Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL168C5.439ON1261266577e-90
Ecym_45105.439ON1261266082e-82
SAKL0G02640g5.439ON1261265841e-78
NDAI0C015805.439ON1261265803e-78
KAFR0D050405.439ON1261265794e-78
TDEL0D026205.439ON1261265779e-78
CAGL0I01078g5.439ON1261265761e-77
Smik_15.2995.439ON1261265752e-77
YOR122C (PFY1)5.439ON1261265752e-77
KLLA0E02289g5.439ON1261265752e-77
Skud_15.2845.439ON1261265734e-77
KNAG0B042205.439ON1261265701e-76
Suva_8.1745.439ON1261265682e-76
Kpol_1062.275.439ON1261265641e-75
NCAS0H020705.439ON1261265622e-75
KLTH0F15950g5.439ON1261265562e-74
TPHA0E017405.439ON1261265404e-72
ZYRO0F10142g5.439ON1261265162e-68
TBLA0A065005.439ON1191265032e-66
Kwal_55.214135.439ON58582733e-32
KAFR0L012307.293ON10646750.034
KLLA0F05555g7.293ON10443690.28
Smik_13.2112.604ON35170700.36
Smik_4.1077.293ON10646670.55
Skud_4.1257.293ON10549670.58
YMR041C (ARA2)2.604ON33571680.84
YDL130W (RPP1B)7.293ON10646650.89
KNAG0B029007.293ON10643651.0
ZYRO0C09372g7.293ON10443651.1
AFR163C7.293ON10544641.5
Ecym_80427.293ON17948641.9
Suva_4.1157.293ON10646622.7
Kpol_2000.127.293ON10545613.8
Skud_13.41singletonOFF108545634.2
Skud_13.428.813ON79345624.5
NDAI0A030007.293ON10646604.6
KLTH0A05434g7.293ON10624597.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL168C
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   257   7e-90
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   238   2e-82
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   229   1e-78
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   228   3e-78
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   227   4e-78
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   226   9e-78
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   226   1e-77
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   226   2e-77
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   226   2e-77
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   226   2e-77
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   225   4e-77
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   224   1e-76
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   223   2e-76
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   221   1e-75
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   221   2e-75
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   218   2e-74
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   212   4e-72
ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   203   2e-68
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   198   2e-66
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   109   3e-32
KAFR0L01230 Chr12 complement(229891..230097,230300..230413) [321...    33   0.034
KLLA0F05555g Chr6 (544997..545311) [315 bp, 104 aa] {ON} highly ...    31   0.28 
Smik_13.211 Chr13 complement(344952..346007) [1056 bp, 351 aa] {...    32   0.36 
Smik_4.107 Chr4 (206552..206665,206992..207198) [321 bp, 106 aa]...    30   0.55 
Skud_4.125 Chr4 (225488..225601,225946..226149) [318 bp, 105 aa]...    30   0.58 
YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON} ...    31   0.84 
YDL130W Chr4 (229906..230019,230321..230527) [321 bp, 106 aa] {O...    30   0.89 
KNAG0B02900 Chr2 (558241..558354,558724..558930) [321 bp, 106 aa...    30   1.0  
ZYRO0C09372g Chr3 complement(711868..712182) [315 bp, 104 aa] {O...    30   1.1  
AFR163C Chr6 complement(729720..729923,729979..730092) [318 bp, ...    29   1.5  
Ecym_8042 Chr8 complement(96293..96499,96603..96935) [540 bp, 17...    29   1.9  
Suva_4.115 Chr4 (218351..218464,218818..219024) [321 bp, 106 aa]...    28   2.7  
Kpol_2000.12 s2000 (20300..20413,20697..20900) [318 bp, 105 aa] ...    28   3.8  
Skud_13.41 Chr13 (70099..70149,70153..70194,70198..70413,70417.....    29   4.2  
Skud_13.42 Chr13 (71021..73402) [2382 bp, 793 aa] {ON} YMR261C (...    28   4.5  
NDAI0A03000 Chr1 (671588..671701,672195..672401) [321 bp, 106 aa...    28   4.6  
KLTH0A05434g Chr1 complement(451664..451870,452033..452146) [321...    27   7.3  

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  257 bits (657), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  238 bits (608), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 113/126 (89%), Positives = 121/126 (96%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNL+ATGKVDKA IYSRAGDTIWASSGG++LE +EI EISQGFDNA GLQ+NG
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFMLLRAD+RSIYGRHEAEG++AVRTKQTILIAHYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  229 bits (584), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLL TGKVDKA IYSRAGD IWA+SGGL L+P+EI EI+QGFDN  GLQ+NG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQ QKFML+RAD+RSIYGRH+AEGVV VRTKQTILIAHYP GVQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  228 bits (580), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLATGKVDKA IYSRAGD++WA+SGG  L+ +EI EI QGFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQT+L+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  227 bits (579), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 107/126 (84%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLAT KVD+A IYSRAGD  WA+SGG+AL+P+EI EI+QGFDNAAGLQ+NG
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  226 bits (577), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 108/126 (85%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLL TGKVDKA IYSRAGD+IWASSGGL L+ +EI+EI+QGFD+  GLQ+NG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQTILIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  226 bits (576), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLATGKVDKA IYS+AGD +WA+SGGL+L+ +EI EI QGFDN  GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQT+LIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNL+ TGKVDKA IYSRAGD +WA+SGGL+L+P+EI EI QGFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNL+ TGKVDKA IYSRAGD +WA+SGGL+L+P+EI EI QGFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  226 bits (575), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLATGK+DK+ IYSRAGD +WASSGGL L+P+EI EI++GFDN +GLQ+NG
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML++AD+RSIYGRHEAEG+V VRTKQTILI HYP GVQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  225 bits (573), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNL+ TGKVDKA IYSRAGD IWA+SGGL+L+P+EI E+ QGFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGV+ VRTKQT++I+HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  224 bits (570), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 114/126 (90%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLL TGKVDKA IYSRAGD++WA+SGGL L+P+EI  I  GFDN AGLQ+NG
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFM LRAD+RSIYGRH+AEGV+ VRTKQTIL+AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 103/126 (81%), Positives = 115/126 (91%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNL+ TGKVDKA I+SRAGD IWA+SGGL+L+P+EI EI QGFDN  GLQ+NG
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGV+ VRTKQT++IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  221 bits (564), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 104/126 (82%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLATGK+DKA +YSRAGD +WASSGGLAL  +EI  I+QGFD+ + LQ+NG
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFM+LRAD+RSIYGRH+AEGVV VRTKQTIL+AHYPA VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISVQY
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  221 bits (562), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 117/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQA TDNLLATGKVD+A +YSRAGD++WA+SGGL L+P+EI EI++GFDN AGLQ+NG
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFMLLRAD++SIYGRH+AEG+V VRT QTILIAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV+Y
Sbjct: 121 LISVKY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  218 bits (556), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 116/126 (92%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLL TGK+DKA IYSRAGD++WA+SGGL+L  +EI EI+QGF+N +GLQ+ G
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+QGQKFML+RAD+RSIYGRH+AEGV+ VRTKQTIL+ HYPAGVQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LISV Y
Sbjct: 121 LISVSY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  212 bits (540), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYTDNLLATGKVDKA +YSRAGD  WA+SGGL+L   E  EI++GFD+ +GLQ  G
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LHIQGQKFMLLRAD+RSIYGRH+AEGVV VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI VQY
Sbjct: 121 LIGVQY 126

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  203 bits (516), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 107/126 (84%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQAYT+NLL TGK+DKA IYSRAGD++WASSGGL   P EI +I+ GFD  +GLQ+ G
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           L +QGQKFMLLRAD+RSIY RH+AEG+  VRTKQTI++AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LISVQY 126
           LI  QY
Sbjct: 121 LIGAQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  198 bits (503), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (85%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60
           MSWQA       TGKVDKA IYSRAGD++WASSGGL L  +EI EI++GFDN +GLQ+NG
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120
           LH+Q QKFMLLRAD+RSIYGRH+AEG+V VRTKQTI+IAHYP  VQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LISVQY 126
           LI VQY
Sbjct: 114 LIGVQY 119

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  109 bits (273), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 55/58 (94%)

Query: 69  MLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADYLISVQY 126
           ML+RAD+RSIYGRH+AEGVV VRTKQTIL+ HYPAGVQAGEATKIVEQLADYLISV Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

>KAFR0L01230 Chr12 complement(229891..230097,230300..230413) [321
          bp, 106 aa] {ON} Anc_7.293 YDL130W
          Length = 106

 Score = 33.5 bits (75), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 8  DNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNA 53
          DNLLA  K   A++     D +WA     ALE  ++KEI  GF NA
Sbjct: 23 DNLLAVTKAAGASV-----DNVWADVYAKALEGKDLKEILSGFHNA 63

>KLLA0F05555g Chr6 (544997..545311) [315 bp, 104 aa] {ON} highly
          similar to uniprot|P10622 Saccharomyces cerevisiae
          YDL130W RPP1B Ribosomal protein P1 beta a component of
          the ribosomal stalk which is involved in the
          interaction between translational elongation factors
          and the ribosome accumulation of P1 in the cytoplasm is
          regulated by phosphorylation and interaction with the
          P2 stalk component
          Length = 104

 Score = 31.2 bits (69), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 8  DNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGF 50
          DNLL   K   A+I     D +WA +   ALE  +IKEI  GF
Sbjct: 23 DNLLTLTKAAGASI-----DNVWAETFAKALEGKDIKEILSGF 60

>Smik_13.211 Chr13 complement(344952..346007) [1056 bp, 351 aa] {ON}
           YMR041C (REAL)
          Length = 351

 Score = 31.6 bits (70), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%)

Query: 16  VDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANGLHIQGQKFMLLRADE 75
           VD A + +R   + W   G + L  S +KE+    DN   +++NG  +  +   L+   +
Sbjct: 267 VDLADLATRYAVSEWMGKGPVVLGVSSMKELKLALDNYKNVESNGNKLSPRDKKLVDFIQ 326

Query: 76  RSIYGRHEAE 85
           ++I+  H  E
Sbjct: 327 KNIFKGHFNE 336

>Smik_4.107 Chr4 (206552..206665,206992..207198) [321 bp, 106 aa]
          {ON} YDL130W (REAL)
          Length = 106

 Score = 30.4 bits (67), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 7  TDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDN 52
          +DNLL   K   A I     D +WA     ALE  ++KEI  GF N
Sbjct: 22 SDNLLTITKAAGANI-----DNVWADVYAKALEGKDLKEILSGFHN 62

>Skud_4.125 Chr4 (225488..225601,225946..226149) [318 bp, 105 aa]
          {ON} YDL130W (REAL)
          Length = 105

 Score = 30.4 bits (67), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 4  QAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDN 52
          +  +DNLLA  K   A +     D +WA     ALE  ++K+I  GF N
Sbjct: 19 EVTSDNLLAITKAAGANV-----DNVWADVYAKALEGKDLKQILSGFHN 62

>YMR041C Chr13 complement(350966..351973) [1008 bp, 335 aa] {ON}
           ARA2NAD-dependent arabinose dehydrogenase, involved in
           biosynthesis of dehydro-D-arabinono-1,4-lactone; similar
           to plant L-galactose dehydrogenase
          Length = 335

 Score = 30.8 bits (68), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 34/71 (47%)

Query: 15  KVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANGLHIQGQKFMLLRAD 74
            VD A + +R   + W   G + L  S ++E+    DN   +++NG  +  +   L+   
Sbjct: 253 NVDLADLATRYAISEWVGKGPVVLGVSSMEELKLALDNYEIVKSNGNRLSSKDGQLVEYI 312

Query: 75  ERSIYGRHEAE 85
           +++I+  H  E
Sbjct: 313 QKNIFKEHFNE 323

>YDL130W Chr4 (229906..230019,230321..230527) [321 bp, 106 aa]
          {ON}  RPP1BRibosomal protein P1 beta, component of the
          ribosomal stalk, which is involved in interaction of
          translational elongation factors with ribosome;
          accumulation is regulated by phosphorylation and
          interaction with the P2 stalk component
          Length = 106

 Score = 29.6 bits (65), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 7  TDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDN 52
          +DNLL   K   A +     D +WA     ALE  ++KEI  GF N
Sbjct: 22 SDNLLTITKAAGANV-----DNVWADVYAKALEGKDLKEILSGFHN 62

>KNAG0B02900 Chr2 (558241..558354,558724..558930) [321 bp, 106 aa]
          {ON} Anc_7.293 YDL130W
          Length = 106

 Score = 29.6 bits (65), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 8  DNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGF 50
          DNLL+  K   A++     D IWA     ALE  ++KEI  GF
Sbjct: 23 DNLLSVTKAAGASV-----DKIWADVYANALEGKDLKEILSGF 60

>ZYRO0C09372g Chr3 complement(711868..712182) [315 bp, 104 aa]
          {ON} highly similar to uniprot|P10622 Saccharomyces
          cerevisiae YDL130W RPP1B Ribosomal protein P1 beta a
          component of the ribosomal stalk which is involved in
          the interaction between translational elongation
          factors and the ribosome accumulation of P1 in the
          cytoplasm is regulated by phosphorylation and
          interaction with the P2 stalk component
          Length = 104

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 8  DNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGF 50
          DNLL+  K   A++     D +WA     ALE  ++KEI  GF
Sbjct: 23 DNLLSLSKAAGASV-----DNVWAEVYAKALEGKDLKEILSGF 60

>AFR163C Chr6 complement(729720..729923,729979..730092) [318 bp,
          105 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YDL130W (RPP1B); 1-intron
          Length = 105

 Score = 29.3 bits (64), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 7  TDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGF 50
          +DNLL+  K   A++     D +WA     ALE  ++KE+  GF
Sbjct: 22 SDNLLSLTKAAGASV-----DNVWAEIFAKALEGKDVKEVLSGF 60

>Ecym_8042 Chr8 complement(96293..96499,96603..96935) [540 bp, 179
           aa] {ON} similar to Ashbya gossypii AFR163C 1-intron
          Length = 179

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 8   DNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAG 55
           DNLLA  K   A++     D +WA     ALE  ++K+I  GF +AAG
Sbjct: 96  DNLLALTKAAGASV-----DNVWADIFSKALEGKDVKDILSGF-HAAG 137

>Suva_4.115 Chr4 (218351..218464,218818..219024) [321 bp, 106 aa]
          {ON} YDL130W (REAL)
          Length = 106

 Score = 28.5 bits (62), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 7  TDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDN 52
          +DNL+   K   A +     D +WA     ALE  ++KEI  GF N
Sbjct: 22 SDNLVTITKAAGANV-----DNVWADVYAKALEGKDLKEILSGFHN 62

>Kpol_2000.12 s2000 (20300..20413,20697..20900) [318 bp, 105 aa]
          {ON} (20300..20413,20697..20900) [318 nt, 106 aa]
          Length = 105

 Score = 28.1 bits (61), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query: 8  DNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDN 52
          +NLL   K   A I     +T+WA     ALE  ++KEI  GF N
Sbjct: 23 ENLLTLTKAAGANI-----ETVWADVFASALEGKDLKEILSGFHN 62

>Skud_13.41 Chr13
           (70099..70149,70153..70194,70198..70413,70417..70623,
           70636..70662,70685..70735,70739..73402) [3258 bp, 1085
           aa] {OFF} YML100W (PSEUDO)
          Length = 1085

 Score = 28.9 bits (63), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 2   SWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEI 46
           SW+ Y +  L  G  D      + GDTIW     L L P  ++EI
Sbjct: 436 SWKFYRN--LNQGFADAIVKIYKKGDTIWIHDYHLMLVPQMVREI 478

>Skud_13.42 Chr13 (71021..73402) [2382 bp, 793 aa] {ON} YMR261C
           (REAL)
          Length = 793

 Score = 28.5 bits (62), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 2   SWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEI 46
           SW+ Y +  L  G  D      + GDTIW     L L P  ++EI
Sbjct: 144 SWKFYRN--LNQGFADAIVKIYKKGDTIWIHDYHLMLVPQMVREI 186

>NDAI0A03000 Chr1 (671588..671701,672195..672401) [321 bp, 106 aa]
          {ON} Anc_7.293 YDL130W
          Length = 106

 Score = 27.7 bits (60), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 5/46 (10%)

Query: 7  TDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDN 52
          ++NLL+  K   A++     + +WA     ALE  ++KEI  GF N
Sbjct: 22 SENLLSVTKAAGASV-----ENVWADVYAKALEGKDLKEILSGFHN 62

>KLTH0A05434g Chr1 complement(451664..451870,452033..452146) [321
          bp, 106 aa] {ON} highly similar to uniprot|P10622
          Saccharomyces cerevisiae YDL130W RPP1B Ribosomal
          protein P1 beta, a component of the ribosomal stalk,
          which is involved in the interaction between
          translational elongation factors and the ribosome;
          accumulation of P1 in the cytoplasm is regulated by
          phosphorylation and interaction with the P2 stalk
          component
          Length = 106

 Score = 27.3 bits (59), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 27 DTIWASSGGLALEPSEIKEISQGF 50
          D IWA +   ALE  ++KEI  GF
Sbjct: 37 DNIWAETFAKALEGKDLKEILSGF 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,597,767
Number of extensions: 380710
Number of successful extensions: 818
Number of sequences better than 10.0: 43
Number of HSP's gapped: 818
Number of HSP's successfully gapped: 43
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)