y FGCAVR+ K 
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  132 bits (333), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVD-GRPSQFAGSQL 59
           MVEWC I+YDKPG DRS  R +HLA IP LVE GKLV AGAIY E    G    FAGS L
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102
            +VAD++EEAL ++ +D FAK+G+WD+EN+++Y FGCAVR+ K
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  125 bits (315), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEV-VDGRPSQFAGSQL 59
           MVEWC I++DK G DRS  R  HL  + +  E+G LV AGAIY EV  DG+P+ FAGS L
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102
            + A+++E+AL ++++D FAK G+WD+EN+++YPFGCAVR+ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  124 bits (310), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 63/104 (60%), Positives = 76/104 (73%), Gaps = 3/104 (2%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKE-VVDGRPSQFAGSQL 59
           MVEW  I+YDK   DRS  R  HLA IP LVEQGKLV AGAIY E    G    FAGS L
Sbjct: 1   MVEWVVIVYDKG--DRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
            +VAD++EEAL +++ D FAK GVWD++N+++Y FGCAVRKEK+
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEKK 102

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  117 bits (292), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 3/101 (2%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEV-VDGRPSQFAGSQL 59
           MVEW  I +DK   DRS +R EHLA IP  VE GKLV AGAIY E    G P  FAGS L
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRK 100
            +VAD++EEA+ I++ D FAK GVWD++N+++Y FGCA+R+
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  116 bits (291), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 75/102 (73%), Gaps = 5/102 (4%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
           MVEWC II DK G DRS  R +HLA IP LVEQGKL  AGAIY +  DG    FAGS L 
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND--DG---SFAGSHLQ 55

Query: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102
           +VAD++E+AL +++ D FA  G+WD++++++Y FGCAVR+ K
Sbjct: 56  IVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  109 bits (273), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVD--GRPSQFAGSQ 58
           MVEWC II DK G DRS    +H A IP LVEQGK+V  GAIY E  +  G P+  AGS 
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPT-VAGSH 59

Query: 59  LTLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEKQ 103
           L +VAD++EE + +++ D FAK G+WDV+N ++Y F  A+R  K+
Sbjct: 60  LQVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPKK 104

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score = 99.8 bits (247), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 67/102 (65%), Gaps = 5/102 (4%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
           M EWC II DK G +RS    +H A I  LVEQG L   GAIY +  DG     AGS L 
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND--DG---SVAGSHLQ 55

Query: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102
           +VAD++E+AL +++ D FA  G+WD++++V+Y F CAVR+ K
Sbjct: 56  IVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score = 82.0 bits (201), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (60%), Gaps = 7/102 (6%)

Query: 1   MVEWCAIIYDKPGVD--RSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQ 58
           M E+  +I D  G +  R  H  EH   IP LV+ G +V  GA++ E  +G P    GS 
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNE--EGSP---VGSH 55

Query: 59  LTLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRK 100
           + +VADSRE+ L +++ D FA+  VWD+E+ ++Y F CAVRK
Sbjct: 56  IQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRK 97

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 72.4 bits (176), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 5/94 (5%)

Query: 1  MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
          M EW   + DKP  DR+ +   HLA +P L E+  LV AGA+      G   +  GS   
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALI-----GDNGKEVGSSFQ 55

Query: 61 LVADSREEALAIIRDDPFAKHGVWDVENVVLYPF 94
          +VA+S+E+A+ +I++D FAK GV+++++ V Y F
Sbjct: 56 VVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 70.9 bits (172), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 5/101 (4%)

Query: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
           M EW   I D P  DR+   +EH+  +P L+  G L   GA+  +          GS   
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDD-----NGNMIGSHFE 55

Query: 61  LVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKE 101
           L  +++EEA+ +I +DPF K GVWD+ ++ +  F C  R+E
Sbjct: 56  LKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREE 96

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 55.8 bits (133), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 51/90 (56%), Gaps = 5/90 (5%)

Query: 1  MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
          M EW   + D   VDR+ +  EH+ ++P LV+ G +V AGA+          +  G    
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALTTP-----EGKEIGGMFI 55

Query: 61 LVADSREEALAIIRDDPFAKHGVWDVENVV 90
          + A ++EEA+ I++ D FA+ G++++++V 
Sbjct: 56 VTAKTKEEAIEIVKRDVFARKGIFNMDSVT 85

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 50.4 bits (119), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 50/90 (55%), Gaps = 5/90 (5%)

Query: 1  MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVDGRPSQFAGSQLT 60
          M EW   I D  G DR+ +  EH+  +  L ++  LV AGA+     +G+ +   G  L 
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGALT--TPEGKET---GGILI 55

Query: 61 LVADSREEALAIIRDDPFAKHGVWDVENVV 90
          + A ++EEA+ +++ D FA+ G++ ++ + 
Sbjct: 56 IAAKTKEEAIEVVKRDVFARKGIFKMDTIT 85

>SAKL0C03784g Chr3 (357131..359080) [1950 bp, 649 aa] {ON} similar
           to uniprot|P07252 Saccharomyces cerevisiae YJL209W CBP1
           Protein required for COB mRNA stability or 5' processing
           required for translation of COB mRNAs
          Length = 649

 Score = 28.5 bits (62), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 6/54 (11%)

Query: 36  LVQAGAIYKEVVD---GRPSQFAGSQLTLVADSREEALAIIRDDPFAKHGVWDV 86
           L     +  ++VD   GRPS+   + + L+A   ++A    R DP  KH +W V
Sbjct: 445 LPSVATVVNKIVDNQRGRPSESNKASMKLLATLLDKAH---RADPLHKHSLWGV 495

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,296,507
Number of extensions: 337098
Number of successful extensions: 640
Number of sequences better than 10.0: 21
Number of HSP's gapped: 622
Number of HSP's successfully gapped: 21
Length of query: 103
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 29
Effective length of database: 44,996,115
Effective search space: 1304887335
Effective search space used: 1304887335
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)