Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL165C5.442ON33133117380.0
Ecym_45135.442ON33333713770.0
Kwal_55.213995.442ON32932912631e-175
KLTH0F15884g5.442ON32932912621e-175
SAKL0G02706g5.442ON33232912531e-174
Smik_4.6385.442ON34634412491e-173
Skud_4.6415.442ON34634412411e-172
YDR372C (VPS74)5.442ON34534312401e-172
Suva_2.5445.442ON34634412361e-171
KLLA0E02355g5.442ON32433112261e-170
KAFR0D050605.442ON32633012251e-170
KNAG0B042005.442ON34434212201e-169
TDEL0D025905.442ON33033212171e-168
Kpol_1016.25.442ON32833011841e-163
TBLA0A064805.442ON33433411841e-163
ZYRO0F10208g5.442ON33232911831e-163
CAGL0A02926g5.442ON32833011811e-163
NDAI0B057205.442ON36531711631e-160
NCAS0F034305.442ON33233111581e-159
TPHA0J026105.442ON32932611171e-153
Kpol_1062.245.442ON2762768931e-120
TBLA0A027805.442ON3873038381e-110
NCAS0H020905.442ON3452835806e-72
Ecym_71028.605ON1029178810.18
TPHA0O019802.2ON104761750.97
TBLA0E040708.605ON111880685.5
CAGL0I04950g7.380ON143974678.0
KLLA0E17425g3.211ON249364679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL165C
         (331 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   674   0.0  
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   535   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   491   e-175
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   490   e-175
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   487   e-174
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   485   e-173
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   482   e-172
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   482   e-172
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   480   e-171
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   476   e-170
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   476   e-170
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   474   e-169
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   473   e-168
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   460   e-163
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   460   e-163
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   460   e-163
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   459   e-163
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   452   e-160
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   450   e-159
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   434   e-153
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   348   e-120
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   327   e-110
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   228   6e-72
Ecym_7102 Chr7 (197436..200525) [3090 bp, 1029 aa] {ON} similar ...    36   0.18 
TPHA0O01980 Chr15 complement(393699..396842) [3144 bp, 1047 aa] ...    33   0.97 
TBLA0E04070 Chr5 (1022909..1026265) [3357 bp, 1118 aa] {ON} Anc_...    31   5.5  
CAGL0I04950g Chr9 (450298..454617) [4320 bp, 1439 aa] {ON} simil...    30   8.0  
KLLA0E17425g Chr5 complement(1543158..1550639) [7482 bp, 2493 aa...    30   9.4  

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/331 (100%), Positives = 331/331 (100%)

Query: 1   MSLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVL 60
           MSLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVL
Sbjct: 1   MSLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVL 60

Query: 61  LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS 120
           LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS
Sbjct: 61  LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS 120

Query: 121 KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL 180
           KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL
Sbjct: 121 KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL 180

Query: 181 RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA 240
           RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA
Sbjct: 181 RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA 240

Query: 241 LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV 300
           LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV
Sbjct: 241 LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV 300

Query: 301 QEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           QEELDRNPGTALNLEVVAGVLKVYSRMDDLL
Sbjct: 301 QEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/337 (77%), Positives = 298/337 (88%), Gaps = 10/337 (2%)

Query: 1   MSLQRRRVNKTAGNETVGGASL------NRSDEEEGMTHKVAYDPEEQKLRENTREPTLT 54
           MSLQRRRVNK      VGG S+      +  DE++  +HKVAYDPE+QKLRENT+EPTLT
Sbjct: 1   MSLQRRRVNKAE----VGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLT 56

Query: 55  LMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLI 114
           LMEEVLLMGLKDKEGYLSF N++ISY+LRGCILIELALRG+I+VV+DA R+RFD SERL+
Sbjct: 57  LMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLV 116

Query: 115 EVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGL 174
           EV++ SKTGEALLDE L+LMK +EPL+IVNW+DLLSGETWN LKI+YQL+QVRERLAKGL
Sbjct: 117 EVIETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGL 176

Query: 175 VDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFK 234
           VDKGVLRTEMKNFFLFDM THPVAD+SCKESIKRR+LSVLVPRNV L YTE FPE+VAFK
Sbjct: 177 VDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFK 236

Query: 235 YLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISV 294
           YLRTIALIC A+GANVLE VLS+LDYEKR+RGFSRAEE+L QFSQYPFALDKD+ETGISV
Sbjct: 237 YLRTIALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISV 296

Query: 295 NLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           NL   V+EE+ +NPGT L LEVVAGV +V+SRMD+ L
Sbjct: 297 NLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  491 bits (1263), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 275/329 (83%), Gaps = 3/329 (0%)

Query: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62
           LQRRRVNK+  N          S+E EG + +VAYDPEE  L++N   P L LMEEVLLM
Sbjct: 4   LQRRRVNKSESNYDSEPVI---SEEAEGESKRVAYDPEEAMLKDNATIPKLNLMEEVLLM 60

Query: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122
           GLKDKEGYLSF N+NISYALRGCILIELALRG+IQVV+D+ R+RFD SERL+EV++ +KT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATKT 120

Query: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182
           GE LLDEAL LMK  EPLTI NW+DLLSGETWNF+KI+YQL+QVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242
           EMKNFFLFDMPTHP+ DTSCKE+IKRRILSVLV RN++L Y E FP +V+FK LRT++LI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSLI 240

Query: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302
           C A+GANVLE VL +LDYEKRDR FSRA+E+L QFSQ+PFALDK  ETGISVN+N+ +QE
Sbjct: 241 CGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQE 300

Query: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           E+D N    L LEVVAGV +V+SRMD LL
Sbjct: 301 EIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  490 bits (1262), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/329 (72%), Positives = 276/329 (83%), Gaps = 3/329 (0%)

Query: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62
           LQRRRVNK+   E++       +DE +G   +VAYDPEE KLR++T  P L LMEEVLLM
Sbjct: 4   LQRRRVNKS---ESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60

Query: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122
           GLKDKEGYLSF N+NISYALRGCILIELALRG+IQV++D  R+RFD SERL+EV++ +KT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120

Query: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182
           GE LLDEAL LMK  EPLTI NW+DLLSGETWNF+KI+YQL+QVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242
           EMKNFFLFDMPTHP+ DTSCKE+IKRRILSVLV RN++L Y E FP +V FK +RT++LI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240

Query: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302
           C A+GANVLE VLS+LDYEKRDR FSRA+E+L QFSQ+PFALDK  ETGISVNLN+ VQE
Sbjct: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300

Query: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           E+  N   +L LE VAGV +V+SRMD LL
Sbjct: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  487 bits (1253), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/329 (71%), Positives = 274/329 (83%)

Query: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62
           LQRRRVN+T  +      + + S++E     KVAYDPEE KL+ENT  P LTLMEEVLLM
Sbjct: 4   LQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEVLLM 63

Query: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122
           GLKDKEGYLSF N+NISYALRGCILIELALR +I+V+DD  R+RFD S+RLIEV+DGSKT
Sbjct: 64  GLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDGSKT 123

Query: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182
           GE LLDEAL L+K  EPL I NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLRT
Sbjct: 124 GEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 183

Query: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242
           EMKNFFLFDM THP+ DTSCKE+IKRR+LSVLV RN+EL Y E F E + FK +RT++LI
Sbjct: 184 EMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTLSLI 243

Query: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302
           C A+GANVLE VL++LDY+KRDR FSRA+E+L QFS++PFALDK  E+GISVNLN+ VQ 
Sbjct: 244 CGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKEVQA 303

Query: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           E+ +NPG  L LEVVAGV +V+SRMD LL
Sbjct: 304 EIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 281/344 (81%), Gaps = 14/344 (4%)

Query: 2   SLQRRRVNK-----------TAGNETVGG---ASLNRSDEEEGMTHKVAYDPEEQKLREN 47
           +LQRRRVN+           +A N    G   AS+   D++ G   K+AYDPEE KLR+N
Sbjct: 3   TLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLRDN 62

Query: 48  TREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRF 107
              PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCI+IELALRG+I+++DD+ R+RF
Sbjct: 63  INIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRF 122

Query: 108 DPSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVR 167
           D SERLIEV+DGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVR
Sbjct: 123 DLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 168 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELF 227
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E F
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 228 PETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKD 287
           PET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  SRAEE++ QFSQ+PF L+K+
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302

Query: 288 IETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
            E GISVNLN+ V+EE++ NPG  L LEV+AGV +V+SRMD LL
Sbjct: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  482 bits (1241), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/344 (67%), Positives = 280/344 (81%), Gaps = 14/344 (4%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSD--------------EEEGMTHKVAYDPEEQKLREN 47
           +LQRRRVN+    +T    S++ +D              ++ G   K+AYDPEE KLR+N
Sbjct: 3   TLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLRDN 62

Query: 48  TREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRF 107
            + PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCILIELALRG+I+++DD+ R+RF
Sbjct: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122

Query: 108 DPSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVR 167
           D SERL+EVVDGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVR
Sbjct: 123 DLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 168 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELF 227
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E F
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 228 PETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKD 287
           PET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  +RAEE++ QFSQYPF L+K+
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLEKE 302

Query: 288 IETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
            E G+SVNLN+ V+EE++ N G  L LEV+AGV +V+SRMD LL
Sbjct: 303 TELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 232/343 (67%), Positives = 280/343 (81%), Gaps = 13/343 (3%)

Query: 2   SLQRRRVNK----------TAGNETVGGASLNRS---DEEEGMTHKVAYDPEEQKLRENT 48
           +LQRRRVN+          ++ N T G    N +   D++ G   K+AYDPEE KLR+N 
Sbjct: 3   TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNI 62

Query: 49  REPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFD 108
             PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCI+IELALRG+I+++DD+ R+RFD
Sbjct: 63  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 122

Query: 109 PSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRE 168
            SERLIEV+D SKTGE LLDE L LMK  EPL+I NW+DLLSGETWN LKINYQL+QVRE
Sbjct: 123 LSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRE 182

Query: 169 RLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFP 228
           RLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E FP
Sbjct: 183 RLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFP 242

Query: 229 ETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDI 288
           ET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  SRAEE++ QFSQYPF L+K+ 
Sbjct: 243 ETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKET 302

Query: 289 ETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           E G+SVNLN+ V+EE++ NPG  L LEV+AGV +V+SRMD LL
Sbjct: 303 ELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  480 bits (1236), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/344 (66%), Positives = 279/344 (81%), Gaps = 14/344 (4%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSD--------------EEEGMTHKVAYDPEEQKLREN 47
           +LQRRRVN+    +T    S + +               ++ G+  K+AYDPEE KLR+N
Sbjct: 3   TLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLRDN 62

Query: 48  TREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRF 107
            + PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCILIELALRG+I+++DD+ R+RF
Sbjct: 63  IKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARKRF 122

Query: 108 DPSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVR 167
           D SERL+EV+DGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVR
Sbjct: 123 DLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182

Query: 168 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELF 227
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E F
Sbjct: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242

Query: 228 PETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKD 287
           PET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  SRAEE++  FSQYPF L+KD
Sbjct: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLEKD 302

Query: 288 IETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
            + G+SVNLN+ V+EE++ NPG  L LEV+AGV +V+SRMD LL
Sbjct: 303 TDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  476 bits (1226), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/331 (69%), Positives = 272/331 (82%), Gaps = 7/331 (2%)

Query: 1   MSLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVL 60
           MSLQRRRVNK    E     S+ + D E    HK+ YD +E KLR+NT  P LTLMEEVL
Sbjct: 1   MSLQRRRVNKGDTTE-----SIPQIDNEHD--HKIVYDEQEAKLRDNTSVPKLTLMEEVL 53

Query: 61  LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS 120
           LMGLKDK+GYLSF N+NISYALRGCILIELALRG+I+ VDD  R+R+D SERLIEV+DGS
Sbjct: 54  LMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGS 113

Query: 121 KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL 180
           KTGE LLDE+L+LMK   P +IV W+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVL
Sbjct: 114 KTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVL 173

Query: 181 RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA 240
           RTEMKNFFLFDM THP+ DT+CKESIKRRILS+LV RN EL Y   FP+ V+FKY+RT++
Sbjct: 174 RTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLS 233

Query: 241 LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV 300
           LIC A+GANVLE VL+TLDYE RD GF+RA+E+L QFS++PF LDK   TG+SVNLN+ +
Sbjct: 234 LICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEI 293

Query: 301 QEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
            +EL+ +PG+ L LEVVAGV +V+SRMD LL
Sbjct: 294 SQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  476 bits (1225), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 269/330 (81%), Gaps = 6/330 (1%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLL 61
           +LQRRR N++  N      S N S   E    KVAYDPEE KLR+N   P LTLMEEVLL
Sbjct: 3   TLQRRRKNRSDSN---ADDSENVS---ESQDRKVAYDPEEAKLRDNVSIPKLTLMEEVLL 56

Query: 62  MGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSK 121
           MGL+D+EGYLSF N+NISYALRGCILIELALR +I+++DD+ R+RFD SERL+EV+DGSK
Sbjct: 57  MGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDGSK 116

Query: 122 TGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLR 181
           TGE LLDEAL LMK  EPLTI NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLR
Sbjct: 117 TGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 176

Query: 182 TEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIAL 241
           TEMKNFFLFDM THPV DTSCKE+IKRRILS LV RN+EL Y   F ET +FKY+R +AL
Sbjct: 177 TEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVAL 236

Query: 242 ICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQ 301
           +C ++GANVLE VLS+LDYEKRDR  SRAEE+L QF+QYPF L K+ E GISVNLN+ V+
Sbjct: 237 VCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVE 296

Query: 302 EELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
            E++ NP   L LEV+AGV++V+SRMD LL
Sbjct: 297 NEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  474 bits (1220), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 233/342 (68%), Positives = 280/342 (81%), Gaps = 12/342 (3%)

Query: 2   SLQRRRVNKTAGNE--TVGG-------ASLNRSDEEE---GMTHKVAYDPEEQKLRENTR 49
           +LQRRRVN++  NE  TV G       ++ N ++E E   G T KVAYDPEE KLR+N  
Sbjct: 3   TLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDNYT 62

Query: 50  EPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDP 109
            P LTLMEEVLLMGL+D+EGYLSF N+NISYALRGCI+IELALR +I+++DD+ R+RFD 
Sbjct: 63  VPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRFDI 122

Query: 110 SERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRER 169
           SERL+EVVDGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN +KINYQL+QVRER
Sbjct: 123 SERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVRER 182

Query: 170 LAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPE 229
           LAKGLVDKGVLRTEMKNFFLFDM THPV D+SCKE+IKRRILS +V RN+EL +   FPE
Sbjct: 183 LAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYFPE 242

Query: 230 TVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIE 289
           + +FKY+RT+AL+CS +GA+VLE VLS+LDYE+RDR  SRAEELL +F QYPF L+K  +
Sbjct: 243 STSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQGD 302

Query: 290 TGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           +GIS NLN+  Q E+D +P +AL LEVVAGV++V+SRMD LL
Sbjct: 303 SGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  473 bits (1217), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 276/332 (83%), Gaps = 6/332 (1%)

Query: 2   SLQRRRVNKT-AGNETVGGASLNRSDEEEGMTHK-VAYDPEEQKLRENTREPTLTLMEEV 59
           +LQRRRVN+  +G+E    +SL  S+  E  T K VAYDPEE K+ EN + P LTLMEEV
Sbjct: 3   NLQRRRVNRVDSGDE----SSLQASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEV 58

Query: 60  LLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDG 119
           LL+GL+DKEGYLSF N+NISYALRGCI+IELALRG+I+++DD+ R+RFD SERLIEVVD 
Sbjct: 59  LLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118

Query: 120 SKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGV 179
           SKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGV
Sbjct: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178

Query: 180 LRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTI 239
           LRTEMKNFFLFDM THPV DTSCKE++KRR+LSVLV RN+EL Y E FP+T +FK +RTI
Sbjct: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238

Query: 240 ALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRL 299
           ALIC ++ ANVLE VL++LDYEKRDR  SRA+E+L Q++QYPF LDK  E+G+S+NLN+ 
Sbjct: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298

Query: 300 VQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           V+EEL +N    L LEVVAGV +V+SRMD LL
Sbjct: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  460 bits (1184), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 217/330 (65%), Positives = 268/330 (81%), Gaps = 4/330 (1%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLL 61
           SLQRRR+N+   +     A  +  DEE   + K+AYDPEE KL+++   PTLTLMEEV+L
Sbjct: 3   SLQRRRLNRINSD----TAESSNDDEERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEVVL 58

Query: 62  MGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSK 121
           +GL DK+GYLSF N+NISY LRGCI+IELALR +I+++DD  R+RFD SERL+EVVDGSK
Sbjct: 59  LGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSK 118

Query: 122 TGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLR 181
           TGE LLDEAL LMK  EPL+I NW+DLLSGETWNF KINYQL+QVRER++KGLVDKGVLR
Sbjct: 119 TGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLR 178

Query: 182 TEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIAL 241
           TEMKNFFLFDM THPV DTSCKE+IKRRILS LV R +EL Y E FPET  +K +RTIAL
Sbjct: 179 TEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIAL 238

Query: 242 ICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQ 301
           ICS++ ANVLE VLS+L+YEKRD   +R+E +L +F+QYPF LDK  +  +S+NL++LV+
Sbjct: 239 ICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVE 298

Query: 302 EELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           +E+ +NPG+AL LE VAGV  V+S+MD +L
Sbjct: 299 DEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  460 bits (1184), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/334 (66%), Positives = 273/334 (81%), Gaps = 6/334 (1%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSDEE----EGMTHKVAYDPEEQKLRENTREPTLTLME 57
           +LQRRR  K A +++VG +  + +D E    +  + +VAYDPEE K+R N   P LTLME
Sbjct: 3   TLQRRR--KQARSDSVGSSGTDSNDNEPTNRQAESRRVAYDPEEDKIRNNMSVPQLTLME 60

Query: 58  EVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVV 117
           EV+L+GL+DKEGYLSF N+NISYALRGCI+IELALRG+I+++DD  R+RF+ SERL+EVV
Sbjct: 61  EVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEVV 120

Query: 118 DGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDK 177
           D SKTGE LLDEAL +M+  EPL I NW+DLLSGETWN  KINYQL+QVRER++KGLVDK
Sbjct: 121 DSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVDK 180

Query: 178 GVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLR 237
           GVLRTEMKNFFLFDM THPV D+SCKE+IKRRILS+LV R  E  Y + FPET +FKY+R
Sbjct: 181 GVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYIR 240

Query: 238 TIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLN 297
           TI+LICSA+GANVLE VL++L+Y+KRD G +RAEELL QFSQYPF L+K  E G S+NLN
Sbjct: 241 TISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINLN 300

Query: 298 RLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
            LV+EE++ +P  AL LEVVAGV +V+S+MD LL
Sbjct: 301 ALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  460 bits (1183), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 227/329 (68%), Positives = 267/329 (81%)

Query: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62
           LQRRRVN+   + +    +     +E+  + KVAYDPEE KL +N   P LTLMEEVLL+
Sbjct: 4   LQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEVLLL 63

Query: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122
           GL+DKEGYLSF N+NISYALRGCI+IELALRG+I+VVDD+ R+RFD SERLIEV D SKT
Sbjct: 64  GLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKT 123

Query: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182
           GE LLDEAL LMK  EPL+I NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLRT
Sbjct: 124 GEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRT 183

Query: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242
           EMKNFFLFDM THPV DTSCKE+IKRRILSVLVPRN+EL Y + F E V+FK +RTIALI
Sbjct: 184 EMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALI 243

Query: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302
           C A+ ANVLE VL++L YEKRD    RA+E+L QFS+YPF LD   E+GIS+NLN+ V +
Sbjct: 244 CGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQ 303

Query: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           EL ++P + L LEV+AGV +V+SRMD LL
Sbjct: 304 ELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  459 bits (1181), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 271/330 (82%), Gaps = 4/330 (1%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLL 61
           +LQRRRVNK+   E       +R D+    + K+AYDPEE KL+ ++++PTLTLMEEVLL
Sbjct: 3   TLQRRRVNKS---ENASNGIEDREDDGTS-SGKIAYDPEESKLQNDSKQPTLTLMEEVLL 58

Query: 62  MGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSK 121
           MGL+D+EGYLSF N++ISYALRGCILIELALR +I+++D   R RFD SERLIEV+D SK
Sbjct: 59  MGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSK 118

Query: 122 TGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLR 181
           TGE LLDE L LM   EPL+I NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLR
Sbjct: 119 TGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 178

Query: 182 TEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIAL 241
           TEMKNFFLFDM THPV+D+SCKE+IKRRILSVLV RN+E+ Y   FPE+  FK +RT++L
Sbjct: 179 TEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSL 238

Query: 242 ICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQ 301
           I  A+GANVLE V+S+L+Y+KRD+  +RAEE+L QFSQYPF L K+ + GISVNLN+ +Q
Sbjct: 239 IAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQ 298

Query: 302 EELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           EEL+ NPG+ L LEV+AGV +V+SRMD LL
Sbjct: 299 EELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  452 bits (1163), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/317 (69%), Positives = 254/317 (80%), Gaps = 17/317 (5%)

Query: 32  THKVAYDPEEQKL-----------------RENTREPTLTLMEEVLLMGLKDKEGYLSFL 74
           + K+AYDPEE KL                   N   PTLTLMEEVLLMGL+DKEGYLSF 
Sbjct: 49  SSKIAYDPEEAKLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFW 108

Query: 75  NENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKTGEALLDEALTLM 134
           N+NISYALRGCILIELALRG+I+++DD+ R+RFD SERLIEV DGSKTGE LLDE L LM
Sbjct: 109 NDNISYALRGCILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLM 168

Query: 135 KGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRTEMKNFFLFDMPT 194
           K  EPLTI NW+DLLSGETWN +KINYQL+QVRERLAKGLVDKGVLRTEMKNFFLFDM T
Sbjct: 169 KNDEPLTIANWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMAT 228

Query: 195 HPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALICSAHGANVLEKV 254
           HPV D+SCKE+IKRR+LSVLV RN+E  Y E FP+   FK +RTIALIC A+GANVLE V
Sbjct: 229 HPVTDSSCKEAIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENV 288

Query: 255 LSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQEELDRNPGTALNL 314
           LS+LDYEK D   +RA+EL+ QFS++PF L+K   T +SVNLNRLVQ+ELD NPG  L L
Sbjct: 289 LSSLDYEKSDNAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQL 348

Query: 315 EVVAGVLKVYSRMDDLL 331
           EV+AGV++V+SRMD LL
Sbjct: 349 EVIAGVIEVFSRMDTLL 365

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  450 bits (1158), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 218/331 (65%), Positives = 265/331 (80%), Gaps = 2/331 (0%)

Query: 2   SLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRE-NTREPTLTLMEEVL 60
           +LQRRRVNK   +   G  + N   + +   +KVAYDPEE ++R    + P LTLMEEVL
Sbjct: 3   TLQRRRVNKDDSDNETGSVTPNVERDSDN-DNKVAYDPEEARMRNVGGQVPVLTLMEEVL 61

Query: 61  LMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGS 120
           LMGL+DKEGYLSF N+NISYALRGCILIELALRG+IQ++DD+ R+RF+ SERL++V+DG+
Sbjct: 62  LMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDGT 121

Query: 121 KTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVL 180
           KTGE LLDE L LMK  EPL+I +W+DLLSGETWN +KINYQL+QVRERLAKGLVDKGVL
Sbjct: 122 KTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVL 181

Query: 181 RTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIA 240
           RTEMKNFFLFDM THPV D+SCKE+IKRR+LS+LV RN+EL Y   FPET  FK +RTIA
Sbjct: 182 RTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTIA 241

Query: 241 LICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLV 300
           LIC A+GANVLE +L +LD+E  D   +RA+EL+ QFS++PF L+     GISVNLNR V
Sbjct: 242 LICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNREV 301

Query: 301 QEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           Q+EL   PG  L LEV+AGV++V+SRMD LL
Sbjct: 302 QQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  434 bits (1117), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/326 (63%), Positives = 258/326 (79%), Gaps = 3/326 (0%)

Query: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62
           +QRRR+N+ + NE     S N  D+      KVA+DPEE K++++   P LTLMEEV+L+
Sbjct: 4   VQRRRINRIS-NEDESDHSDN--DQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEEVVLL 60

Query: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122
           GL D EGYLSF N+NISY LRGCILIELALRG+I+++DD+ R+ FD SERLIEV+D SKT
Sbjct: 61  GLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASKT 120

Query: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182
           GE LLDE L LMK  EP +IV+W+DLLSGETWNF K+NYQL+QVRERL+KGLVDKGVLRT
Sbjct: 121 GEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRT 180

Query: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242
           EMKNFFLFDM THPVAD+SCKES+KRRI+S LV R + LQY E FPE+  FK +RT++LI
Sbjct: 181 EMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLI 240

Query: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302
            +A+ ANVLE VL+TL+YEKRD+  SRAE LL  F  YPF L  + +  IS+NLN+LV++
Sbjct: 241 ITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVED 300

Query: 303 ELDRNPGTALNLEVVAGVLKVYSRMD 328
           E+  NP TAL LEV+AGV  V+++MD
Sbjct: 301 EIKANPKTALQLEVLAGVFDVFAKMD 326

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  348 bits (893), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 169/276 (61%), Positives = 207/276 (75%)

Query: 56  MEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIE 115
           MEEV+L+G++DKEGYLSF NEN+S+ LRGCILIELA RG IQV+DD  R+RFD S+RLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 116 VVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLV 175
           VV+  KTGE LLDE L +MK  E  +I  W+DLLSGETWN  KIN QL+QVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 176 DKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKY 235
           DKG+LRTEMKNFFLFDM THPV D  CKE IK+RILSVL+P+   +   E FPETV  + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 236 LRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVN 295
           LRTIALI SA+  +VLE V S LDY+K+D  F R  E+L Q S YPF  D    T I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 296 LNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           LN+LV+ EL ++    L LE +AGV +V+ +MD ++
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMDSIV 276

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  327 bits (838), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/303 (52%), Positives = 211/303 (69%), Gaps = 1/303 (0%)

Query: 30  GMTHKVAYDPEEQKLRENTREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIE 89
           G  H   +DPEE         P L LMEE++L+GLKDK+GYLSF N+NISY LRGCILIE
Sbjct: 85  GKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIE 144

Query: 90  LALRGRIQVVDDAMRRRFDPSERLIEVV-DGSKTGEALLDEALTLMKGSEPLTIVNWMDL 148
           LALR +I+V+DD +R  +D S R+IEVV   +KTG  LLDEAL +M    P +I+NW+DL
Sbjct: 145 LALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDL 204

Query: 149 LSGETWNFLKINYQLRQVRERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKR 208
           LSGETWN  K N QL+ VRER++KGLVDKG+L+    NF  FDM THP+ D   KES+K+
Sbjct: 205 LSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQ 264

Query: 209 RILSVLVPRNVELQYTELFPETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFS 268
           RI S+LVP++  L Y   FPE V FK +R++ LIC A+GA+VL+  L T++Y+  D  F 
Sbjct: 265 RIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFK 324

Query: 269 RAEELLVQFSQYPFALDKDIETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMD 328
           +AE+L    S +P  LD+   +G+ V++ + +Q EL ++ G +L LEVVAGVL+V  RMD
Sbjct: 325 KAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMD 384

Query: 329 DLL 331
            LL
Sbjct: 385 SLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  228 bits (580), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 182/283 (64%), Gaps = 7/283 (2%)

Query: 51  PTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRR-FDP 109
           P LTLM+E+ L+ LKDKEGY+S  +  +SY LR C++IELALRG+IQ V +  +++   P
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAP 122

Query: 110 SERLIEVVDGSKTGEALLDEALTLMKGSEP-LTIVNWMDLLSGETWNFLKINYQLRQVRE 168
            E  IEV+DGS TG+ LLD+ L LMK  +   ++ +W+ LLSGE+ NFLK +YQL  VR+
Sbjct: 123 HECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRK 182

Query: 169 RLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFP 228
           R+ + LV+ G+L  + K      + THP+ D  CK +I+ R+  +L    V+L  T+ FP
Sbjct: 183 RIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFP 242

Query: 229 ETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDI 288
           +TV+++ LRTI L C+A+GA++L+K     + E    G  RA  LL  FS++PF L++ +
Sbjct: 243 DTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQAV 301

Query: 289 ETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331
           +     +LN  V +EL  +P  A  LEVVAG + V + +D +L
Sbjct: 302 QP----DLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>Ecym_7102 Chr7 (197436..200525) [3090 bp, 1029 aa] {ON} similar to
           Ashbya gossypii AGR230W
          Length = 1029

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 34/178 (19%)

Query: 176 DKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKY 235
           +K V R  MK+FF F   ++P   +S  +++       +  ++ E+  T    E+   K 
Sbjct: 740 EKEVKRRRMKSFFAFKKLSNPAPYSSGNDNVS------IFSQDEEVNSTTTGTESTIHKS 793

Query: 236 LRTI----------------ALICSAHGAN----VLEKVLSTLDYEKRDRGFSR------ 269
           L+++                AL  S+H       +   V  TL++  ++RG         
Sbjct: 794 LQSMHLYSNNKVVFGADLKTALQLSSHAYQGRYEIPSIVFRTLEFLYKNRGIHEEGIFRL 853

Query: 270 -AEELLVQFSQYPFALDKDIETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSR 326
               LL++  Q  F  D D++   + N N +V  E +   G  +++  V G+LK+Y R
Sbjct: 854 SGSSLLIKSLQEQFDRDHDVDL-CNYNKNVVVSPENENQGGIYVDVNTVTGLLKLYLR 910

>TPHA0O01980 Chr15 complement(393699..396842) [3144 bp, 1047 aa]
           {ON} Anc_2.2 YDL240W
          Length = 1047

 Score = 33.5 bits (75), Expect = 0.97,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 46  ENTREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRR 105
           ENT EPT+TL ++++  G ++    +SFL EN+    R   L +++   RI  V+ A   
Sbjct: 596 ENTEEPTITLEDKLISSGNEENNTKVSFLPENVFSNGRSLTLDDIS---RIVAVEQAREL 652

Query: 106 R 106
           R
Sbjct: 653 R 653

>TBLA0E04070 Chr5 (1022909..1026265) [3357 bp, 1118 aa] {ON}
           Anc_8.605 YPL115C
          Length = 1118

 Score = 30.8 bits (68), Expect = 5.5,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 10/80 (12%)

Query: 254 VLSTLDYEKRDRGFSR-------AEELLVQFSQYPFALDKDIETGISVNLNRLVQEELDR 306
           V   L+Y  ++R  S            L++  Q  F L  DI+     N N  +++E   
Sbjct: 921 VYRCLEYLYKNRAVSEQGIFRLSGSSSLMKSLQEQFELKHDIDL---YNYNEHLEQEHKN 977

Query: 307 NPGTALNLEVVAGVLKVYSR 326
            P T +++  V+G+LK+Y R
Sbjct: 978 TPSTCIDIHTVSGLLKLYFR 997

>CAGL0I04950g Chr9 (450298..454617) [4320 bp, 1439 aa] {ON} similar
           to uniprot|P40061 Saccharomyces cerevisiae YER093c
          Length = 1439

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 32/74 (43%)

Query: 221 LQYTELFPETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQY 280
            Q+   F     F  L  + L  SAH   V+ K L   D E R     R  ELL++ +  
Sbjct: 869 FQFQSKFASKCLFLVLADLHLQHSAHCRTVMGKALVVEDEEVRISATKRLGELLIELNGS 928

Query: 281 PFALDKDIETGISV 294
             A + D+E  ++V
Sbjct: 929 KVASEIDLENKLNV 942

>KLLA0E17425g Chr5 complement(1543158..1550639) [7482 bp, 2493 aa]
           {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
           YBL004W UTP20 Possible snoRNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 2493

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%)

Query: 169 RLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFP 228
            L + +  K VL    K+F  F +       TS +  +  ++L++LVPR +ELQ +  F 
Sbjct: 498 HLLERVFQKDVLSDFEKDFVGFLLQALTFKITSSESVMAAKLLNILVPRIIELQNSRYFI 557

Query: 229 ETVA 232
           E ++
Sbjct: 558 EGIS 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,456,458
Number of extensions: 1419027
Number of successful extensions: 4162
Number of sequences better than 10.0: 36
Number of HSP's gapped: 4271
Number of HSP's successfully gapped: 36
Length of query: 331
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 221
Effective length of database: 40,868,139
Effective search space: 9031858719
Effective search space used: 9031858719
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)