Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL167C5.440ON43943918250.0
Ecym_45115.440ON46127410531e-140
SAKL0G02662g5.440ON4792569631e-126
KLLA0E02311g5.440ON4172639001e-117
Kwal_55.214085.440ON4362468831e-114
KLTH0F15928g5.440ON4232518601e-111
CAGL0K10230g5.440ON4462608481e-109
KAFR0D050505.440ON4192428421e-109
Smik_15.3005.440ON4632768161e-104
Suva_8.1755.440ON4532508151e-104
KNAG0B042105.440ON4632448021e-102
TDEL0D026105.440ON4402477991e-102
YOR123C (LEO1)5.440ON4642637991e-101
NCAS0H020805.440ON4352437851e-100
NDAI0C015905.440ON4702427792e-98
ZYRO0F10164g5.440ON4232287663e-97
Skud_15.2855.440ON4873697592e-95
Kpol_1062.265.440ON4572617214e-90
TPHA0E017305.440ON4692767163e-89
TBLA0A064905.440ON4282646977e-87
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL167C
         (439 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   707   0.0  
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   410   e-140
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   375   e-126
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   351   e-117
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   344   e-114
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   335   e-111
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   331   e-109
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   328   e-109
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   318   e-104
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   318   e-104
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   313   e-102
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   312   e-102
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   312   e-101
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   306   e-100
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   304   2e-98
ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   299   3e-97
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   296   2e-95
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   282   4e-90
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   280   3e-89
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   273   7e-87

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/439 (82%), Positives = 360/439 (82%)

Query: 1   MAEEQRDALTESAELSEQKLEDGFTSDQGGSSANENDLFXXXXXXXXXXXXXXXXXXXXX 60
           MAEEQRDALTESAELSEQKLEDGFTSDQGGSSANENDLF                     
Sbjct: 1   MAEEQRDALTESAELSEQKLEDGFTSDQGGSSANENDLFGEDSDVSGSDDADEADDGASE 60

Query: 61  XXXXXXXXXTGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHV 120
                    TGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHV
Sbjct: 61  DSGSRRSRGTGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHV 120

Query: 121 VPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLID 180
           VPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLID
Sbjct: 121 VPLLYNKPLEGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLID 180

Query: 181 ENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQ 240
           ENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQ
Sbjct: 181 ENTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQ 240

Query: 241 EIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRE 300
           EIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRE
Sbjct: 241 EIMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRE 300

Query: 301 LQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSMEXXXXXXXX 360
           LQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSME        
Sbjct: 301 LQKKHDQVLRERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSMEDEYDDEDG 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXPGSPTASQDEEDDLNAARLQQLKRXXXXXXXXXXXXXXX 420
                                PGSPTASQDEEDDLNAARLQQLKR               
Sbjct: 361 FIDDDDDLEALSDNDDAADSLPGSPTASQDEEDDLNAARLQQLKREGAAKYAAAPPAPRA 420

Query: 421 XXXXXLKRRKVAVLDSDDE 439
                LKRRKVAVLDSDDE
Sbjct: 421 DEEVALKRRKVAVLDSDDE 439

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  410 bits (1053), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/274 (73%), Positives = 234/274 (85%), Gaps = 2/274 (0%)

Query: 73  GLGAEDNE-EQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEG 131
           GLG  D E EQEMYNRKFYGDDL++ S  SD +E REIKEA+++++KHVVP       E 
Sbjct: 77  GLGLSDEEDEQEMYNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEK 136

Query: 132 KRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRG 191
              LYY KVPQFLTIDP+PFDPP FQ QIE+R+ RFSSKEDQLGD LIDENTIRWRYSRG
Sbjct: 137 DSSLYYAKVPQFLTIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRG 196

Query: 192 SDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTI 251
           ++Q+VFKESNAQ+I+WSDGT SLKLGDE++DIL N+IENTY+TVSHEQ+E+MQCVEGG I
Sbjct: 197 ANQQVFKESNAQIIQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEI 256

Query: 252 SNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRE 311
             SMLFIPTSTNSK H+RL+ AIARREAREHSGPSTYIVR DPELEK+EL+KKHDQV+RE
Sbjct: 257 KKSMLFIPTSTNSKTHQRLSAAIARREAREHSGPSTYIVRMDPELEKKELEKKHDQVIRE 316

Query: 312 RRKRQLKEQLDRDNLEGGLAQ-GSFEFKKAAGRA 344
           RRKRQLKEQ+DR+N EGG+ + G F FKK  GR+
Sbjct: 317 RRKRQLKEQMDRENAEGGIVETGYFGFKKGNGRS 350

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  375 bits (963), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 175/256 (68%), Positives = 213/256 (83%), Gaps = 3/256 (1%)

Query: 70  TGHGLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPL 129
             HG   E++EEQ MYNRKFYGDD+   SD   ED  RE KEAD+E+ KH+VP       
Sbjct: 120 ANHGSYLEEDEEQAMYNRKFYGDDVDNDSDA--EDSQREFKEADVEIAKHIVPYKTTSNS 177

Query: 130 EGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYS 189
           + K + YY KVPQFLTIDPVPFDPPSF+  +E R+A+FSSKEDQL D LIDENTIRWRYS
Sbjct: 178 QDKEV-YYAKVPQFLTIDPVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYS 236

Query: 190 RGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGG 249
           R S Q+VFKESNAQ+I+WSDGT SL+LGDE++D+L N+ +NT+LTVSHEQQE+MQCVEGG
Sbjct: 237 RDSKQQVFKESNAQIIQWSDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGG 296

Query: 250 TISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVL 309
            I+ +M+FIPTST+SKIH+RL+KA+ RRE REH GP+TYIVRKDPELE+REL+KK DQ++
Sbjct: 297 EITKTMMFIPTSTSSKIHQRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIV 356

Query: 310 RERRKRQLKEQLDRDN 325
           RERRKRQLKEQL+++N
Sbjct: 357 RERRKRQLKEQLEKEN 372

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  351 bits (900), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 169/263 (64%), Positives = 211/263 (80%), Gaps = 5/263 (1%)

Query: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLY 136
           E++EEQ MYNRKF G+D +  S+   E + +E+   D+E+VKHVVP       + K  +Y
Sbjct: 65  EEDEEQAMYNRKFLGEDYEGQSEEEYEKKYKEV---DVEIVKHVVPYKTANGADDK-TIY 120

Query: 137 YTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRV 196
           Y KVPQFLTIDPVPFDPPSFQ ++E R++++SSKEDQLGD LI+ENTIRWRYSR  D+RV
Sbjct: 121 YAKVPQFLTIDPVPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERV 180

Query: 197 FKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSML 256
           FKESNAQ++EWSDGT SLK+GDEYTDIL N  ENTYLTVSHE+QE++QCVEGG I+ SM+
Sbjct: 181 FKESNAQIVEWSDGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMM 240

Query: 257 FIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQ 316
           F+PTSTNSK+HK L+KA+ARR+ R   GP+TYI R DPELEKREL+KKHDQ+LRERRK+Q
Sbjct: 241 FVPTSTNSKVHKILSKAVARRDERGQHGPNTYITRTDPELEKRELEKKHDQILRERRKKQ 300

Query: 317 LKEQLDRDNLEGGLAQGSFEFKK 339
           LKE+L+ +N  G   +  F  +K
Sbjct: 301 LKEKLELENA-GDSPEPQFNIQK 322

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  344 bits (883), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 205/246 (83%), Gaps = 4/246 (1%)

Query: 82  QEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYTKVP 141
           Q MYNRKFYGD+   A D +DE   RE +EAD+++VKHVVP     P EG + ++Y KVP
Sbjct: 81  QAMYNRKFYGDN---AEDSNDEGSQREFREADVDVVKHVVPY-STVPSEGDKTIFYAKVP 136

Query: 142 QFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKESN 201
           QFLTIDP+PFDPP+FQ +IE+R A+ SS EDQ+ D LI+ENT+RWRYSR S Q+VFKESN
Sbjct: 137 QFLTIDPIPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESN 196

Query: 202 AQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTS 261
           AQ+++WSDGT SL+LGDE+TD+L N+ E+TYLTVSH+QQE++Q V+GG ++ +M+FIPTS
Sbjct: 197 AQIVQWSDGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTS 256

Query: 262 TNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKEQL 321
           TNSK H+RL+KA+AR+E REH GP+TYI+R DPELE++EL+KK  Q++RERRKRQL+EQ 
Sbjct: 257 TNSKSHQRLSKAVARKEQREHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQLREQQ 316

Query: 322 DRDNLE 327
           +R+ L+
Sbjct: 317 EREGLD 322

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  335 bits (860), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/251 (60%), Positives = 210/251 (83%), Gaps = 5/251 (1%)

Query: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLY 136
           E+++EQ MYNRKFYGD   +  D +DE  ++E +EAD++++KH+VP    +P +G + +Y
Sbjct: 63  EEDDEQAMYNRKFYGD---KGEDSNDEG-SQEFREADIDIMKHIVPYS-TEPSQGDKTIY 117

Query: 137 YTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRV 196
           YTKVPQFLTIDP+PFDPP+FQ +IE+R A+ +S EDQ+ D LI+ENT+RWRYSR  +QRV
Sbjct: 118 YTKVPQFLTIDPIPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRV 177

Query: 197 FKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSML 256
           FKESNA +++WSDGT SL+LGDEYTD+L N+ E+TYL VSH+QQE++Q V+GG ++ +M+
Sbjct: 178 FKESNAHIVQWSDGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMI 237

Query: 257 FIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQ 316
           FIPTSTNSK H+RL+KA+AR+E +EH GP+TYI+R DPELE++EL+KK  Q++RERRKRQ
Sbjct: 238 FIPTSTNSKSHQRLSKAVARKEQQEHHGPNTYILRVDPELEQKELEKKQGQIIRERRKRQ 297

Query: 317 LKEQLDRDNLE 327
           L+EQ +R+ ++
Sbjct: 298 LREQQEREGMD 308

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  331 bits (848), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 207/260 (79%), Gaps = 4/260 (1%)

Query: 81  EQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYTKV 140
           EQEMY RKFYG+D   A + SD+DE    KE++++L++H++P            ++Y KV
Sbjct: 108 EQEMYTRKFYGED---AVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKV 164

Query: 141 PQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKES 200
           P FLTIDPVPFDP +F+  +++R+++ +SKEDQLGD LIDENTIRWRYSR ++Q VFKES
Sbjct: 165 PAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKES 224

Query: 201 NAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPT 260
           NAQ+++WSDG+ SLKLGDEYTDI+ N+ +NT+LTVSH+QQE+MQC +GG I+ +M+FIPT
Sbjct: 225 NAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPT 284

Query: 261 STNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLKEQ 320
           STNSKIH++L+KA++RR AR++ GP +YI+++DPE+EK+EL+K   Q++RERRKRQ KE 
Sbjct: 285 STNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQQKEI 344

Query: 321 LDRDNLEGGLAQGSFEFKKA 340
             R+N E G A+ + EFK+ 
Sbjct: 345 ETRENAENGFAE-TGEFKRG 363

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  328 bits (842), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 158/242 (65%), Positives = 200/242 (82%), Gaps = 3/242 (1%)

Query: 79  NEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYT 138
           +EE+ MYNRKFYG   ++ SD+SD +E    KEAD+ELV+HVVP       E  + +YYT
Sbjct: 66  DEEEAMYNRKFYG---EEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYT 122

Query: 139 KVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFK 198
           KVP FL+IDP+PFDPPSF+ ++++R + FSS EDQLGD LIDENTIRWRYSR ++QRVFK
Sbjct: 123 KVPAFLSIDPLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFK 182

Query: 199 ESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFI 258
           ESNAQ+++WSDG+ SLKLG EYTDIL N  +NT+LTVSH+QQE+MQCV+GG I+ +++FI
Sbjct: 183 ESNAQIVQWSDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFI 242

Query: 259 PTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLK 318
           PTSTNSKIH+RL+KAIARR+ R HSGP T IV  DPE+EKREL+KK  Q++RERR+RQ+K
Sbjct: 243 PTSTNSKIHQRLSKAIARRDQRVHSGPGTMIVNLDPEVEKRELEKKQTQIIRERRRRQMK 302

Query: 319 EQ 320
           EQ
Sbjct: 303 EQ 304

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  318 bits (816), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 151/276 (54%), Positives = 205/276 (74%), Gaps = 10/276 (3%)

Query: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPL--LYNKPL 129
           GL  ++ EEQ MY RKFYG+DL   +D SD+DEA    KE ++ELV+H++P   + N+  
Sbjct: 101 GLDDDEAEEQAMYTRKFYGEDL---NDFSDQDEATHTFKEENVELVRHIIPSKGIVNETA 157

Query: 130 EGKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYS 189
               + +Y ++P FLTIDPVPFDPPSF+ ++ +R +  +SKEDQL D LIDENT+RWRYS
Sbjct: 158 SHNEI-FYARIPNFLTIDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYS 216

Query: 190 RGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGG 249
           R  DQ VFKESN Q+++WSDGT SLK+G+E TDIL N+  NT+LTVSH+QQE++QC EGG
Sbjct: 217 RDKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGG 276

Query: 250 TISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVL 309
            I  +++FIPTSTNSKIH++L+KA+ RR  R++ GP TYIV  DPE+EKREL+KK  Q+L
Sbjct: 277 EIKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKRELEKKQSQIL 336

Query: 310 RERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAA 345
           R+RR+RQLKE+  +++ +     G   F+K +   A
Sbjct: 337 RDRRRRQLKEKEKQESPDAAFETG---FRKQSSPTA 369

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  318 bits (815), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 145/250 (58%), Positives = 193/250 (77%), Gaps = 5/250 (2%)

Query: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYN-KPLE 130
           GL  ++ EEQ MY RKFYG+D   A+D SD+DEA    KE ++ELV+H++P   N     
Sbjct: 99  GLDDDEAEEQAMYTRKFYGED---ANDFSDQDEATHTFKEENVELVRHIIPSKANVNETA 155

Query: 131 GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSR 190
               ++Y ++P FLTIDP+PFDPPSF+ ++ +R     SKEDQL D LIDENT+RWRYSR
Sbjct: 156 SHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSR 215

Query: 191 GSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGT 250
            +DQ VFKESN Q+++WSDG+ SLK+G+EYTDIL N+  NT+LTVSH+QQE+MQC EGG 
Sbjct: 216 DNDQHVFKESNTQIVQWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGE 275

Query: 251 ISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLR 310
           I  +++FIPTST+SKIH++L+KA+ R+  R++ GP TYI+  DPE+EKREL+KK  Q+LR
Sbjct: 276 IKKTLMFIPTSTSSKIHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILR 335

Query: 311 ERRKRQLKEQ 320
           +RRKRQLKE+
Sbjct: 336 DRRKRQLKEK 345

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  313 bits (802), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 144/244 (59%), Positives = 194/244 (79%), Gaps = 6/244 (2%)

Query: 79  NEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPL-LYNKPLEGKRLLY 136
           +EE+EMYNRKFYG+D+    D+SD ++A  E KEA++ELVKH+VP  L      G   +Y
Sbjct: 97  DEEEEMYNRKFYGEDV----DMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTNDIY 152

Query: 137 YTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRV 196
             KVP FL IDP PFDP SF+G++  R+    SKED+LGD LIDENT+RWRYSR ++Q V
Sbjct: 153 VAKVPPFLMIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSV 212

Query: 197 FKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSML 256
           FKESN Q+++WSDG+ SLKLG+EYTDIL N+ +NT+LTVSH+QQE+MQCVEGG ++ +++
Sbjct: 213 FKESNTQIVQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLM 272

Query: 257 FIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQ 316
           FIPTST+SKIH++L+KA+ARR   + +GP TYIV  DPE+EK+EL++K  Q+ +ERR+RQ
Sbjct: 273 FIPTSTSSKIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKELERKQGQIFKERRRRQ 332

Query: 317 LKEQ 320
           L+E+
Sbjct: 333 LREK 336

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  312 bits (799), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 194/247 (78%), Gaps = 10/247 (4%)

Query: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDE-AREIKEADLELVKHVVPLLYNKPLEG---K 132
           E+ +E  MY RKFYG+D   A ++SD++E A    E ++ELV+H+VP  Y    EG   K
Sbjct: 81  EEAQEHAMYTRKFYGED---ADNMSDQEESANHFTEENVELVRHIVP--YKTVGEGADEK 135

Query: 133 RLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGS 192
             +YY KVP+FLTIDPVPFDPPSF+ ++++R+   SS+EDQLGD LIDENTIRWRYSR  
Sbjct: 136 STIYYAKVPEFLTIDPVPFDPPSFESKVKERLNS-SSREDQLGDRLIDENTIRWRYSRDE 194

Query: 193 DQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTIS 252
           +Q+V+KESNAQ+++WSDG LSLKLG EYTDIL N+ +NT+  VSH++QE+MQC +GG ++
Sbjct: 195 NQQVYKESNAQIVQWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVT 254

Query: 253 NSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRER 312
            S++FIPTSTNSK+H++LTKA+ RR+ R+  GP  Y V KDPELEK EL+KK  QV+RER
Sbjct: 255 KSLMFIPTSTNSKMHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRER 314

Query: 313 RKRQLKE 319
           RKRQLKE
Sbjct: 315 RKRQLKE 321

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  312 bits (799), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 142/263 (53%), Positives = 196/263 (74%), Gaps = 5/263 (1%)

Query: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYN-KPLE 130
           GL  ++ EEQ MY RKFYG+D   A++ SD+DE     KE ++ELV+H++P   N     
Sbjct: 107 GLDDDEAEEQAMYTRKFYGED---ANNFSDQDETTHTFKEENVELVRHIIPSKANVNETA 163

Query: 131 GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSR 190
               ++Y ++P FLTIDP+PFDPPSF+ ++ +R +  +S+EDQL D LIDENT+RWRYSR
Sbjct: 164 SHNEIFYARIPNFLTIDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSR 223

Query: 191 GSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGT 250
             DQ VFKESN Q+++WSDGT SLK+G+E TDIL N+  NT+LTVSH+QQE++QC EGG 
Sbjct: 224 DKDQHVFKESNTQIVQWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGE 283

Query: 251 ISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLR 310
           I  +++FIPTSTNSKIH++L+KA+ RR  R+  GP TYIV  DPE+EK+EL++K  Q+LR
Sbjct: 284 IKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKELERKQSQILR 343

Query: 311 ERRKRQLKEQLDRDNLEGGLAQG 333
           +RR+RQLKE+  +++ +     G
Sbjct: 344 DRRRRQLKEKEKQESPDAAFETG 366

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  306 bits (785), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 145/243 (59%), Positives = 190/243 (78%), Gaps = 2/243 (0%)

Query: 79  NEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYNKPLEGKRLLYY 137
           +EE+ MY RKFYGDD       SD+D A    KE ++EL++H+VP   +     +  +YY
Sbjct: 80  DEEEAMYTRKFYGDDDYNRYS-SDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYY 138

Query: 138 TKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVF 197
            KVP FLTI+PVPFDP +F+  +  R++ +SSKEDQLGD LIDENT+RWRYSR ++QRVF
Sbjct: 139 AKVPPFLTINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVF 198

Query: 198 KESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLF 257
           KESNAQ+++WSDG+ SLKLGDEYTDIL NE  NT+L VSH+QQE+MQC  GG I+ +++F
Sbjct: 199 KESNAQIVQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMF 258

Query: 258 IPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQL 317
           IPTSTNSKIH++L+KA+ RR  REH GP T I+ +DPE+EKREL+KK  Q++R+RR+RQL
Sbjct: 259 IPTSTNSKIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKRELEKKQGQIIRDRRRRQL 318

Query: 318 KEQ 320
           KE+
Sbjct: 319 KEK 321

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  304 bits (779), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 148/242 (61%), Positives = 197/242 (81%), Gaps = 4/242 (1%)

Query: 79  NEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYT 138
           ++E+ MY RKFYGD   + SD  +E++A + KEA++E+++H+VP   +   +    +YY 
Sbjct: 116 DDEEAMYTRKFYGD-TDKYSD--NEEDAHDFKEANVEIIRHMVPYKTSSD-QADTTIYYA 171

Query: 139 KVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFK 198
           KVP FLTIDP+PFDP SF+ +++ R+A +SS+EDQLGD LIDENTIRWRYSR  +QRVFK
Sbjct: 172 KVPPFLTIDPIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFK 231

Query: 199 ESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFI 258
           ESNAQ+++WSDG+ SLKLGDEYTDIL N+ +NT+LTVSH+QQE+MQC  GG I+ +M+FI
Sbjct: 232 ESNAQIVQWSDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFI 291

Query: 259 PTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKRQLK 318
           PTSTNSKIH++L+KA+ RR  R++ GP T I+ KDPELEK+EL+KK  Q+LRERRKRQLK
Sbjct: 292 PTSTNSKIHQQLSKAVTRRNQRQNLGPGTMIIEKDPELEKKELEKKQGQILRERRKRQLK 351

Query: 319 EQ 320
           E+
Sbjct: 352 ER 353

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  299 bits (766), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 190/228 (83%), Gaps = 4/228 (1%)

Query: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLY 136
           E+ EE  MY RKFYG+D+ +   +SDE+EA+E +E D+ELV+H+VP    +  + K +LY
Sbjct: 84  EEAEEHAMYTRKFYGEDVDR---VSDEEEAQEFREEDVELVRHIVPYRATQGTD-KPVLY 139

Query: 137 YTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRV 196
           Y K+P+FLTIDPVPFDPPSF+  +++R+   +SKEDQLGD LIDENT+RWRYSR ++Q+V
Sbjct: 140 YAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQV 199

Query: 197 FKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSML 256
           FKESNAQ+++WSDGT SLKLGDEYTDIL+N+ +NT+  VSH+QQE+MQC EGG ++ +++
Sbjct: 200 FKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLM 259

Query: 257 FIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKK 304
           FIPTST+S++H++LTKA+ RR+ ++ +GP TYIV+KDPELE+ EL+KK
Sbjct: 260 FIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELEKK 307

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  296 bits (759), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 166/369 (44%), Positives = 230/369 (62%), Gaps = 14/369 (3%)

Query: 73  GLGAEDNEEQEMYNRKFYGDDLQQASDLSDEDEA-REIKEADLELVKHVVPLLYN-KPLE 130
           GL  ++ EEQ MY RKFYG+D   A+D SD+DEA    KE ++E+V+H++P   N     
Sbjct: 129 GLDDDEAEEQAMYTRKFYGED---ANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETA 185

Query: 131 GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSR 190
               ++Y ++P FLTID VPFDPPSF+ ++ +R    +SKEDQL D LIDENT+RWRYSR
Sbjct: 186 SHNEIFYARIPNFLTIDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSR 245

Query: 191 GSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGT 250
             DQ VFKESN Q+++WSDG+ SLK+G+E TDIL N+  NT+LTVSH+QQE++QC EGG 
Sbjct: 246 DKDQHVFKESNTQIVQWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGE 305

Query: 251 ISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLR 310
           I  +++FIPTSTNSKIH++L+KA+ RR  R++ GP TYIV  DPE+EK+EL+KK  QVLR
Sbjct: 306 IKKTLMFIPTSTNSKIHQKLSKAVIRRNQRQNKGPGTYIVNMDPEVEKKELEKKQSQVLR 365

Query: 311 ERRKRQLKEQLDRDNLEGGLAQGSFEFKKAAGRAAPYSRSMEXXXXXXXXXXXXXXXXXX 370
           +RR+RQLKE+  +++ +     G   F+K   +++P S  +                   
Sbjct: 366 DRRRRQLKEREKQESPDAAFETG---FRK---QSSPTSYGISRRNEYEEDDFLVDDDEEE 419

Query: 371 XXXXXXXXXXXPGSPTASQDEEDDLNAARLQQLKRXXXXXXXXXXXXXXXXXXXXLKRRK 430
                             ++E D  NAARL+ LKR                     KRR+
Sbjct: 420 EAGFDDGDDEEEEEEEEEEEEADQENAARLRNLKR---EGAAMYKEEEKDDDSNETKRRR 476

Query: 431 VAVLDSDDE 439
           VAV++ D++
Sbjct: 477 VAVIEDDED 485

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  282 bits (721), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 192/261 (73%), Gaps = 4/261 (1%)

Query: 77  EDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPL-LYNKPLEGKRLL 135
           +++EEQ MY RKFYG+D    SD   E++  E +E D+ L +HVVP  + ++  +    +
Sbjct: 88  DEDEEQAMYTRKFYGEDDYDKSD--QEEDKHEFREEDVVLTRHVVPTKITSEENDADTTI 145

Query: 136 YYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQR 195
           YY KVP FLTIDP+PFDPP+F+  + +R+    SKE+QL D LID+NTIRWRYSR  +QR
Sbjct: 146 YYAKVPPFLTIDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQR 205

Query: 196 VFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSM 255
           VFKESNA +++WSDG+ SLKLGDEYTDIL N+ +NT+LTVSH+QQE+MQCV GG IS S+
Sbjct: 206 VFKESNATIVQWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSL 265

Query: 256 LFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVLRERRKR 315
           LF+P ST SK+H+RL+KAI RR A E  GP + IV  DPELEK+EL+KK  QV RERRK+
Sbjct: 266 LFVPISTTSKLHQRLSKAIVRRNATETMGPRSMIVNIDPELEKKELEKKQSQVFRERRKK 325

Query: 316 QLKEQLDRDNLE-GGLAQGSF 335
           + KE    ++LE  G    S+
Sbjct: 326 KQKEIEALESLETTGFGNNSY 346

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  280 bits (716), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 144/276 (52%), Positives = 202/276 (73%), Gaps = 20/276 (7%)

Query: 74  LGAEDNEEQEMYNRKFYGDDLQQASDLSDEDE-AREIKEADLELVKHVVPLLYNKPLE-- 130
           +  +++EE  MY RKFYGD   +  +  DEDE   E KEAD+ELV+H+VP    K LE  
Sbjct: 104 MDEDEDEEHAMYTRKFYGD---EDVNKYDEDENMHEFKEADVELVRHIVPY---KILEQK 157

Query: 131 ---------GKRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDE 181
                     K   YY ++P FLTIDPVPFDPP F+ ++++R+   ++ +D++GD LIDE
Sbjct: 158 NDNSKDDATSKNSTYYARIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDE 217

Query: 182 NTIRWRYSRGSDQRVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQE 241
           NTIRWRYSR ++Q VFKESNAQ+I+WSDG+ SLKLGD+YTD+L N+I NT+LTVSH+QQE
Sbjct: 218 NTIRWRYSRDANQTVFKESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQE 277

Query: 242 IMQCVEGGTISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKREL 301
           +MQCV+GG IS S +F+P STNS++H+RL+KAIARR+      P + I+  DPE+EK+EL
Sbjct: 278 LMQCVDGGEISKSAMFVPISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDPEIEKKEL 337

Query: 302 QKKHDQVLRERRKRQLKE-QLDRDNLEG-GLAQGSF 335
           +KK  Q+ R+RRKR+ +E + +++ L+  G +QG++
Sbjct: 338 EKKQSQIFRDRRKRKQREIETEQEALDSPGFSQGNY 373

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  273 bits (697), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 191/264 (72%), Gaps = 9/264 (3%)

Query: 75  GAEDNEEQEMYNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLY---NKPLEG 131
            ++D +++ MY +KFYG+D    SD  D+D   E KE+D+ELV+H+VP      NK L+ 
Sbjct: 49  NSDDEQDKAMYEKKFYGEDGFNRSD--DDDNEYEYKESDIELVRHIVPYKTRPSNKELDK 106

Query: 132 KRLLYYTKVPQFLTIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRG 191
            R LYY KVP FL +DPVPFD  +F+  +++R+    +++ Q+ D L DENTIRWRYSR 
Sbjct: 107 HRELYYAKVPPFLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRD 166

Query: 192 SDQ--RVFKESNAQVIEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGG 249
           S+   +VFK+SNAQ+I+WSDG+ SLKLG++YTDILTNE +N +LTVSH+QQE+MQC  GG
Sbjct: 167 SNDNDKVFKQSNAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGG 226

Query: 250 TISNSMLFIPTSTNSKIHKRLTKAIARREAREHSGPSTYIVRKDPELEKRELQKKHDQVL 309
            I+ +++FIP+ST SKIH+RLT A+  R+ +  SGP   ++  DPE+EK+ L+KK  Q++
Sbjct: 227 EITKTLMFIPSSTKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLLEKKQWQMM 286

Query: 310 RERRKRQLKEQLDRDNLEGGLAQG 333
           R+RR++QL+E+   +N   G+  G
Sbjct: 287 RDRRRKQLQER--ENNEVDGITSG 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,482,805
Number of extensions: 1599332
Number of successful extensions: 7239
Number of sequences better than 10.0: 70
Number of HSP's gapped: 7433
Number of HSP's successfully gapped: 74
Length of query: 439
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 326
Effective length of database: 40,524,141
Effective search space: 13210869966
Effective search space used: 13210869966
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)