Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL166W5.441ON49049025100.0
Ecym_45125.441ON52748914700.0
TDEL0D026005.441ON52351610681e-140
KLLA0E02333g5.441ON48048110231e-134
NDAI0B057105.441ON56348010231e-133
Kpol_1062.255.441ON53346310101e-131
SAKL0G02684g5.441ON53947610071e-131
ZYRO0F10186g5.441ON5194969901e-129
NCAS0F034205.441ON5254939801e-127
KNAG0C048705.441ON4584489691e-126
TBLA0A027905.441ON5475309661e-125
TPHA0E017205.441ON5374529641e-125
CAGL0A02904g5.441ON5014479471e-122
KAFR0E038105.441ON4904299091e-117
Suva_2.5435.441ON5115029061e-116
Smik_4.6375.441ON5115078881e-113
Kwal_55.214025.441ON5164608501e-108
Skud_4.6405.441ON5115018501e-108
KLTH0F15906g5.441ON5154618401e-106
YDR371W (CTS2)5.441ON5115068381e-106
TDEL0A069006.277ON102289761.1
KLTH0H11242g1.346ON27483713.5
KNAG0F003101.54ON60270714.2
KLLA0D13882g7.140ON43280688.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL166W
         (490 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   971   0.0  
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   570   0.0  
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   416   e-140
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   398   e-134
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   398   e-133
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   393   e-131
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   392   e-131
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   385   e-129
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   382   e-127
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   377   e-126
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   376   e-125
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   375   e-125
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   369   e-122
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   354   e-117
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   353   e-116
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   346   e-113
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   332   e-108
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   332   e-108
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   328   e-106
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   327   e-106
TDEL0A06900 Chr1 (1204342..1207410) [3069 bp, 1022 aa] {ON} Anc_...    34   1.1  
KLTH0H11242g Chr8 complement(963370..964194) [825 bp, 274 aa] {O...    32   3.5  
KNAG0F00310 Chr6 (36504..38312) [1809 bp, 602 aa] {ON} Anc_1.54 ...    32   4.2  
KLLA0D13882g Chr4 (1194407..1195705) [1299 bp, 432 aa] {ON} simi...    31   8.4  

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/490 (95%), Positives = 468/490 (95%)

Query: 1   MRRFPTPVYTIWXXXXXXXXXXEMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPD 60
           MRRFPTPVYTIW          EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPD
Sbjct: 1   MRRFPTPVYTIWILILVAAIVLEMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPD 60

Query: 61  GEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM 120
           GEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM
Sbjct: 61  GEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM 120

Query: 121 NLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAI 180
           NLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAI
Sbjct: 121 NLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAI 180

Query: 181 DAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLS 240
           DAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLS
Sbjct: 181 DAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLS 240

Query: 241 MAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDK 300
           MAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDK
Sbjct: 241 MAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDK 300

Query: 301 RRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQLIGQKY 360
           RRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQLIGQKY
Sbjct: 301 RRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQLIGQKY 360

Query: 361 XXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEY 420
                       MWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEY
Sbjct: 361 SGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEY 420

Query: 421 VKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKLIQYYLRTRPEGF 480
           VKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKLIQYYLRTRPEGF
Sbjct: 421 VKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKLIQYYLRTRPEGF 480

Query: 481 LVPMYRHTSG 490
           LVPMYRHTSG
Sbjct: 481 LVPMYRHTSG 490

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/489 (57%), Positives = 344/489 (70%), Gaps = 5/489 (1%)

Query: 1   MRRFPTPVYTIWXXXXXXXXXXEMTFLPKLIKEKLSR-RIRPKPLEVHEETRPVPDAPYP 59
           MRRF    Y+IW          EMTF+PKL+ EK  + R   +   +   TRPV D    
Sbjct: 1   MRRFSITSYSIWILVLLVAIILEMTFIPKLMIEKFKKPRSDIERTALSTITRPV-DRNLQ 59

Query: 60  DGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMP 119
            G+Y VGVYY+SWSPY+PRLH+P +IDF+RVT+V YAFFVVD KTGK+   D WSD +MP
Sbjct: 60  HGKYAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMP 119

Query: 120 MNLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSA 179
            +  G+P+G+ G IGELNYLK +  T+F+L MAVGGWSNRE F KIVR EEK  NF++S 
Sbjct: 120 SHAPGIPQGVTGMIGELNYLKLQRNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNST 179

Query: 180 IDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHL 239
           IDAMFEYGFDGIDLDWEFPKDDGYEP MYLEMCSRLR KMD+LED IWG   T  P+F L
Sbjct: 180 IDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFEL 239

Query: 240 SMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLD 299
           S+A PAF QTL I P+ EMNK++S+WNMMTYD+HG+WS+RTGYHSNLY+   +     L 
Sbjct: 240 SVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKN--NDELK 297

Query: 300 KRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRG-DGEQLIGQ 358
           KRR+E M ID+ + LNA DAI +M E FKV  +K+ LGM AYGRGFTNV+  D + L+ +
Sbjct: 298 KRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTKDDDDLLNK 357

Query: 359 KYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKK 418
           KY            +WLYNQLPLA+  EKFD+ WVSAY +D N KT V YDN+ SM++K 
Sbjct: 358 KYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKS 417

Query: 419 EYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKLIQYYLRTRPE 478
           +YVK K L+G F WESCGD   D  RNLV AF++ +   R  T +KD + I YYL+ R +
Sbjct: 418 DYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEMRIPTIFKDPRAIAYYLKHRQK 477

Query: 479 GFLVPMYRH 487
           GFL  ++  
Sbjct: 478 GFLYSLFSQ 486

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  416 bits (1068), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/516 (43%), Positives = 306/516 (59%), Gaps = 40/516 (7%)

Query: 1   MRRFPTPVYTIWXXXXXXXXXXEMTFLPKLIKEKLSRRI----RPKPLEVHEETRPVPDA 56
           M+R P   +T+           EM F  K+      R++    + +P +    T P    
Sbjct: 1   MQRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQAQLVTNPGTVE 60

Query: 57  PYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDT 116
           P   G+Y  G+YYS+WSPY PR+H+P +ID  RV+H+YYAFF+VD  TG +   D+WSD 
Sbjct: 61  P---GQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDV 117

Query: 117 KM----PM-------------NLTGMPRGL-NGAIGELNYLKT------RPGTDFKLMMA 152
            M    PM             +L    R L NG +GEL Y++       R   DFK++M 
Sbjct: 118 GMDLYKPMAIKLNKLNPEVKNDLERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMC 177

Query: 153 VGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMC 212
           VGGWSNRE F K+VR+ ++ + FIDS I+ MF+YGFDGIDLDWEFP+DDG+EPQMYL++ 
Sbjct: 178 VGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLA 237

Query: 213 SRLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDY 272
            RL+ +M+ELED I+GP     P+F LSMA PAF + L I P+ EM+KY+ +WNMMTYDY
Sbjct: 238 KRLKERMNELEDAIFGP-NMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDY 296

Query: 273 HGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPR 332
           HG WSE+TGYH NLYN +   +     K  Y    ++  D   AH AI  M     V+  
Sbjct: 297 HGEWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLD---AHSAIEHMLNVAGVNSH 353

Query: 333 KIALGMAAYGRGFTNV--RGDGEQLIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDN 390
           KI LGMAAYGRGFTNV  +   ++ I + +            MWLYNQLP+    E FD 
Sbjct: 354 KICLGMAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDP 413

Query: 391 VWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAF 450
            +VS + Y   +KT V YD+V+S++ K +YV++K LAG F WESCGD+  ++ R+L+ AF
Sbjct: 414 DYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAF 473

Query: 451 TENMKGARK--ATAYKDSKLIQYYL-RTRPEGFLVP 483
           T  +K   K     Y+ + +++YY+ +   + FL P
Sbjct: 474 TNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSP 509

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  398 bits (1023), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 210/481 (43%), Positives = 298/481 (61%), Gaps = 23/481 (4%)

Query: 12  WXXXXXXXXXXEMTFLPKLIKEKLSR---RIRPKPLEVHEETRPVPDAPYPDGEYTVGVY 68
           W          EM  +P L  +K+ +     R  P E+  +TR VP +  PDG ++V  Y
Sbjct: 15  WIIIIVLAFIVEMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTR-VP-SEGPDG-FSVATY 71

Query: 69  YSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNLTGMPRG 128
           YS+WSPY  R H P +I   ++THVYYAFFVVD K+G + S D WSD ++P+++     G
Sbjct: 72  YSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPLSV-----G 126

Query: 129 LNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGF 188
           + G I EL  +K     +FK ++ +GGWSNRE + KI + E+K   FI++A+D MF YGF
Sbjct: 127 VKGCIKELQKIKLESKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGF 186

Query: 189 DGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTE--PRFHLSMAAPAF 246
           DGIDLDWEFP++D  EP +YLEM   +R  MD+LE  I+G     +  P F LS+A PAF
Sbjct: 187 DGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQLSVATPAF 246

Query: 247 PQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDM 306
            + L I P+ EM+KY+ +WNMM YD+HG WS+ TGYHSNLY   +S        RR    
Sbjct: 247 AEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHS-------HRRSLSN 299

Query: 307 GIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQLIGQKYXXXXXX 366
            I N   L++  A+ +MT++  +S R+IALGMAAYGRGFTNV  + +  +G+KY      
Sbjct: 300 RISN-SSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETNDDNYLGKKYHGVGGG 358

Query: 367 XXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKL 426
                 +WLYNQLP+    E+FD+  VSAY +DP ++T V YDNV SM IK +Y+K K L
Sbjct: 359 SEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNL 418

Query: 427 AGAFLWESCGDNFKDKDRNLVEAFTENMKGARK-ATAYKDSKLIQYYLRTRPEGFLVPMY 485
            G F WESCGD+ KD  ++LV AF++ +  +    + +K  K+ Q++L+  P+ ++  ++
Sbjct: 419 NGGFWWESCGDS-KDPRKSLVNAFSKEIGLSEGFVSLFKSDKVKQFHLQKYPKDYISSLF 477

Query: 486 R 486
           +
Sbjct: 478 Q 478

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  398 bits (1023), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 217/480 (45%), Positives = 289/480 (60%), Gaps = 55/480 (11%)

Query: 54  PDAPYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKW 113
           P     +  +  GVYYSSWSPYKPR H+P +ID  ++THVYY+FF+V+  TG +   D+W
Sbjct: 84  PKLGKTNNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEW 143

Query: 114 SDTKM----PMNLTGMPRGLN-------------------------GAIGELNYLKTRPG 144
           SD KM    P++L       N                         G +GEL YLK    
Sbjct: 144 SDLKMDLYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKF-- 201

Query: 145 TDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYE 204
            +FKL+M++GGWSNRE F  +VRD+ K N FI+S+++ MF+YGFDGIDLDWEFP+DDG+E
Sbjct: 202 QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFE 261

Query: 205 PQMYLEMCSRLRHKMDELEDNIWGPGGTT---------EPRFHLSMAAPAFPQTLGIFPV 255
           P  YLE+  RLR +MD+LE +I+     +          P+F LS+A PAF + L I P+
Sbjct: 262 PGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPI 321

Query: 256 EEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELN 315
           +EMNKY+  WNMMTYDY+G WSE TGYH NLY   N+   +     +Y+     +   LN
Sbjct: 322 KEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTIN----AQYKHEHTSSNKGLN 377

Query: 316 AHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR--GDGEQLIGQKYXXXXXXXXXXXXM 373
           A+DAI  M     VS RK+ LG+AAYGRGFT V+   + E  I +K+            M
Sbjct: 378 ANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGM 437

Query: 374 WLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWE 433
           WLYNQLP+ +  E FD  +VSA+ YDP TKT V YDNVD+MK+K +YV+D+ LAG F WE
Sbjct: 438 WLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWE 497

Query: 434 SCGDNFKDKDRNLVEAFTENMKGARKATAYKDSKL-------IQYYLRT-RPEGFLVPMY 485
           SCGD+ K  +R+L+ AFT  ++  +    Y+DS L       I+YYL     +GFL P +
Sbjct: 498 SCGDDHKHPERSLLNAFTNQLE-VKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  393 bits (1010), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/463 (45%), Positives = 288/463 (62%), Gaps = 43/463 (9%)

Query: 59  PDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM 118
           PD  Y VGVYYS+WSPY PRLH P ++DF R+THVYYAFFVVD KTG + + D WSD +M
Sbjct: 60  PDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEM 119

Query: 119 --------------------PMNLTGMPRGLNGAIGELNYLKTRPGTD------FKLMMA 152
                               P    G+P G    IGEL YL+     D      FKL+M+
Sbjct: 120 DCYKPLAMKLKKLQLDHFFNPKFKNGLPMG---CIGELFYLRHSQLFDSNNSRKFKLIMS 176

Query: 153 VGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMC 212
           VGGWSNRE F +++RD +K + F++S I+ MF YGFDGI+LDWEFPKDD  EP+MYLE+ 
Sbjct: 177 VGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELV 236

Query: 213 SRLRHKMDELEDNIWGPGG----TTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMM 268
            +L+ K +ELE  I+   G    +  P+FHLS+AAPAF + L I  + EM+ Y+ +WNMM
Sbjct: 237 KKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMM 296

Query: 269 TYDYHGAWSERTGYHSNLYNATNS-----PYKSHLDKRRYEDMGIDNFDELNAHDAILMM 323
           TYDYHG WSE+TGYHSNLY+   +           +    +D   D+   LN   AI  +
Sbjct: 297 TYDYHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYV 356

Query: 324 TEQFKVSPRKIALGMAAYGRGFTNVRGDGE--QLIGQKYXXXXXXXXXXXXMWLYNQLPL 381
            +++ ++P+KI LGMAAYGRGFT V    +  + I + Y            MWLYNQLP+
Sbjct: 357 IKKYHINPKKINLGMAAYGRGFTKVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPI 416

Query: 382 AHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKD 441
            +  E+FD  +VSA+ YD  +KT V YDN DSMK+K +YVK+  L G F WESCGD+ K+
Sbjct: 417 KNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKN 476

Query: 442 KDRNLVEAFTENMKGA--RKATAYKDSKLIQYYLRTRPE-GFL 481
            +++L+ AFT+ +     +  T + + ++++YYL+T+ + GFL
Sbjct: 477 PEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFL 519

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  392 bits (1007), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 207/476 (43%), Positives = 288/476 (60%), Gaps = 47/476 (9%)

Query: 46  VHEETRPVPDAPYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTG 105
           + EE  P   A      Y  GVYY++WSPY PR H+P +++F R+T+V+Y+FFVVD K+G
Sbjct: 75  LQEEVGP---ASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSG 131

Query: 106 KIGSLDKWSDTKMPMNLTGMPRGLN---------------------GAIGELNYLKTRP- 143
            + S D+WSD +M +     P+                        G IGEL YLK    
Sbjct: 132 TVKSSDEWSDFQMDLYKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSI 191

Query: 144 ---------GTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLD 194
                      +FK+ M+VGGWSNR+ F  IVRD+ KF+ FI + ++ MF+YGFDG+D+D
Sbjct: 192 LPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDID 251

Query: 195 WEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFP 254
           WEFP++DG EP+MYL M  RLR  +D+LE +I+     +E  F L++A PAF + L + P
Sbjct: 252 WEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQDEHHSE-HFFLTVAVPAFKEKLQVLP 310

Query: 255 VEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDEL 314
           + +M+ Y+  WN+M YDYHG WSE TGYHSNLY    S   +H+ +R + D      ++L
Sbjct: 311 LRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLY----SEDSNHVHRRHFRDEE----NQL 362

Query: 315 NAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR--GDGEQLIGQKYXXXXXXXXXXXX 372
           NA  A+  + + F ++ RK+ LGMAAYGRGFT V+   +    IG+ Y            
Sbjct: 363 NADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPG 422

Query: 373 MWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLW 432
           MWLYNQLPL    E FD   VSAYS+DP +KT V YDNVDSM+ K +YVK+  LAG F W
Sbjct: 423 MWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWW 482

Query: 433 ESCGDNFKDKDRNLVEAFTENMKGARKA--TAYKDSKLIQYYLRTRPEGFLVPMYR 486
           ESCGDN KD+ ++L+ AFT ++    K   + Y  + +I+YYL+  P+GFL  +++
Sbjct: 483 ESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYYLKNYPQGFLSRVFK 538

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/496 (42%), Positives = 299/496 (60%), Gaps = 44/496 (8%)

Query: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEET-RPVPDAPYPDGE--YTVGVYYSSWSPYKPRL 79
           EM F  K+ K      +     EV + + +   D     G+  YT G+YYS WSPY PR 
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84

Query: 80  HYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM------------------- 120
           H+P +IDF +V+H+YYAFF++D  TG++ S D+WSD +M +                   
Sbjct: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144

Query: 121 -NLTGMPRGLNGAIGELNYLKTR------PGTDFKLMMAVGGWSNREPFHKIVRDEEKFN 173
            ++  +P+G    +GEL YL+         G  FK+MMAVGGWSNR+ + K+VRD  +  
Sbjct: 145 ASMGVLPKG---CVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVE 201

Query: 174 NFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTT 233
           NFI+S ++ MF+YGFDGIDLDWEFP++DG+EP+MYLE+  ++R K DELE+ I+  G   
Sbjct: 202 NFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFA-GEPN 260

Query: 234 EPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSP 293
            P+F LSMA PAF   L + P++E+++Y+ +WNMMTYDYHG WS  TGYH NLY+    P
Sbjct: 261 HPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDG---P 317

Query: 294 YKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRG--D 351
            K H    +Y+     + + L+A+ AI  M  +F V  RKI LGMAAYGRGFT+V+   +
Sbjct: 318 VKVH---SQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSN 374

Query: 352 GEQLIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNV 411
            ++ I + +            MWLYNQLP+    E++D  +VS + +D  TKT V YDNV
Sbjct: 375 DKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNV 434

Query: 412 DSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARK--ATAYKDSKLI 469
           +S+K+K +YVK+  L G F WESCGDN  D  R+L+ AFT  +K   K   + Y   + +
Sbjct: 435 ESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEAL 494

Query: 470 QYYL-RTRPEGFLVPM 484
           +YYL +   + FL P 
Sbjct: 495 RYYLEKFGQDEFLSPF 510

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 213/493 (43%), Positives = 294/493 (59%), Gaps = 40/493 (8%)

Query: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPDGE--YTVGVYYSSWSPYKPRLH 80
           ++ F  K  ++ +    R   +   +E   + +    +GE  Y  G+YYSSWSPYKPR H
Sbjct: 32  KLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGYLSGLYYSSWSPYKPRFH 91

Query: 81  YPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM--------------------PM 120
           +P +ID  RV+H+YYAFF+VD KTGK+   D+WSD +M                    P+
Sbjct: 92  FPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNLADNEKPV 151

Query: 121 NLTGMPRGLNGAIGELNYLKTRP----GTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFI 176
            L    +   G IGEL YLK       G+  K+++++GGWSNR+ F  +VRD  KF NFI
Sbjct: 152 QLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLVRDTRKFENFI 211

Query: 177 DSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPR 236
           DSA++ MF YGFDGIDLDWEFPKDDG EP  YLEM S+LR KMD+LE  I+G      P+
Sbjct: 212 DSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGE-TKDHPK 270

Query: 237 FHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKS 296
           F LS+A PAF   L I P+ +M++Y+  WNMMTYDY+G+WSE TGYH NL+N   S +++
Sbjct: 271 FQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGDGSEFRA 330

Query: 297 HLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNV--RGDGEQ 354
                ++E    +N   LNA++AI  M +   V   K+ LGMAAYGR F +V  R   + 
Sbjct: 331 GY---KHEHTAHNN--GLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVDT 385

Query: 355 LIGQKYXXXXXXXXXXX-XMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDS 413
           LI QK+             MWLYNQLPL    E +D  + +A+ YD  ++T + YDNVDS
Sbjct: 386 LINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVDS 445

Query: 414 MKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKAT----AYKDSKLI 469
           +K+K +YV+ ++L G F WESCGD+  +K R+L+  F+  +   RK +     ++  + I
Sbjct: 446 VKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKECI 505

Query: 470 QYYL-RTRPEGFL 481
            YYL R   +GFL
Sbjct: 506 AYYLNRYGTDGFL 518

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  377 bits (969), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 201/448 (44%), Positives = 273/448 (60%), Gaps = 32/448 (7%)

Query: 47  HEETRPVPDAPYPDGEYTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGK 106
           H    P       + +Y  GVYYS WSPY+PR+H+P+NID  ++TH+YY+FF+VD  +  
Sbjct: 35  HHHQPPAQCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSA 94

Query: 107 IGSLDKWSDTKMPMNLTGMPRGLNGAIGELNYLK-TRPGTDFKLMMAVGGWSNREPFHKI 165
           +   D WSD +MPM   G    L G IG LN L+  +PG  FK +MAVGGWSN++ F   
Sbjct: 95  LKLGDSWSDIEMPM---GKNTVLKGCIGALNSLRDEKPG--FKNIMAVGGWSNKDAFPLA 149

Query: 166 VRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDN 225
           +R +        S ++ MF+YGFDGIDLDWE+PKDDG EP++YLE+  ++R  M+ELE  
Sbjct: 150 LRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHMNELEIA 209

Query: 226 IWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSN 285
           IW   G  + RFHLS+A PAF   L  FP++EM++Y+  WNMMTYDY+G WS  TG+HSN
Sbjct: 210 IW---GDKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSN 266

Query: 286 LYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGF 345
           LY+ TN  +  H                L A  AI  MT +  ++ RK+ LGMA YGRGF
Sbjct: 267 LYDGTNK-FSEH---------------SLCADGAIRYMTNKIGINSRKVVLGMALYGRGF 310

Query: 346 TNVR-GDGEQ---LIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPN 401
           TNV+ GD ++   LI +K+            MWLYNQLP+    E FD  + SAY +DP 
Sbjct: 311 TNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPK 370

Query: 402 TKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMK--GARK 459
           TKTLV YDNVDS + K +YV+   LAG F WESCG+ + +  ++LV  F E+++     +
Sbjct: 371 TKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNE 430

Query: 460 ATAYKDSKLIQYYLRT-RPEGFLVPMYR 486
              Y+D KL ++YL+     GFL   ++
Sbjct: 431 TNLYQDPKLREHYLQIFAKSGFLAATFK 458

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  376 bits (966), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/530 (40%), Positives = 296/530 (55%), Gaps = 91/530 (17%)

Query: 23  EMTFLPKLIKEKLSRRI--------RPKPL-----EVHEETRPVPDAPYPDGEYTVGVYY 69
           EM F  KL  +K  +++        + +PL     E+ +          P G YT GVYY
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQG-YTSGVYY 83

Query: 70  SSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNL--- 122
           S+WSPY PR H+P +IDF R++HVYY+FF+V+   GK+   DKWSD +M    P+++   
Sbjct: 84  SNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLG 143

Query: 123 -------------------TGMPRGLNGAIGELNYLK---------TRPGTDFKLMMAVG 154
                              T +P+G    IGE  YL+         T    +FK++M +G
Sbjct: 144 KLKNKVDVYEEPQTQSTIKTNLPKG---CIGEFFYLRNSKLLPTINTENSKNFKMIMTIG 200

Query: 155 GWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSR 214
           GWSNR+ F K+ +  +K +NF+ SAI+ MFEYGFDGIDLDWEFPK++  EP +YL++  +
Sbjct: 201 GWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQ 260

Query: 215 LRHKMDELEDNIWGPGGT-TEPR--FHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYD 271
           LR  M+ELE+ I+       E R  F LS+A+PAF + L + P++EMNK L  WNMMTYD
Sbjct: 261 LRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYD 320

Query: 272 YHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSP 331
           Y+G WSE+TGYHSNLY+ +   +   +               LNA  AI  M E   V P
Sbjct: 321 YNGEWSEKTGYHSNLYDGSKVKHDEEV---------------LNADSAIKYMIETQGVEP 365

Query: 332 RKIALGMAAYGRGFTNVR-----------------GDGEQLIGQKYXXXXXXXXXXXXMW 374
            K+ LG+A YGRG+TNV                  GD E  I  +Y            MW
Sbjct: 366 NKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGD-EVFIDLEYKGVGGESEGEPGMW 424

Query: 375 LYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWES 434
           +YNQLP+    E+FD  +VSAY YD  T TLV YDNV+SM +K +YVKDK LAG F+WES
Sbjct: 425 MYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWES 484

Query: 435 CGDNFKDKDRNLVEAFTENMKGARK--ATAYKDSKLIQYYLRT-RPEGFL 481
           CGD   +  R+L+ AFT  +   +K  ++ ++D K  ++YL     EG+L
Sbjct: 485 CGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYL 534

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  375 bits (964), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 203/452 (44%), Positives = 277/452 (61%), Gaps = 39/452 (8%)

Query: 63  YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM-- 120
           Y++GVYYS+WSPY PRL +P +ID  RV+HVYY+F +VD   G I S D WSD ++ M  
Sbjct: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137

Query: 121 -----------NLTGMPRGLN------GAIGELNYLK-TR------PGTDFKLMMAVGGW 156
                      +   +P  +       G IGE  YL+ TR        TDFK+ M+VGGW
Sbjct: 138 PLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGW 197

Query: 157 SNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLR 216
           SNRE F K+VRD +K + FI+S ID MF YGFDGIDLDWEFP+DDG+EP MYL++  RL+
Sbjct: 198 SNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLK 257

Query: 217 HKMDELEDNIWGPG---GTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYH 273
            KM ELE  I+       T+ P F LS+AAPAF + L I PV++M+K++  WNMMTYDY 
Sbjct: 258 MKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYS 317

Query: 274 GAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRK 333
           G WS+ TGYHSNL++    P  S    +R +    ++ + L   +A+  M +  K+S RK
Sbjct: 318 GEWSDVTGYHSNLFSP---PDVSGSVMKRSQS---NSNETLCGDNAVKYMKDNLKISSRK 371

Query: 334 IALGMAAYGRGFTNVRGD--GEQLIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNV 391
           I LGMAAYGRGF+ V       +L G+K+            +WLYN+LP+    E+FD  
Sbjct: 372 IILGMAAYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKE 431

Query: 392 WVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFT 451
            VSAY YDP +K  V YDN  SM IK +YV+D  L G FLWE+CG+   +   +L+ +FT
Sbjct: 432 SVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFT 491

Query: 452 ENMKGA-RKATAYKDSKLIQYYL-RTRPEGFL 481
            +M    ++ + + + K+++YYL +   +GFL
Sbjct: 492 FDMNNIDKQKSMFSNRKVLEYYLMKYGKQGFL 523

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  369 bits (947), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 204/447 (45%), Positives = 261/447 (58%), Gaps = 38/447 (8%)

Query: 63  YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM-- 120
           Y  G+YYS+WSPY+PRLH+P +IDF++V+H+YYAF ++D +TG + S D+WSDT++ +  
Sbjct: 56  YIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAK 115

Query: 121 --------NLTG-------MPRGLNGAIGELNYLK----TRPGTDFKLMMAVGGWSNREP 161
                     TG         R   G IGELNYL+         + KL+M+VGGWSNRE 
Sbjct: 116 QCREYMFKRFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRES 175

Query: 162 FHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDE 221
           F  +VRDE KF NFI+S I+ M  YGFDGIDLDWEFP+DD YEP  YL M   L+ ++ +
Sbjct: 176 FPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQK 235

Query: 222 LEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTG 281
           LE NI G    +   F LSMA PAF   L I P+ +++KY+ +WN+MTYDY+G WSERTG
Sbjct: 236 LEANILGD--HSNKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTG 293

Query: 282 YHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAY 341
            H+NLYN        H   R  ED G      L+   AI  M  + K+ PRK+ LGMAAY
Sbjct: 294 LHANLYNEKGKLLHLH---RHDEDAG------LSGDAAINYMVNRCKIDPRKVILGMAAY 344

Query: 342 GRGFTNV---RGDGEQLIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSY 398
           GRGFTNV     +     G K+            MWLYNQLP+    EK+D   V AY Y
Sbjct: 345 GRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCY 404

Query: 399 DPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGAR 458
           D  T TLV YDN  S+  K  Y+    L GAF WESCGD  K+  R+L+  +   ++  +
Sbjct: 405 DDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVK 464

Query: 459 --KATAYKDSKLIQYYLRT-RPEGFLV 482
             K T Y  +KL  YYL      GFL 
Sbjct: 465 NNKETIYSTTKLHDYYLENYDTNGFLT 491

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  354 bits (909), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 184/429 (42%), Positives = 260/429 (60%), Gaps = 19/429 (4%)

Query: 63  YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNL 122
           ++ G+YYS+WS Y+PRLH+P  I+F  ++HVYYAFF+VD K GK+ S DKW+D + P  +
Sbjct: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRP--I 115

Query: 123 TGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDA 182
               + + G +GEL  LK +     K +M +GGWSNRE +H    D  K  +F + A+  
Sbjct: 116 LKNNKLVKGNVGELFDLKMK--NRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKM 173

Query: 183 MFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMA 242
           MFEYGFDGIDLDWE+P+DDG EPQ+YLE+  R++H M++LE  I+     T   F LS+A
Sbjct: 174 MFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESEIFKDTSATTSYFELSVA 233

Query: 243 APAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRR 302
            PAF   L IFP++EM+  +  WNMMTYDY+G WSERTGYHSNLY+ +          R 
Sbjct: 234 TPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRH 293

Query: 303 YEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVR------GDGEQLI 356
               G+   + LN   A+  M  Q  +   KI LGMAAYGRGFTNV        +  + I
Sbjct: 294 ----GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRPNESPRYI 348

Query: 357 GQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKI 416
           G+ +            MW Y+QLP+    E+FD  +VS Y ++P T T V YD +DS+++
Sbjct: 349 GRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRV 408

Query: 417 KKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENM---KGARKATAYKDSKLIQYYL 473
           K +Y+K K + G F WESCGD  K+ +R+LV A+ + +      +  + YK+   + +Y 
Sbjct: 409 KTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRDNIKKPESIYKNLHCVSHYK 468

Query: 474 RT-RPEGFL 481
           ++   +GFL
Sbjct: 469 QSFHGKGFL 477

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  353 bits (906), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/502 (39%), Positives = 285/502 (56%), Gaps = 62/502 (12%)

Query: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYPDGE---YTVGVYYSSWSPYKPRL 79
           EM    KL K + S  IR        +   +     P G+   Y  GVYYS+WSPYKPR 
Sbjct: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRF 89

Query: 80  HYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNLTG---MPRGLN-- 130
           H+P +I+ ++V+HVYYAFF +D KTG IGS D WSD +M    P+ +     +   L+  
Sbjct: 90  HFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDN 149

Query: 131 --------GAIGELNYLKTR-PGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAID 181
                   G IGEL YLK    G  FK +M++GGWS+ E F  IV++E+   NF+DS+++
Sbjct: 150 NMQSILPLGCIGELFYLKNACSGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVE 209

Query: 182 AMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSM 241
            MF+ GFDGID+DWEFP+++  EPQ YL++   LR K++ LE  I+  GG+T+  F LS+
Sbjct: 210 TMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIF--GGSTKDHFELSI 267

Query: 242 AAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKR 301
           AAPAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T           
Sbjct: 268 AAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFSET----------- 316

Query: 302 RYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGD-------GEQ 354
                      EL+ + AI  M  +F V+PRK+ LGMAAYGR F +++ D          
Sbjct: 317 -----------ELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDDKFRPFTKNTV 364

Query: 355 LIGQKYX------XXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVY 408
           LI Q++                  +W Y  LP     E++D  +VSAY +D      + Y
Sbjct: 365 LINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGY 424

Query: 409 DNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENM--KGARKATAYKDS 466
           DN +S+K K +YV   +L G F WESCG+++ DK R+L+ AF E +    + K + ++D 
Sbjct: 425 DNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDK 484

Query: 467 KLIQYYLRTRPE-GFLVPMYRH 487
           ++++YYL    + GFL P  +H
Sbjct: 485 RVMKYYLSKYGDGGFLAPYLKH 506

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 196/507 (38%), Positives = 283/507 (55%), Gaps = 73/507 (14%)

Query: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPD-----APYPDGE-YTVGVYYSSWSPYK 76
           EM    K+ K + S +IR      +     VP+      P  DGE +  GVYYS+WSPYK
Sbjct: 30  EMCLYKKIFKNQRSNKIRD---SFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYK 86

Query: 77  PRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNLTG-------- 124
           PR H+P +I+  +V+HVYYAFF ++ +TG I S D WSD +M    P+ +          
Sbjct: 87  PRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNS 146

Query: 125 -------MPRGLNGAIGELNYLK-TRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFI 176
                  +P G    IGEL YLK +  G  FK++M++GGWS+ E F  I+++E     F+
Sbjct: 147 SNDIQKILPLG---CIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFV 203

Query: 177 DSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPR 236
           DS+++ MF+ GFDGIDLDWEFP+++  EPQ YL++   LR K++ LE  I+G G   E  
Sbjct: 204 DSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEG--VEDH 261

Query: 237 FHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKS 296
           F LS+AAPAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T      
Sbjct: 262 FQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSET------ 315

Query: 297 HLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQ-- 354
                           EL+ + AI  M ++F ++ RK+ LGMAAYGR F +++G G Q  
Sbjct: 316 ----------------ELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPF 358

Query: 355 -----LIGQ------KYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTK 403
                LI Q      K             +W Y  LP     E++D  +VSAY +D    
Sbjct: 359 TQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNS 418

Query: 404 TLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKG--ARKAT 461
             + YDN  S+K K EYV   KL G F WESCG+ + ++ R+L+ AF E ++   + K +
Sbjct: 419 IFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPS 478

Query: 462 AYKDSKLIQYYL-RTRPEGFLVPMYRH 487
            +++ +++ +YL +    GFL P  +H
Sbjct: 479 MFENERVVNFYLNKYGNNGFLTPYLKH 505

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  332 bits (850), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/460 (41%), Positives = 260/460 (56%), Gaps = 55/460 (11%)

Query: 64  TVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM--- 120
           T G+YYS+WSPYK R H+P +IDF+R+T V+Y+F VV+ +TG+    D+WSD +M +   
Sbjct: 72  TSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYKQ 131

Query: 121 -----------------NLTGMPRGLNGAIGELNYLK-----TRPG-----TDFKLMMAV 153
                            +   +P G    IGEL YLK     ++ G      +FK +M+V
Sbjct: 132 MFSAFEKVDLKRQFPQSSRNDLPLG---CIGELFYLKYTDFLSKMGGPEDVKNFKTIMSV 188

Query: 154 GGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCS 213
           GGWSNRE F  +V+   K   FI+S +D MF+YGFDGID+DWEFPK+D  EP+ YL+M  
Sbjct: 189 GGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAYLDMMR 248

Query: 214 RLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYH 273
            LR K+D+LE +I+G    T+  F L+ A  A P  L   P+ E+++Y+  WN+M YD+ 
Sbjct: 249 SLRKKLDDLESDIFGTEKHTQ-HFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMAYDFS 307

Query: 274 GAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRK 333
           GAWS  T Y SNLY+      +S L KR       +N +  +A  A+ ++  + K+  +K
Sbjct: 308 GAWSRHTAYQSNLYS------RSSLGKRS------ENSEGGSADTAVRLLLNKHKLPAKK 355

Query: 334 IALGMAAYGRGFTNV---RGDGEQLIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDN 390
           I LGM AYGRGF  V         +IGQ +            + LYNQLPL  G E FD 
Sbjct: 356 IVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEWFDQ 415

Query: 391 VWVSAYSY----DPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNL 446
             VSAYS     +     LVVYDNV SMKIK +YV    L G F WESCG+N+ D  R+L
Sbjct: 416 DAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSL 475

Query: 447 VEAFTENMKGARKA--TAYKDSKLIQYYLRTRPEGFLVPM 484
             AFT+ +K   K   T Y   ++ +YY +  P+GFL  +
Sbjct: 476 TRAFTQEIKYLNKTVPTIYALPQVGEYYHKKYPDGFLASI 515

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  332 bits (850), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/501 (38%), Positives = 275/501 (54%), Gaps = 61/501 (12%)

Query: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPDAPYP-DGE--YTVGVYYSSWSPYKPRL 79
           EM    K+ K + S  IR       ++   +     P DG   Y  GVYYS+WSPY PR 
Sbjct: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDGGKGYVSGVYYSNWSPYTPRF 89

Query: 80  HYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNLTG---MPRGLN-- 130
           H+P +I+  +V+HVYYAFF ++ KTG I S D WSD +M    P+ +     +   LN  
Sbjct: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLNDS 149

Query: 131 -------GAIGELNYLKTRPG-TDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDA 182
                  G +GEL YLK       FK++M++GGWS+ E F  IV D++   NF+DS+++ 
Sbjct: 150 VQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVET 209

Query: 183 MFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMA 242
           MF+ GFDGID+DWEFP+++  EPQ YL++   LR K++ LE  I+G   + E  F +S+A
Sbjct: 210 MFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGE--SIEDHFQISIA 267

Query: 243 APAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLDKRR 302
           APAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T            
Sbjct: 268 APAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSET------------ 315

Query: 303 YEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQ-------L 355
                     EL+ + A+  M ++F V   K+ LGMAAYGR F +++    Q       L
Sbjct: 316 ----------ELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQPFTQNTVL 364

Query: 356 IGQKYX------XXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYD 409
           I Q +                  +W Y  LP     E++D  +VSAY +D      + YD
Sbjct: 365 INQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYD 424

Query: 410 NVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMK--GARKATAYKDSK 467
           N  S K K EYV   KL G F WESCG+   +K R+L+ AF E ++   + K + ++D +
Sbjct: 425 NTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMR 484

Query: 468 LIQYYL-RTRPEGFLVPMYRH 487
           +I++YL +   +GFL P  +H
Sbjct: 485 VIKFYLNKYGDDGFLSPYLKH 505

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  328 bits (840), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/461 (40%), Positives = 264/461 (57%), Gaps = 52/461 (11%)

Query: 63  YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM---- 118
           +  G+YYS+WSPY  R H+P +IDF+++THVYYAF VV+ +TG+    D+WSD +M    
Sbjct: 71  FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK 130

Query: 119 -------PMNLTG-MPRGLN-----GAIGELNYLK-----TRPG-----TDFKLMMAVGG 155
                   ++L    P G       G IGEL +LK     TR G      +FK +M+VGG
Sbjct: 131 QMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGG 190

Query: 156 WSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRL 215
           WSNRE F  +V    K   F+DS +  MFEYGFDGID+DWEFPK+D  EP++YL+M   L
Sbjct: 191 WSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKAL 250

Query: 216 RHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGA 275
           R ++D LE  I+G     +  F L+ A  A  + L   P++E ++Y+  WN+M YD+ GA
Sbjct: 251 RERLDTLESQIFGS-KDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGA 309

Query: 276 WSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIA 335
           WS +T Y SNLY    +P K+  +KR     G       +A  A+  +T++ K++ +KI 
Sbjct: 310 WSAQTAYQSNLY----TPAKT--NKRSTNGRG-------SADKAVRFLTDKSKLASKKIV 356

Query: 336 LGMAAYGRGFTNVRGDG---EQLIGQKYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVW 392
           LGM AYGRGF  V       E +IG+ +            + LY QLPL  G E FD+  
Sbjct: 357 LGMPAYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNA 416

Query: 393 VSAY----SYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVE 448
           VSAY    S++     L+VYDNVDSM  K  YV+   L G F WESCG+++K K  +LV 
Sbjct: 417 VSAYCVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKGK--SLVG 474

Query: 449 AFTENMKGARKA--TAYKDSKLIQYYLRTRPEGFLVPMYRH 487
           AFT+ +K   K   T Y   +++Q+YL+  P GFL   +++
Sbjct: 475 AFTKEIKCLNKTEPTIYSLPEVVQHYLKLHPGGFLASTFQN 515

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  327 bits (838), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/506 (37%), Positives = 272/506 (53%), Gaps = 71/506 (14%)

Query: 23  EMTFLPKLIKEKLSRRIRPK--------PLEVHEETRPVPDAPYPDGEYTVGVYYSSWSP 74
           EM    K+ K + S  IR          P  V      + D  +       GVYYS+WSP
Sbjct: 30  EMCLYNKIFKNQRSDDIRDNFNNGGHRVPSNVQNHGTHIRDEAF-----ISGVYYSNWSP 84

Query: 75  YKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM-------NLTGMPR 127
           YKPR H+P +I+ ++V+H+YYAFF ++ +TG I + D WSD +M +       N   +  
Sbjct: 85  YKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSELIKE 144

Query: 128 GLN---------GAIGELNYLK-TRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFID 177
             N         G IGEL YLK T     FK++M++GGWS+ E F  I++D++   NF+D
Sbjct: 145 SSNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSIGGWSDSENFKIIIKDDKLLQNFVD 204

Query: 178 SAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRF 237
           S+++ MF  GFDGIDLDWEFP ++  EP+ YL++   LR K++ LE  I+G    TE  F
Sbjct: 205 SSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIFGK--RTEDHF 262

Query: 238 HLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSH 297
            LS+AAPAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T       
Sbjct: 263 QLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFSET------- 315

Query: 298 LDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQLIG 357
                          ELN + A+  M ++F V+ RK+ LGMAAYGR F +++ +  +   
Sbjct: 316 ---------------ELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF-HIKDNKFEPFN 359

Query: 358 Q-------------KYXXXXXXXXXXXXMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKT 404
           Q             K             +W Y  LP     E++D  +VSAY +D     
Sbjct: 360 QNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSI 419

Query: 405 LVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENM--KGARKATA 462
            + YDN  S+K K EYV    L G F WESCG+ + ++ R+L+ AF E +    + K + 
Sbjct: 420 FISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSI 479

Query: 463 YKDSKLIQYYLRTRPE-GFLVPMYRH 487
           ++D ++ +YYL    + GFL P  +H
Sbjct: 480 FQDVRVKKYYLNKYGDGGFLSPYLKH 505

>TDEL0A06900 Chr1 (1204342..1207410) [3069 bp, 1022 aa] {ON}
           Anc_6.277 YMR189W
          Length = 1022

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 37/89 (41%), Gaps = 3/89 (3%)

Query: 120 MNLTGMPRGLNGAIGELNYLKTRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSA 179
           M   G+P     A    NY+ TR    +K++    G SN+   H+ + D   + N    A
Sbjct: 829 MGSEGLPFSSVIASLNANYMMTRLKEHYKILFITNGGSNKHCAHEFIIDLRDYKNKGVEA 888

Query: 180 IDA---MFEYGFDGIDLDWEFPKDDGYEP 205
           ID    + +YGF    L +  P     EP
Sbjct: 889 IDIAKRLQDYGFHAPTLAFPVPGTLMVEP 917

>KLTH0H11242g Chr8 complement(963370..964194) [825 bp, 274 aa] {ON}
           similar to uniprot|P38336 Saccharomyces cerevisiae
           YBR257W POP4 Subunit of both RNase MRP which cleaves
           pre- rRNA and nuclear RNase P which cleaves tRNA
           precursors to generate mature 5' ends binds to the RPR1
           RNA subunit in Rnase P
          Length = 274

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 2/83 (2%)

Query: 401 NTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARKA 460
           +T  L+  D   S ++KK+  K + L+G  +  S    +++ ++N   A    + GARKA
Sbjct: 31  DTLLLLPTDGGLSSRLKKKNGKLRLLSGEHIKNSTHSAYREINKNSKHALKSYINGARKA 90

Query: 461 TAYKDSKLIQYYLRTRPE--GFL 481
           ++       +  LR RPE  G+L
Sbjct: 91  SSTAKRIASEKNLRERPELLGYL 113

>KNAG0F00310 Chr6 (36504..38312) [1809 bp, 602 aa] {ON} Anc_1.54
           YDR506C
          Length = 602

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 196 EFPKD-DGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHLSMAAPAFPQTLGIFP 254
           EFP +  G + Q++      L   +D L+ ++WGP G  +PR   S+   +    + +F 
Sbjct: 190 EFPVNLSGVQEQVFTLSDYYLDGNLDILKSSVWGPEGGPDPRVEESLINGSAQDNV-VFL 248

Query: 255 VEEMNKYLSM 264
           +E  +KYL +
Sbjct: 249 LEGSSKYLKL 258

>KLLA0D13882g Chr4 (1194407..1195705) [1299 bp, 432 aa] {ON} similar
           to uniprot|P33767 YEL002C Saccharomyces cerevisiae WBP1
           wheat germ agglutinin-binding protein oligosaccharyl
           transferase glycoprotein complex beta subunit
          Length = 432

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 3/80 (3%)

Query: 227 WGPGGTTEPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGY-HSN 285
           W P  T + +F L +  P +  TL      E  +Y S  N    D+HG ++  T Y  S 
Sbjct: 307 WSPFTTNDVQFELRLVDPYYRLTLNASRRTEDTQYYSTGNFKLPDHHGMFTFLTDYKRSG 366

Query: 286 LYNATNSPYKS--HLDKRRY 303
           L   T S  K+  HL    Y
Sbjct: 367 LSFITESDTKAIRHLANDEY 386

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.138    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,889,386
Number of extensions: 2647741
Number of successful extensions: 5902
Number of sequences better than 10.0: 28
Number of HSP's gapped: 5926
Number of HSP's successfully gapped: 31
Length of query: 490
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 376
Effective length of database: 40,409,475
Effective search space: 15193962600
Effective search space used: 15193962600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)