Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL164C5.443ON1389138969200.0
Ecym_45145.443ON124682928070.0
SAKL0G02728g5.443ON123780922380.0
KLTH0F15862g5.443ON124180820660.0
Kwal_55.213935.443ON123383820400.0
ZYRO0G01606g5.443ON130581819370.0
TDEL0D025805.443ON127279118880.0
Kpol_1062.235.443ON126678418290.0
Skud_15.2865.443ON127887718200.0
Smik_15.3015.443ON127280218090.0
YOR124C (UBP2)5.443ON127286118070.0
Suva_8.1765.443ON127079218060.0
KLLA0E02377g5.443ON122077417780.0
TPHA0E017105.443ON128379417750.0
NCAS0H021005.443ON126979717590.0
KAFR0D050705.443ON122785817230.0
KNAG0B041905.443ON126282817230.0
TBLA0A064705.443ON132087216760.0
NDAI0C015505.443ON129578716640.0
CAGL0K10252g5.443ON126784815470.0
Kpol_1016.15.443ON12517879081e-101
TPHA0J026205.443ON12258077658e-83
Ecym_27171.369ON483921282e-06
ZYRO0G01188g1.369ON500531282e-06
AEL029W1.369ON446341246e-06
TBLA0C012001.369ON503361238e-06
SAKL0D10120g1.369ON492531238e-06
TDEL0D024001.369ON494541211e-05
NCAS0D006001.369ON493561202e-05
KLLA0A10791g1.369ON484991192e-05
KNAG0C019401.369ON499561193e-05
NCAS0A143707.390ON729901176e-05
KLTH0H13354g1.369ON495331166e-05
Kwal_34.162681.369ON449331149e-05
NDAI0A016707.390ON846781122e-04
KAFR0L017307.390ON701851112e-04
Ecym_46857.390ON778511104e-04
KAFR0C045201.369ON499531094e-04
Smik_7.3141.369ON499531077e-04
CAGL0K10494g1.369ON495341050.001
NDAI0H035501.369ON502521040.001
YFR010W (UBP6)1.369ON499531030.002
TPHA0A025101.369ON505501030.002
Skud_6.941.369ON499341030.002
Smik_2.497.390ON745401030.002
Suva_5.2177.390ON754821010.005
Skud_5.2237.390ON748831000.005
Kpol_534.231.369ON496331000.005
Suva_6.831.369ON50053990.005
Kpol_2001.541.137ON1223701000.006
Kpol_1003.532.307ON78848990.007
NDAI0B034302.307ON85668990.007
TPHA0L022905.18ON119352990.007
KAFR0I026005.18ON121395990.008
TBLA0C070205.18ON124750990.008
Skud_10.221.137ON125539990.009
NCAS0D023905.18ON121153980.010
Suva_13.4078.742ON471131970.010
YJL197W (UBP12)1.137ON125450980.012
NCAS0G036802.307ON48248950.016
Smik_13.4318.742ON47148950.017
KNAG0C035807.390ON77673960.018
Smik_5.2447.390ON74978950.019
CAGL0H10582g2.307ON79048950.020
KLTH0B09944g5.18ON118949950.026
TPHA0A025401.137ON128628950.026
Kpol_513.255.18ON119050940.027
TDEL0C056401.137ON117852940.027
TBLA0D010708.742ON48364930.029
YBL067C (UBP13)7.390ON74740940.030
NDAI0G007802.307ON48666930.031
TDEL0A011002.69ON66166930.035
Suva_2.507.390ON75040930.035
NCAS0I031401.137ON120172930.035
Suva_6.2761.137ON125650930.037
KAFR0A075802.69ON80266930.039
Smik_10.371.137ON124742930.040
NDAI0E008108.742ON49348920.040
KAFR0F015601.137ON117161930.041
KLLA0D08459g2.69ON75066920.042
KLLA0A00396g5.712ON101231930.042
SAKL0H00418g5.18ON119052930.043
NDAI0I025305.18ON119750930.044
KAFR0C004103.270ON76991920.045
KLLA0C03476g1.137ON125271920.045
Ecym_62488.742ON46662910.048
SAKL0E07106g2.307ON79148920.048
KNAG0F012202.69ON78466910.056
Kpol_1045.417.390ON712103910.057
Ecym_56715.18ON1176100920.059
TPHA0P006807.390ON72778910.061
ZYRO0C17908g1.137ON120439910.062
YMR304W (UBP15)5.18ON123050910.063
Skud_13.4785.18ON123197910.063
Smik_13.5215.18ON123150910.064
Suva_13.4955.18ON123055910.065
KLTH0F03674g1.137ON119850910.066
KNAG0A054502.307ON76448910.067
TBLA0E017605.712ON121234910.067
Skud_13.3928.742ON47392900.071
Skud_14.1482.69ON77678900.074
Kwal_55.196455.712ON97031900.075
SAKL0D03322g3.270ON76555900.079
Smik_4.1152.307ON79048900.086
TPHA0G008502.307ON78252900.088
Skud_4.1332.307ON78748900.088
Skud_2.387.390ON74840900.091
Kwal_26.95985.18ON119171900.093
Suva_14.1562.69ON78878900.094
TDEL0B020805.712ON102531900.097
Suva_4.1252.307ON79348890.100
TBLA0J006001.137ON146293900.10
YDL122W (UBP1)2.307ON80948890.10
ABL145W2.69ON74966890.10
Kwal_27.114442.307ON75748890.11
CAGL0M13783g5.18ON119649890.12
KLTH0G10934g2.307ON75848890.12
Ecym_40095.712ON151731890.12
NCAS0B061302.307ON77048890.12
Smik_14.1442.69ON76366880.13
YMR223W (UBP8)8.742ON47148880.13
CAGL0J11352g2.69ON77166880.13
TBLA0B097602.69ON89881880.13
KAFR0A069102.307ON67848880.14
KLLA0E20351g7.390ON69742880.14
ZYRO0D07062g5.18ON119349880.16
KLTH0E00814g5.712ON97436880.16
KNAG0B023707.390ON75331870.17
TBLA0B060802.307ON82463870.18
AGR370W7.390ON74046870.18
AGR389C2.307ON77552870.18
ZYRO0C09812g2.69ON70266870.18
TPHA0E008707.390ON71546870.19
NCAS0G001705.712ON103031870.20
Kwal_33.136281.137ON116030870.20
Kpol_1018.937.390ON75531870.20
NCAS0B005808.742ON46688860.20
Kwal_27.108427.390ON71142870.21
AGL357W5.18ON116656870.21
Klac_YGOB_Anc_5.18b5.18ON116654870.22
CAGL0G02563gsingletonON63130860.22
Ecym_81401.137ON126439860.23
TPHA0D046605.712ON104531860.23
NDAI0B004801.137ON125394860.25
NDAI0F034102.69ON87066860.25
AFR551W8.742ON46962850.25
Kwal_33.144302.69ON51166850.26
KAFR0D021605.712ON84631860.27
TDEL0G023702.307ON74751860.27
NCAS0G018002.69ON87566850.31
AFR627C1.137ON128739850.33
KNAG0L022005.712ON116131850.33
CAGL0L01639g1.137ON114758850.34
SAKL0C04246g1.137ON129768850.36
TDEL0G004105.18ON118649850.36
SAKL0E15136g5.712ON103731850.37
NDAI0F002005.712ON110531850.38
KAFR0A042108.742ON44059830.42
AFR296C5.712ON116931840.43
SAKL0E13002g2.69ON73966840.43
ZYRO0A02420g2.307ON74548840.47
TDEL0B036708.742ON46388830.48
ZYRO0B03300g7.390ON81369840.48
TBLA0D006207.390ON117131830.57
YER098W (UBP9)7.390ON75440830.60
YIL156W (UBP7)5.712ON107131830.61
CAGL0H06721g5.712ON108131830.61
SAKL0F12430g7.390ON75452820.64
Smik_9.135.712ON106034820.67
YNL186W (UBP10)2.69ON79266820.67
Kpol_1044.242.69ON72466820.68
KNAG0E012905.18ON119649820.74
CAGL0I05522g7.390ON72479820.74
Suva_9.305.712ON106231820.75
ZYRO0A05962g8.742ON46564810.76
KLTH0B07150g2.69ON75666820.80
Skud_11.3385.712ON71231810.88
Skud_9.125.712ON106434810.92
KNAG0C021801.137ON123129811.0
KLLA0E08801g2.307ON77148801.2
TBLA0E025703.270ON78541801.2
NCAS0E026107.390ON71742801.3
Suva_4.2953.270ON78252791.4
KLTH0C06732g7.390ON71442791.4
KNAG0J008003.270ON76554791.6
KLLA0F18700g3.270ON77068791.6
KAFR0K018107.390ON71465791.6
ZYRO0B16544g5.712ON104427791.6
Kwal_26.91518.742ON45464781.7
ZYRO0A06336g5.409ON327122771.9
KLLA0C06974g8.742ON44665772.2
SAKL0H04994g8.742ON45448772.4
CAGL0M11198g8.742ON46164772.7
Ecym_55448.202ON83465772.7
CAGL0A04477g7.390ON77031772.9
TDEL0C015707.390ON76531763.7
KAFR0H001505.712ON65631763.9
KNAG0G029308.742ON45970754.2
Kwal_56.230843.270ON76242754.4
Ecym_63441.271ON139764754.6
Skud_2.1773.270ON78224754.6
AGR139C8.202ON78966755.0
KLTH0D12760g8.742ON45364745.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL164C
         (1389 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...  2670   0.0  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...  1085   0.0  
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...   866   0.0  
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...   800   0.0  
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...   790   0.0  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...   750   0.0  
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....   731   0.0  
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...   709   0.0  
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...   705   0.0  
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...   701   0.0  
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...   700   0.0  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...   700   0.0  
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...   689   0.0  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....   688   0.0  
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...   682   0.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...   668   0.0  
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....   668   0.0  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...   650   0.0  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....   645   0.0  
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...   600   0.0  
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...   354   e-101
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...   299   8e-83
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    54   2e-06
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    54   2e-06
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    52   6e-06
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    52   8e-06
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    52   8e-06
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    51   1e-05
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    51   2e-05
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    50   2e-05
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    50   3e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    50   6e-05
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    49   6e-05
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    49   9e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    48   2e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    47   2e-04
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    47   4e-04
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    47   4e-04
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    46   7e-04
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    45   0.001
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    45   0.001
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    44   0.002
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    44   0.002
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    44   0.002
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    44   0.002
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    44   0.005
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    43   0.005
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    43   0.005
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    43   0.005
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    43   0.006
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...    43   0.007
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     43   0.007
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    43   0.007
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    43   0.008
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    43   0.008
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    43   0.009
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    42   0.010
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    42   0.010
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    42   0.012
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    41   0.016
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    41   0.017
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    42   0.018
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    41   0.019
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...    41   0.020
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    41   0.026
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    41   0.026
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    41   0.027
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    41   0.027
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    40   0.029
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    41   0.030
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}               40   0.031
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    40   0.035
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    40   0.035
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    40   0.035
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    40   0.037
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    40   0.039
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    40   0.040
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    40   0.040
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    40   0.041
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    40   0.042
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...    40   0.042
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    40   0.043
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    40   0.044
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    40   0.045
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    40   0.045
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    40   0.048
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...    40   0.048
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    40   0.056
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    40   0.057
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    40   0.059
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    40   0.061
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    40   0.062
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    40   0.063
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    40   0.063
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    40   0.064
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    40   0.065
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    40   0.066
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    40   0.067
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...    40   0.067
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    39   0.071
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    39   0.074
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...    39   0.075
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    39   0.079
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...    39   0.086
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...    39   0.088
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...    39   0.088
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    39   0.091
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    39   0.093
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    39   0.094
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    39   0.097
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    39   0.100
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    39   0.10 
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    39   0.10 
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    39   0.10 
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    39   0.11 
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    39   0.12 
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...    39   0.12 
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...    39   0.12 
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    39   0.12 
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    39   0.13 
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    39   0.13 
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    39   0.13 
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    39   0.13 
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    39   0.14 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    39   0.14 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    39   0.16 
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...    39   0.16 
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    38   0.17 
TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...    38   0.18 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    38   0.18 
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...    38   0.18 
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    38   0.18 
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    38   0.19 
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      38   0.20 
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    38   0.20 
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    38   0.20 
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       38   0.20 
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    38   0.21 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    38   0.21 
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    38   0.22 
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    38   0.22 
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    38   0.23 
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...    38   0.23 
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    38   0.25 
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    38   0.25 
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    37   0.25 
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    37   0.26 
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...    38   0.27 
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...    38   0.27 
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      37   0.31 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    37   0.33 
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...    37   0.33 
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    37   0.34 
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    37   0.36 
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    37   0.36 
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...    37   0.37 
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      37   0.38 
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    37   0.42 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    37   0.43 
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    37   0.43 
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...    37   0.47 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    37   0.48 
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    37   0.48 
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    37   0.57 
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    37   0.60 
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    37   0.61 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    37   0.61 
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    36   0.64 
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    36   0.67 
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    36   0.67 
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    36   0.68 
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    36   0.74 
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    36   0.74 
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...    36   0.75 
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    36   0.76 
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    36   0.80 
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...    36   0.88 
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    36   0.92 
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    36   1.0  
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    35   1.2  
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    35   1.2  
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    35   1.3  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    35   1.4  
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    35   1.4  
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    35   1.6  
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    35   1.6  
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    35   1.6  
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...    35   1.6  
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    35   1.7  
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...    34   1.9  
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    34   2.2  
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    34   2.4  
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    34   2.7  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    34   2.7  
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    34   2.9  
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    34   3.7  
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    34   3.9  
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    33   4.2  
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    33   4.4  
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    33   4.6  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    33   4.6  
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    33   5.0  
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    33   5.6  

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR124C
            (UBP2)
          Length = 1389

 Score = 2670 bits (6920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1304/1389 (93%), Positives = 1304/1389 (93%)

Query: 1    MNQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSLSEEGREV 60
            MNQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSLSEEGREV
Sbjct: 1    MNQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSLSEEGREV 60

Query: 61   LRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQNRVHVFMGVLCDPGQRFA 120
            LRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQNRVHVFMGVLCDPGQRFA
Sbjct: 61   LRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQNRVHVFMGVLCDPGQRFA 120

Query: 121  SQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVV 180
            SQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVV
Sbjct: 121  SQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVV 180

Query: 181  DSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAE 240
            DSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAE
Sbjct: 181  DSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAE 240

Query: 241  CLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIY 300
            CLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIY
Sbjct: 241  CLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIY 300

Query: 301  EYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQT 360
            EYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQT
Sbjct: 301  EYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQT 360

Query: 361  HFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPAN 420
            HFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPAN
Sbjct: 361  HFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPAN 420

Query: 421  ASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLL 480
            ASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLL
Sbjct: 421  ASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLL 480

Query: 481  ESYKEVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXX 540
            ESYKEVCKDSGPQKH            YKESDKLKFYVEVEPFPNELQAYKLL       
Sbjct: 481  ESYKEVCKDSGPQKHADLRNALRLLARYKESDKLKFYVEVEPFPNELQAYKLLEIDESVD 540

Query: 541  XXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSY 600
                 TAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSY
Sbjct: 541  IDIIETAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSY 600

Query: 601  QSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFL 660
            QSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFL
Sbjct: 601  QSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFL 660

Query: 661  ETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXX 720
            ETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHT         
Sbjct: 661  ETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTASNLLNNAV 720

Query: 721  XXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSS 780
               DMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSS
Sbjct: 721  SSSDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSS 780

Query: 781  TEVEFEPVPPAVGTASNALVANEVYNEDTEVIDISMEECDEDSAINELGASNISVKLDSD 840
            TEVEFEPVPPAVGTASNALVANEVYNEDTEVIDISMEECDEDSAINELGASNISVKLDSD
Sbjct: 781  TEVEFEPVPPAVGTASNALVANEVYNEDTEVIDISMEECDEDSAINELGASNISVKLDSD 840

Query: 841  IGTDSNSNLATGAQTGIPLDGHTDLNTGIRTCMPNDTAINMATGNATAPNKGIVNSEANF 900
            IGTDSNSNLATGAQTGIPLDGHTDLNTGIRTCMPNDTAINMATGNATAPNKGIVNSEANF
Sbjct: 841  IGTDSNSNLATGAQTGIPLDGHTDLNTGIRTCMPNDTAINMATGNATAPNKGIVNSEANF 900

Query: 901  EHLMTPAPHEGTDKPIGNDQSVVPNLGTSKDTLSAYPKSGYXXXXXXXXXXXXXXXXPDD 960
            EHLMTPAPHEGTDKPIGNDQSVVPNLGTSKDTLSAYPKSGY                PDD
Sbjct: 901  EHLMTPAPHEGTDKPIGNDQSVVPNLGTSKDTLSAYPKSGYAKTAASALSTNNSAASPDD 960

Query: 961  FSVRYQASSDTANTGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDDSGKDIT 1020
            FSVRYQASSDTANTGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDDSGKDIT
Sbjct: 961  FSVRYQASSDTANTGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDDSGKDIT 1020

Query: 1021 MVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEG 1080
            MVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEG
Sbjct: 1021 MVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEG 1080

Query: 1081 EQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDL 1140
            EQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDL
Sbjct: 1081 EQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDL 1140

Query: 1141 LTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLAT 1200
            LTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLAT
Sbjct: 1141 LTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLAT 1200

Query: 1201 DNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSR 1260
            DNAELNAKKQQAIG                AKNDHGVTLSAALADTRRFLDAAELTSGSR
Sbjct: 1201 DNAELNAKKQQAIGLREELERLRERRRRLLAKNDHGVTLSAALADTRRFLDAAELTSGSR 1260

Query: 1261 QLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRG 1320
            QLQEQYHATTSH                 HIASVQDAIAHRFDAFSSYGYSLGAVFIHRG
Sbjct: 1261 QLQEQYHATTSHLDALRVALDEELAALDAHIASVQDAIAHRFDAFSSYGYSLGAVFIHRG 1320

Query: 1321 EASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELD 1380
            EASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELD
Sbjct: 1321 EASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELD 1380

Query: 1381 IEPLKRLLA 1389
            IEPLKRLLA
Sbjct: 1381 IEPLKRLLA 1389

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/829 (63%), Positives = 637/829 (76%), Gaps = 15/829 (1%)

Query: 23  GRTVLYGNLARQGPVKTSDRLLDDVRVTVSLSEEGRE---VLRAPMLEYARQRANARTWS 79
           G+TVLY  ++   P KTSDRLLDD+R T+S   EG     VL++PML+Y+++R   R WS
Sbjct: 30  GKTVLYPLVSGNYPFKTSDRLLDDIRSTLSFVLEGVRGNGVLKSPMLDYSKERGELRAWS 89

Query: 80  VGYLLDQVVLQTSFEYTSRTC-------AQNRVHVFMGVLCDPGQRFASQDELVNYRIYH 132
           +GYLLDQV+LQTS+EY S            ++++VFMG+LCDP  +  S+D++VNY  YH
Sbjct: 90  IGYLLDQVLLQTSYEYASLGGSGGGGGDKHSKINVFMGLLCDPMVKLCSEDDIVNYSGYH 149

Query: 133 LRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASGTNR 192
           LRVTVK R  LERA++ +G+AQYHLV++LHP DK D C FED D  V+DSATYV+SGTNR
Sbjct: 150 LRVTVKTRLHLERAKRQFGIAQYHLVNDLHPADKQDLCFFEDDDECVIDSATYVSSGTNR 209

Query: 193 LVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVFKNP 252
           LVRIE+L+PEF  +E  EFT + IR RYL +C+++PDL+  ++P+QAECLNTLFKVFKNP
Sbjct: 210 LVRIEILKPEFTAEEWSEFTPDSIRKRYLSICEKYPDLNRENVPNQAECLNTLFKVFKNP 269

Query: 253 LSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEI-EEDGQKIYEYKPPDFTEHV 311
           LSRQ + DELKTISA+NKVLNSQL+ NWLV KFGFELCE+ EEDG+K YEYKPPDFT +V
Sbjct: 270 LSRQDSDDELKTISAENKVLNSQLDPNWLVDKFGFELCEVQEEDGRKEYEYKPPDFTNYV 329

Query: 312 ENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFWYHLM 371
            +W VR  RE YIRKSLEL+F+GKQS+RL+PK+VV ++SKLRSFQLYQTHFSH+FW+ L+
Sbjct: 330 NDWNVRHLRERYIRKSLELLFVGKQSIRLLPKEVVAASSKLRSFQLYQTHFSHTFWFQLL 389

Query: 372 GEYDHNDFNQQM-HPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDDLSF 430
           GE+D NDFNQQ  HPYDTN HF++LS NYYY DRDII+NYE+QI LDP NA IYYDDL+F
Sbjct: 390 GEFDRNDFNQQQQHPYDTNPHFINLSVNYYYGDRDIIRNYESQILLDPKNAGIYYDDLTF 449

Query: 431 VANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVCKDS 490
           +AN KGS QLLT+T KQN+VG EAL SALRLFH+DPS TDP+Q+ DE LL  YKE CK  
Sbjct: 450 IANVKGSHQLLTFTLKQNIVGQEALNSALRLFHIDPSETDPKQIPDEMLLSCYKEECKYG 509

Query: 491 GPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXXXXXXTAYSI 550
             ++H            YK+S+KLKFYVE+EPF  E QAY +L            TAY+I
Sbjct: 510 NTRQHADLRNALRLLAKYKQSEKLKFYVELEPFQQESQAYSILEIDESVDIDIIETAYTI 569

Query: 551 KVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVN 610
           KVSDAPGLK+DC RALYTLA+AKRS+ LFN L Q+CP+F QFYH+SY SY SALQYL VN
Sbjct: 570 KVSDAPGLKVDCDRALYTLAIAKRSMDLFNYLLQRCPRFQQFYHISYWSYTSALQYLQVN 629

Query: 611 VNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDINYL 670
           VNATDDLILEIF+RKW+ +P++SP+Q LNLK+AL KI  ERNSKLINHFLETG++D NYL
Sbjct: 630 VNATDDLILEIFRRKWAEEPVISPDQFLNLKVALMKIAHERNSKLINHFLETGIIDTNYL 689

Query: 671 PAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDMGRRRI 730
            +GNWPTG+NNIGNTCYLNSLLQYYFTISPLR+YI  Y+ T             M +RRI
Sbjct: 690 TSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRDYIQNYEDTASDLLLNMNQSGAMTKRRI 749

Query: 731 GGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEFEPVPP 790
           GGRA+++ EVERSVQFVYQLR LF++M HS+ER VTP+REL YLSFSPS+T VEFE    
Sbjct: 750 GGRAVNKPEVERSVQFVYQLRDLFNDMAHSKERCVTPSRELAYLSFSPSTTNVEFESAAQ 809

Query: 791 AVGTASNALVANEVYNEDTEVIDISMEECD---EDSAINELGASNISVK 836
                +  L+  E  NEDTEV DIS+E  +   E +A + +   NI  K
Sbjct: 810 VPFRDTTILLEQEPPNEDTEVFDISIEGSNVETEAAAEDIIADDNIDTK 858

 Score =  476 bits (1224), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 231/366 (63%), Positives = 279/366 (76%)

Query: 1020 TMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEE 1079
            +M    E   P TST VAKIS DQLENTLEIGRQQDVTECIGNVLYQIESASVPL+ DE 
Sbjct: 878  SMSNIVEENEPITSTCVAKISPDQLENTLEIGRQQDVTECIGNVLYQIESASVPLNFDEG 937

Query: 1080 GEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDD 1139
             EQ+DLVKQLFYGKLKQ+LIP+E P+++RTK ERFMSLLVN+GDHPKDIYDALD YF+DD
Sbjct: 938  HEQYDLVKQLFYGKLKQDLIPIENPEKRRTKFERFMSLLVNVGDHPKDIYDALDLYFRDD 997

Query: 1140 LLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLA 1199
            LL L +D+ +VRRSVAV ELP +LQIQIQRVYYDREK MPFKSTEPLPFGEKLYMDRY+A
Sbjct: 998  LLALGDDNARVRRSVAVEELPTILQIQIQRVYYDREKLMPFKSTEPLPFGEKLYMDRYMA 1057

Query: 1200 TDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGS 1259
            +  +EL AKKQ+++                 +KND G+TL  +L +T+ FL+++ L    
Sbjct: 1058 STESELLAKKQESLQLHETLEAIKQRRKKILSKNDAGLTLKDSLKETKIFLESSVLAESE 1117

Query: 1260 RQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHR 1319
             +++ +                         I  ++++I+H+FD F+++GY+L AVFIHR
Sbjct: 1118 GKIRIEKRNLIKQLDSFSLEIDKELSNLDDKIKDMENSISHKFDQFTNFGYNLFAVFIHR 1177

Query: 1320 GEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHEL 1379
            GEASYGHYWVYIKD +N GIWRKYNDESVTEVPESEVFDF+E+NTATPYFLVY+K+ HE 
Sbjct: 1178 GEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYFLVYIKDGHEH 1237

Query: 1380 DIEPLK 1385
            +IEPLK
Sbjct: 1238 EIEPLK 1243

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/809 (53%), Positives = 575/809 (71%), Gaps = 25/809 (3%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL----------SEEGREVLRAPMLEYAR 70
           DDG+T+LY  +    P KTSDRLLDD+R  +            S+    VLR PMLEY+R
Sbjct: 34  DDGKTLLYPGVHLNFPFKTSDRLLDDIRSDMFFLNSEEHDILYSQLHNGVLRLPMLEYSR 93

Query: 71  QRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPGQRFASQDELVNYR 129
           ++   +  SVGYLLDQV L+T +EY S+TC + N+++VFMGVL D   R  S D+++N  
Sbjct: 94  KKT-TQPCSVGYLLDQVTLKTKYEYESKTCPELNKINVFMGVLVDQHIRPESLDDVINVP 152

Query: 130 IYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASG 189
           IYHL++TVK R  LER ++H GV  YHL+D+LH +DK D  +  + +  +VDSATYV+S 
Sbjct: 153 IYHLKITVKTRLHLERVKKHVGVTHYHLIDQLHSFDKQDIFMTTESE-QLVDSATYVSSD 211

Query: 190 TNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVF 249
           TNRL+RIE+ +PEF  ++L  F+ E+++ RY   C++  DLDP+ +P+Q ECLNTLFK+F
Sbjct: 212 TNRLLRIEIFKPEFTKEDLAIFSQEKVKERYASACEKFQDLDPTSVPTQVECLNTLFKIF 271

Query: 250 KNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEI--EEDGQKIYEYKPPDF 307
           K PL+R+ ++D LKTISADNK LNSQ++ +WL  K+ F+L E   EE G+ I E++PPD 
Sbjct: 272 KGPLNRRSSEDILKTISADNKFLNSQIDPSWLTEKYDFKLVETTDEETGELIREFEPPDL 331

Query: 308 TEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFW 367
           T++V++W VR  RESY RK LELIFLGK S +L+PKD++  +SK RSF LYQT+FS SFW
Sbjct: 332 TDYVQDWSVRSKRESYTRKCLELIFLGKTSAQLLPKDILSKDSKSRSFNLYQTNFSTSFW 391

Query: 368 YHLMGE-YDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYD 426
           +HL+G+  +  D N Q  P+D +YHF++LS++ YYSD+DIIKNYE QI+LDP N  IY+D
Sbjct: 392 FHLLGDGRNFQDHNLQ-QPFDNDYHFINLSASSYYSDKDIIKNYETQISLDPENVGIYFD 450

Query: 427 DLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEV 486
            L+++AN+KG  QL+ Y  KQN+VG EAL  AL +F +D   TD + ++DE LL  YK  
Sbjct: 451 ALNYIANTKGGYQLIAYCGKQNIVGKEALDGALTVFGIDSKDTDVKSITDELLLSIYKNE 510

Query: 487 CKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXXXXXXT 546
            K +  QK             +KES KLKF+V+ EP+ +  +AY+LL            T
Sbjct: 511 LKAASVQKRTDLKNALRLLAKFKESKKLKFHVDYEPYTSTSKAYQLLEIGESVDLDIIQT 570

Query: 547 AYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQY 606
           AY+I+V+DAPGLK+DC RALYTLAVAKRS++LFN L Q+CP F +FY++   SY+ AL  
Sbjct: 571 AYTIRVADAPGLKIDCDRALYTLAVAKRSLVLFNFLTQECPIFQEFYNIDNWSYKEALSL 630

Query: 607 LHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVD 666
           L VN NATDD+ILEIFQRKWS +P+ SP+Q L LK ALTK+G ERNSKLIN+F++TG+VD
Sbjct: 631 LQVNENATDDVILEIFQRKWSQEPMTSPDQFLILKTALTKLGIERNSKLINNFIDTGIVD 690

Query: 667 INYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXX-XDM 725
           ++ LPAGNWPTG+NNIGNTCYLNSLLQYYF+ISPLR+Y+L Y                ++
Sbjct: 691 VSCLPAGNWPTGLNNIGNTCYLNSLLQYYFSISPLRDYVLNYQKMLNCFRDIEDATGGEI 750

Query: 726 GRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEF 785
            +RRIG R +S+ EVERSVQFVYQLR LF +MVH++ER+VTPT+EL YL+F+PS+ EVEF
Sbjct: 751 SKRRIGSREVSKPEVERSVQFVYQLRDLFRDMVHTKERFVTPTKELAYLAFAPSNIEVEF 810

Query: 786 EPVPPAVGTASNALVANEVYNEDTEVIDI 814
           E   P + T     VA E  +E T  +DI
Sbjct: 811 E--APTITT-----VAPEDLDERTNKLDI 832

 Score =  436 bits (1122), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 277/401 (69%), Gaps = 4/401 (0%)

Query: 988  GLSDSAANAEYTSAGPLEDRQAVENDDSGKDITMVGSPEAEGPETSTYVAKISSDQLENT 1047
            G+ +       +S   + ++Q  E  +  +DI M G+ E E    S  VAKISSDQLENT
Sbjct: 839  GIDNETEKGSKSSLLDVHNQQKPE--EQTEDIIMGGTQEEEAVNASMRVAKISSDQLENT 896

Query: 1048 LEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRK 1107
            LE+GRQQDVTECIGNVL+Q+ESAS P SL+E+ EQ DL+K+LFYGK+KQ LIP++ P + 
Sbjct: 897  LELGRQQDVTECIGNVLFQLESASDPWSLEEDNEQHDLIKELFYGKIKQHLIPVKNPSKI 956

Query: 1108 RTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQI 1167
            RTKIERF+SLLVNIGDHPKDIYDALD YFKDDLL LDE DG+V+R+VAV  LP +LQIQI
Sbjct: 957  RTKIERFVSLLVNIGDHPKDIYDALDLYFKDDLLQLDE-DGEVKRTVAVTNLPKILQIQI 1015

Query: 1168 QRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXX 1227
            QRVYYDRE+FMPFKS EPLPF E +YMDRY+ TD+  + AK+                  
Sbjct: 1016 QRVYYDRERFMPFKSIEPLPFSETIYMDRYMDTDDPVMLAKRDDTKKLKEELRALKDRQH 1075

Query: 1228 XXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXX 1287
               +KND G++   +L  T++FL  +E+        E   A   H               
Sbjct: 1076 QLLSKNDTGLSFKGSLLQTKKFL-QSEVLDKHEIAVENKGALVCHIDSMITKIDGELSSL 1134

Query: 1288 XXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDES 1347
               I +++  IA++F+ F+  GYSL A FIHRGEASYGHYW+YIKD +  GIWRKYNDES
Sbjct: 1135 YQKITALEVQIANQFNEFTKIGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDES 1194

Query: 1348 VTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388
            VTEVP+SEVF+F+E NTATPYFLVY+KE HE +IEPLKR++
Sbjct: 1195 VTEVPQSEVFNFTEGNTATPYFLVYIKEGHEDEIEPLKRVI 1235

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/808 (50%), Positives = 535/808 (66%), Gaps = 17/808 (2%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL-SEEGRE---------VLRAPMLEYAR 70
           D+G+ +LY +     P KTS+RLLD+++  ++  +  G +         VL+ P+LEY+R
Sbjct: 36  DNGKALLYPDAGSLFPFKTSERLLDEIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSR 95

Query: 71  QRANARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCDPGQRFASQDELVNYR 129
           +      +S+G+LLDQVVL+T +EY SRTC   N+V VFMGVL  P       ++L    
Sbjct: 96  KPV-PDPFSIGHLLDQVVLKTRYEYESRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAP 154

Query: 130 IYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASG 189
           IYHL++TVK R  LE  R+  GV QYH++ ELHP DK D  L E+ DP+++DSA YV+S 
Sbjct: 155 IYHLKLTVKTRMHLEHTRKQAGVCQYHMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSD 214

Query: 190 TNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVF 249
           TN+LV IE+ +PEF  ++L  F+ + IR R+ E C + PDLDP  +PSQAEC +TL K+F
Sbjct: 215 TNKLVCIEIFKPEFSHEDLATFSPDSIRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIF 274

Query: 250 KNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIE--EDGQKIYEYKPPDF 307
           K PL+R+   D LKTISADNK LNSQ+E  WL  +F F+LCE +  E+ +   EY+PPD 
Sbjct: 275 KGPLNRRSPDDVLKTISADNKFLNSQIEPAWLTERFQFQLCETQASEEPETALEYQPPDL 334

Query: 308 TEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFW 367
           T++V N  VR+ RE Y RK LEL+FLGK ++ L+ KD V  +S+ RSF LYQ  +S SF+
Sbjct: 335 TDYVNNLSVRKLREEYTRKCLELVFLGKMAVALMSKDDVAQDSRARSFHLYQISYSPSFF 394

Query: 368 YHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDD 427
           +HL+GE      +      D NYHF++LS+ +YYSD+DIIKNYE Q  LDP N  IY+D 
Sbjct: 395 FHLLGE-TRGVMDYGTQEIDKNYHFINLSACHYYSDKDIIKNYETQARLDPENIGIYFDA 453

Query: 428 LSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVC 487
           L+F+AN KGS QL+TY  KQ+VVG EAL SAL LF +D S TD   + D+ LL  Y++  
Sbjct: 454 LNFIANFKGSYQLITYCRKQDVVGKEALDSALSLFGIDASDTDLSTVPDDLLLGIYRKES 513

Query: 488 KDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXXXXXXTA 547
             +  QK              K+S  L+FY   EP+ N  QAY LL            TA
Sbjct: 514 SQASQQKRSSLKNSLRLIAKAKKSQILQFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTA 573

Query: 548 YSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYL 607
           Y++KV+D+PGLK+DC RA+YT+AV++RS+ LFN L +QCP F++FY    L+YQ AL  L
Sbjct: 574 YTVKVTDSPGLKIDCDRAIYTIAVSRRSMPLFNFLAEQCPAFNEFYSADKLTYQEALNLL 633

Query: 608 HVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDI 667
            VN NA+DD+ILE+FQRKW  +P+ SP+Q L    ALTKIG  RNS LIN +LETG++D+
Sbjct: 634 QVNENASDDVILEVFQRKWHQEPVSSPDQFLISSSALTKIGQVRNSLLINRYLETGIIDV 693

Query: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDMGR 727
           + LPAGNWPTG+NNIGNTCYLNSLLQYYF ISPLR+ I+ Y  T               +
Sbjct: 694 SCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIVEYQKTLSEFHQSIGHLE--SK 751

Query: 728 RRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEFEP 787
           RRIGGR +S+AEVERS+QFVYQLR LF +MVH+  RYVTPT+EL YL+F+PS+ EVEFE 
Sbjct: 752 RRIGGREVSEAEVERSIQFVYQLRDLFTDMVHTENRYVTPTKELAYLAFAPSNIEVEFEG 811

Query: 788 VPPAVGTASNALVANEVYNEDTEVIDIS 815
            P +               E TEVID++
Sbjct: 812 TPSSGSVGEAEDEEEGAIKETTEVIDLT 839

 Score =  406 bits (1044), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/386 (55%), Positives = 260/386 (67%), Gaps = 6/386 (1%)

Query: 1003 PLEDRQAVEN-DDSGKDITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIG 1061
            P E    VE   DS KD     + EA G  TST VAKISSDQLEN LE+GRQQDVTECIG
Sbjct: 855  PSESEMIVEQFVDSPKDDKKQDAAEAIG--TSTRVAKISSDQLENALEMGRQQDVTECIG 912

Query: 1062 NVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNI 1121
            NVL+Q+ESAS P  LD +GEQ DL+KQLF+GKL+Q L PL  P + RTKIERF+SLLVN+
Sbjct: 913  NVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRTKIERFVSLLVNV 972

Query: 1122 GDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFK 1181
            GDHPKD+YDALD YFK+D+L L  +DG V RSVA+ ELP +LQIQIQRVYYDRE+FMPFK
Sbjct: 973  GDHPKDVYDALDQYFKNDVLQL--EDGDVNRSVAIKELPAVLQIQIQRVYYDRERFMPFK 1030

Query: 1182 STEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSA 1241
            S EPLPF + +YMDRY+ T++  +  K+++A                   KN  G++  +
Sbjct: 1031 SIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLDKNGSGMSFKS 1090

Query: 1242 ALADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHR 1301
            +L +T+RFL +  L +   +   +  +  +                   IA ++  ++  
Sbjct: 1091 SLLETKRFLQSDVLENNDIESPNKEQSIQT-IDSMLLKIDEELASVYHRIAFLEQKLSSH 1149

Query: 1302 FDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSE 1361
            FD F   GYSL AVFIHRGEASYGHYW+YIKD    GIWRKYNDESVTE PESEVF+FSE
Sbjct: 1150 FDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSE 1209

Query: 1362 ENTATPYFLVYVKEAHELDIEPLKRL 1387
             NTATPYFLVYVK   E  IEPL R+
Sbjct: 1210 GNTATPYFLVYVKNGQESQIEPLHRV 1235

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/838 (49%), Positives = 545/838 (65%), Gaps = 31/838 (3%)

Query: 2   NQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL-------- 53
           N+ S   +E+  N      D G+T+LY +     P KTS+RLLDD+++ ++         
Sbjct: 17  NEGSAPGLESNLNDGQPIKDTGKTLLYADAGNLFPFKTSERLLDDIKLELAYKNSIEHDI 76

Query: 54  --SEEGREVLRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMG 110
             SE  + VLR P+LEY+R+  +   +++G+L+DQVVL+T +EY S+TC   N++ VFMG
Sbjct: 77  LYSELHKGVLRLPILEYSRKPTD-DVYNIGHLVDQVVLKTRYEYDSKTCPGLNKITVFMG 135

Query: 111 VLCDPGQRFASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFC 170
           VL +  Q     D++    +YHL+VTVK R  LER R+  GV QYHL+ ELHP+DK D  
Sbjct: 136 VLLNSSQMPKIYDDVTQASVYHLKVTVKTRLHLERTRKQAGVPQYHLLPELHPFDKEDLL 195

Query: 171 LFEDGDPAVVDSATYVASGTNRLVRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDL 230
           L +  DP ++DS  YV+S TN+L+ IE+ +PEF   +L EF  + I+ RY   C ++PDL
Sbjct: 196 LTDAEDPHLIDSVMYVSSDTNKLICIEIFKPEFSQADLTEFCPDAIKKRYSSACDKYPDL 255

Query: 231 DPSDIPSQAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC 290
           DP  IPSQAEC +TL K+FK PL+R+  +D LKTISADNK LNSQL+  WL  KF F+LC
Sbjct: 256 DPDMIPSQAECFSTLLKIFKGPLNRRGPEDVLKTISADNKFLNSQLDPKWLTEKFAFKLC 315

Query: 291 E---IEEDGQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVV 347
           +    +E G  + E++PPD T +V++  VR  RESY RK LELIFLGK S  L+ K+ + 
Sbjct: 316 QANDTDEAGSAM-EFQPPDLTNYVDDVSVRELRESYTRKCLELIFLGKMSSSLMTKEDIA 374

Query: 348 SNSKLRSFQLYQTHFSHSFWYHLMGEYDH-NDFNQQMHPYDTNYHFVHLSSNYYYSDRDI 406
            +S+ RSFQLYQT  S SF++HL+ E     D+  Q    D NY+F++LSS YYY+D+DI
Sbjct: 375 KDSRARSFQLYQTSNSLSFFFHLLNETRGVMDYGSQ--EIDRNYNFMNLSSCYYYTDKDI 432

Query: 407 IKNYEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDP 466
           IKNYE Q  LD  N  IY+D L+++AN KGS  L+ Y  KQ+VVG EAL SAL LF +DP
Sbjct: 433 IKNYETQALLDRENIGIYFDALTYIANLKGSYALIAYCRKQDVVGKEALDSALSLFGIDP 492

Query: 467 SSTDPRQLSDEFLLESYKEVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNE 526
           S T    + DE LL  Y++ C     QKH             K S  L+FY   EP+ N 
Sbjct: 493 SDTSLMTIPDELLLGVYRKECSQGSTQKHATLKNALRLLAKAKNSSTLQFYAAYEPYDNV 552

Query: 527 LQAYKLLXXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQC 586
            QAY LL            TAY+IKV+D+PGLK+DC RA+YTLAV KRS+ LFN L +QC
Sbjct: 553 HQAYSLLEVDESVDVDVIQTAYTIKVADSPGLKIDCDRAIYTLAVTKRSMPLFNFLVEQC 612

Query: 587 PKFHQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTK 646
           P F +FY    L+Y  AL  L VN NA+DD+ILE+FQRKW+++ ++SP+Q L    ALTK
Sbjct: 613 PVFEEFYSADKLTYHDALSLLQVNENASDDIILEVFQRKWNHETVLSPDQFLKSSSALTK 672

Query: 647 IGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           IG  RNS LIN +LETG +D+  LPA NWPTG+NNIGNTCYLNSLLQYYF ISPLR++I+
Sbjct: 673 IGQVRNSLLINRYLETGTIDVRCLPARNWPTGLNNIGNTCYLNSLLQYYFCISPLRQFIV 732

Query: 707 AYDHTXXXXXXXXXXXXDMG-RRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYV 765
            Y  T            ++G +RRIGGR +S++EVERSVQFVYQLR LF +M+H+  R+V
Sbjct: 733 DYQKT---LAEFHDSIGNLGSKRRIGGREVSESEVERSVQFVYQLRDLFTDMIHTESRFV 789

Query: 766 TPTRELVYLSFSPSSTEVEFEPVPPAVGTASNALVANEVYNEDTEVIDISME-ECDED 822
           TP +EL YL+F+PS+ EVEFE  P       N+         D EVID++ E E  ED
Sbjct: 790 TPRKELAYLAFAPSNIEVEFEGTPTVEPAKENS-------ENDVEVIDLTAEGEASED 840

 Score =  421 bits (1081), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 208/387 (53%), Positives = 268/387 (69%), Gaps = 3/387 (0%)

Query: 1003 PLEDRQAVENDDSGKDITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGN 1062
            P E    V      +D  M      E   +ST VAKIS+DQLEN LE+GRQQDVTECIGN
Sbjct: 846  PAESETQVVTTQLNEDTVMNDVIATEPMVSSTRVAKISTDQLENALEMGRQQDVTECIGN 905

Query: 1063 VLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIG 1122
            VL+Q+ESAS P++LD +GEQ DL+K+LF+GKLKQ+L PL+ P + RTKIERF+SLLVN+G
Sbjct: 906  VLFQLESASDPINLDSDGEQRDLIKELFFGKLKQDLAPLKDPSKIRTKIERFVSLLVNVG 965

Query: 1123 DHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKS 1182
            DHPK++YDALD YFKDD+L L  +DG V+R++A+ ELP++LQIQIQRVYYDREKFMPFKS
Sbjct: 966  DHPKNVYDALDQYFKDDVLQL--EDGDVKRTLAIKELPVVLQIQIQRVYYDREKFMPFKS 1023

Query: 1183 TEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAA 1242
             EPLPF + +YMDRY+ T +AE+  K+Q+A                   KN +G++   +
Sbjct: 1024 IEPLPFRDTIYMDRYMDTQDAEMQQKRQEAAKYKNELESLKLRQKALLEKNGNGMSFKTS 1083

Query: 1243 LADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRF 1302
            L +T RFL++  L   + ++Q++  A  +                   I ++   ++  F
Sbjct: 1084 LLETERFLESGVLEQNAIEIQKKDSALKA-IESMLLKIDNELSEIYSRITALDQKLSSHF 1142

Query: 1303 DAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEE 1362
            D F   GYSL AVFIHRGEASYGHYW+YIKD    GIWRKYNDE+VTE PE+EVF+F+E 
Sbjct: 1143 DNFKELGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNFTEG 1202

Query: 1363 NTATPYFLVYVKEAHELDIEPLKRLLA 1389
            NTATPYFLVYVK  HE +I+PL R++A
Sbjct: 1203 NTATPYFLVYVKNGHESEIQPLHRVIA 1229

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/818 (48%), Positives = 528/818 (64%), Gaps = 25/818 (3%)

Query: 13  QNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL----------SEEGREVLR 62
           +N  L+  D G+  LY   A + P KT+DRLLDD+   +S           S+    +L+
Sbjct: 50  KNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSDLSNGILK 109

Query: 63  APMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPGQR-FA 120
           +P+L Y+R+    R +++G L+DQVVLQT FEY S +C Q N + VFMGVL D  Q+  A
Sbjct: 110 SPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVLIDVTQQNVA 169

Query: 121 SQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDE--LHPWDKPDFCLFEDGDPA 178
           + + L    I+HL+VTVK R  LER ++  G+  YH +DE  +HP+DK D   F+  DP 
Sbjct: 170 TFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQDLLTFDSKDPQ 229

Query: 179 VVDSATYVASGTNRLVRIEVLRPEFGPDELQE-FTGERIRARYLEVCKRHPDLDPSDIPS 237
           ++D A YV+S +N+L+ IE+ +PEF  DE ++ F  E I  RY   C R   LDP+ IP+
Sbjct: 230 LLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMACNRFDSLDPTRIPT 289

Query: 238 QAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC--EIEED 295
           Q +C+NTLFK+FK PL+R+ +++  KTI+ +N  LNS ++  WL +K+GFEL   + EE 
Sbjct: 290 QPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLTSKYGFELHVEKDEET 349

Query: 296 GQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKL-RS 354
           G+ I EY PPD T +  +W+VRR RES+ R+ LELIFLG+ S+RL+ ++ V  N K+ R 
Sbjct: 350 GEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSIRLLSQEAVNRNPKVYRI 409

Query: 355 FQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQI 414
           F + QT+FS  FW+ L+GEY      +   P D+++HF+ LS+ Y Y DRDII+NYEAQ 
Sbjct: 410 FSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDLSACYNYIDRDIIRNYEAQC 469

Query: 415 ALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQL 474
            LDP N  +Y D L+F+AN KG+ QL+ Y  KQ+ VG EAL  AL +F +D    DP  L
Sbjct: 470 TLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQEALDHALGVFQIDSKEFDPHNL 529

Query: 475 SDEFLLESYK-EVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLL 533
           +D  LL  YK E      P +H            +K+S KLKFY + EP+ N  QAY++L
Sbjct: 530 NDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKKSPKLKFYADYEPYRNVTQAYEIL 589

Query: 534 XXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFY 593
                       TAY++KV+D+PGLK+DC RALYT+AV  RS+ LFN L QQ  +F +++
Sbjct: 590 EVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYTIAVHSRSLALFNFLVQQSEEFQEYF 649

Query: 594 HMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNS 653
                SYQ AL  L VN NA DD ILEIFQRKW  +P+   +Q L LK AL+KIGFERNS
Sbjct: 650 GPDQFSYQDALSVLQVNENAGDDTILEIFQRKWYKEPVFDADQFLKLKGALSKIGFERNS 709

Query: 654 KLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXX 713
           KLI+HF++TG VD + LPA NWPTG+NNIGNTCYLNSLLQYYF+IS LR+Y+L Y +T  
Sbjct: 710 KLISHFIDTGTVDASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNT-- 767

Query: 714 XXXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVY 773
                     +   RRIGGR I++AEVERSVQFVYQLR LF  M+H+++R VTP +EL Y
Sbjct: 768 --VQHFLNNQEYASRRIGGREITEAEVERSVQFVYQLRDLFDSMIHAQDRCVTPRKELAY 825

Query: 774 LSFSPSSTEVEFEPVPPAVGTASNALVANEVY-NEDTE 810
           L+F PS   VEFE +P A    +NA V  E Y N D+E
Sbjct: 826 LAFVPSGLGVEFE-LPNASQANANAPVEKENYVNIDSE 862

 Score =  407 bits (1045), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/404 (53%), Positives = 265/404 (65%), Gaps = 22/404 (5%)

Query: 1004 LEDRQAVENDDSGKDITMVGSPEAE-------------------GPETSTYVAKISSDQL 1044
             ++ QA END    DI+M  SP  E                      TST VAKISSDQL
Sbjct: 901  FDNSQAGEND-VDVDISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQL 959

Query: 1045 ENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFP 1104
            EN LE+GRQQDVTECIGNVL+Q+ESAS P+SL ++ EQ DLVKQLFYG +KQ +IPL+  
Sbjct: 960  ENALEMGRQQDVTECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDE 1019

Query: 1105 DRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQ 1164
             + RTK ERF+SLLVNIGDHPKDIYDALD YF+D+ L L E+ G V+R+VAV + P +LQ
Sbjct: 1020 TQVRTKYERFLSLLVNIGDHPKDIYDALDLYFRDEYLKL-EEYGDVKRTVAVTDFPTILQ 1078

Query: 1165 IQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXX 1224
            IQIQRVYYDRE+FMPFKS  PLPF E +YMDRY  T+N  L  +K++             
Sbjct: 1079 IQIQRVYYDRERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKG 1138

Query: 1225 XXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXX 1284
                  +KN+ G++   AL +T  FL +  L +   Q+  +                   
Sbjct: 1139 RQRELLSKNELGLSRKGALIETSNFLKSDVLETQGIQIDNR-TGLAQELDNIVLGINDEL 1197

Query: 1285 XXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYN 1344
                 +I  ++  I+H+FD F S GYSL AVFIHRGEASYGHYW+YIKD    GIWRKYN
Sbjct: 1198 SQLYHNITQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYN 1257

Query: 1345 DESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388
            DE++TEVPESEVF+FSE NTATPYFLVYVK+ HE +IEPLKR+L
Sbjct: 1258 DETITEVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVL 1301

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/791 (47%), Positives = 513/791 (64%), Gaps = 25/791 (3%)

Query: 17  LEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL----------SEEGREVLRAPML 66
           L   D G+ VLY  ++ + P KTSDRLLDD+   ++           S+    +L+AP+L
Sbjct: 55  LTHRDSGKEVLYREVSTKFPFKTSDRLLDDLIHDLAFINSKDHDILYSDLHNGILKAPVL 114

Query: 67  EYARQRANARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCD-PGQRFASQDE 124
            Y+R+ +    +S G L+DQ+ LQTSFEY S +C   N+++V+MGVL D P     +   
Sbjct: 115 AYSRRISQLYPYSFGTLVDQITLQTSFEYPSISCPGHNKLNVYMGVLIDVPHDYKITSST 174

Query: 125 LVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDE--LHPWDKPDFCLFEDGDPAVVDS 182
           L    +YHL+VTVK R  LE  ++  GV  YH + E  LH +D+ D   F+  DP +VD 
Sbjct: 175 LSENTVYHLKVTVKTRSILEHTKKKAGVTHYHCISEADLHQFDRQDL-EFDPTDPRLVDH 233

Query: 183 ATYVASGTNRLVRIEVLRPEFGPDELQE-FTGERIRARYLEVCKRHPDLDPSDIPSQAEC 241
           A YV+S TN+LV IEV  PEF  +E  E ++G  I+ RY E C+R   LDPS+IP+QA+C
Sbjct: 234 AIYVSSDTNKLVLIEVFLPEFDREEKTECWSGTAIKTRYSEACQRFDTLDPSEIPTQADC 293

Query: 242 LNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEED---GQK 298
           +NTL K+F+ PL+RQ +++ LKTI++DN VLNS++  NWL +K+GFEL  +E+D   G+ 
Sbjct: 294 INTLLKIFRGPLNRQNSEEPLKTINSDNVVLNSRINPNWLTSKYGFEL-HVEKDESTGES 352

Query: 299 IYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLY 358
            +E++PP+ T ++E+ +VRR RES+IRK +ELIFLGK ++ L+ KD   ++   R+F   
Sbjct: 353 YFEFEPPNLTNYIEDRKVRRLRESFIRKCIELIFLGKTAIELLGKDAKTTSKVYRTFNAI 412

Query: 359 QTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDP 418
           Q  FS + W+ ++GE+      +   P D NY+F++LS+ +YY DRDIIKNYEAQ ALDP
Sbjct: 413 QIAFSKTTWFKMLGEHRSIFSFESASPLDANYNFINLSACFYYIDRDIIKNYEAQCALDP 472

Query: 419 ANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEF 478
            N  IY+D L+++AN KG+ QL+ Y  KQ+VVG EAL  AL+LF +D    D   + D  
Sbjct: 473 ENTGIYFDALTYIANRKGAYQLVAYCGKQDVVGQEALDQALKLFGIDSKDVDVATIDDSL 532

Query: 479 LLESYK-EVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXX 537
           L+  YK E   +    +H            YK+SDKLKF+ + EP+ N  +AY++L    
Sbjct: 533 LVSIYKSETMANPNENRHTDLKNALRLLAKYKKSDKLKFFADYEPYKNVSRAYEILEVDE 592

Query: 538 XXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSY 597
                   TAYSI ++D+PGLK+DC RALYT+ V KRS+ L N L QQCP F  +Y    
Sbjct: 593 SVDDDIIETAYSISINDSPGLKIDCDRALYTIGVRKRSLRLLNYLLQQCPDFQLYYGPGT 652

Query: 598 LSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLIN 657
           L Y  AL  L +N NA D+ +LE+FQRKW  +     + LL LK ALTKIG ERNSKLI 
Sbjct: 653 LLYSEALSMLQLNENAGDETVLEVFQRKWHQETAFESDYLLKLKAALTKIGIERNSKLIL 712

Query: 658 HFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXX 717
           HF++TG +D + LPA NWPTG+NNIGNTCYLNSLLQYYF+++PLR Y+L Y  T      
Sbjct: 713 HFIDTGTIDASCLPADNWPTGLNNIGNTCYLNSLLQYYFSLAPLRRYVLEYQETMEHFRH 772

Query: 718 XXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFS 777
                     RRIGGR +S+AEVERSVQFVYQLR LF  M++S+ER VTP +EL YL+F+
Sbjct: 773 HTGNEL----RRIGGREVSEAEVERSVQFVYQLRDLFQAMIYSKERCVTPRKELAYLAFA 828

Query: 778 PSSTEVEFEPV 788
           PS+ EVEFEP 
Sbjct: 829 PSNFEVEFEPT 839

 Score =  401 bits (1031), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 218/446 (48%), Positives = 284/446 (63%), Gaps = 20/446 (4%)

Query: 958  PDDFSVRYQASSDTANTGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDDSGK 1017
            P +F V ++ ++  A    ++   S+  +  +      ++    GP+E      N+D   
Sbjct: 829  PSNFEVEFEPTTVNAQHEVSKIAESTNNDILMYGPTNRSDNDQTGPIELDSDSGNEDI-- 886

Query: 1018 DITMVGSPEAEGPE--------------TSTYVAKISSDQLENTLEIGRQQDVTECIGNV 1063
            D++M   P  E  E              TST VAKISSDQLEN LE+GRQQDVTECIGNV
Sbjct: 887  DVSMTKEPSEEYKEDIPMSDAEKDNIISTSTRVAKISSDQLENALEMGRQQDVTECIGNV 946

Query: 1064 LYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGD 1123
            L+Q+ESAS P++LDE+ EQ DLVKQLFYGK+KQ +IPL      +TKIER++SLLVNIGD
Sbjct: 947  LFQLESASDPINLDEDNEQNDLVKQLFYGKIKQTIIPLAKSTEIQTKIERYLSLLVNIGD 1006

Query: 1124 HPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKST 1183
            HPKDIYDALDSYF D+ LT+ E  G V+R+VAV E P +LQIQIQRVYYDRE+FMPFKS 
Sbjct: 1007 HPKDIYDALDSYFSDERLTMAE-YGDVKRTVAVTEFPTILQIQIQRVYYDRERFMPFKSI 1065

Query: 1184 EPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAAL 1243
            EPLPF E LYMDRY  + + ++  KK+++                  + N+ G++  AA 
Sbjct: 1066 EPLPFNEVLYMDRYSDSQDPKMVEKKKESEQLKAQLSRLKIRQKELLSVNELGLSRKAAY 1125

Query: 1244 ADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXH-IASVQDAIAHRF 1302
             +T  +L +  +   S++L+   +                      H IA +++ I  +F
Sbjct: 1126 METINYLKSDLIK--SQELKGLNNDFLIEQLKQSIADIDQELTSLYHDIAKLENTIDKQF 1183

Query: 1303 DAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEE 1362
            + F   GYSL AVFIHRGEASYGHYWVYIKD    G WRKYNDE++TEVPE+EVF+F+E 
Sbjct: 1184 EEFKKIGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEG 1243

Query: 1363 NTATPYFLVYVKEAHELDIEPLKRLL 1388
            NTATPYFLVYV++ HE DIEPLKR++
Sbjct: 1244 NTATPYFLVYVRQGHEHDIEPLKRII 1269

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/784 (46%), Positives = 509/784 (64%), Gaps = 20/784 (2%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV----------SLSEEGREVLRAPMLEYAR 70
           DDG+ +LY +     P KTS+RLLD++  +V          S +E    +L+  +L Y++
Sbjct: 52  DDGKQLLYPDARDLTPFKTSERLLDEIMCSVPYILLSEKDESFNEFSNGLLKKQLLSYSK 111

Query: 71  QRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG-QRFASQDELVNY 128
            R N + +SVG ++DQ++LQT FEY S TC + N ++V +GVL D   Q  ++ D++ + 
Sbjct: 112 SRHNVQPFSVGTIVDQIILQTKFEYKSTTCPEFNNIYVRLGVLIDTNHQPLSTFDDVADL 171

Query: 129 RIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVAS 188
           +IYHL++TVK+R  LER ++H GV +YHL+D LHP+D+ D   F+  DP +VD A YV+ 
Sbjct: 172 KIYHLKITVKVRSFLERTKRHVGVPRYHLLDSLHPFDQQDLLNFDPKDPKLVDHAIYVSD 231

Query: 189 GTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFK 247
            TN+LV +E+ RPEF   +E    T   I+ R+++  K++  LD  +IP+Q +C+NT+FK
Sbjct: 232 DTNKLVLLEIFRPEFDSEEERNSLTMGAIKERHIKASKKYDTLDKDEIPTQIDCINTMFK 291

Query: 248 VFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIY--EYKPP 305
           +FK PL+R+   + +KT+S+DN VLNSQ+   WLVTK+GF+     E+  +    +Y PP
Sbjct: 292 IFKGPLTRKSNDEPVKTLSSDNVVLNSQMNPKWLVTKYGFQELIETEEETEEQLIDYLPP 351

Query: 306 DFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTHFSH 364
           +  +   + +VR+ RE+  RK LELI+LGK S+ L+  +   S SK LR+F L QT FS 
Sbjct: 352 NLVDFETDQDVRKSREAVTRKCLELIWLGKISISLMTPEQKESASKSLRTFNLLQTSFST 411

Query: 365 SFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIY 424
            FW  ++ E  +    ++    + +YH + LS++Y+Y+DRDII+NYE Q  LDPAN  IY
Sbjct: 412 LFWSQILDENKNIATMKENPQMNLDYHLIDLSASYHYTDRDIIQNYELQCKLDPANIGIY 471

Query: 425 YDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYK 484
           +D L F+AN++GS  L+ Y  KQ++VG EAL  AL+ F LDP + D    +D   +  YK
Sbjct: 472 FDSLHFIANNRGSYTLIGYCDKQDIVGQEALEQALKTFSLDPDTIDLSDTNDAIFMTIYK 531

Query: 485 EVCKDSG--PQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXXX 542
              K  G  P +             +K S +LKFYV+ EP+ +  +A+ +L         
Sbjct: 532 NEVKLHGNDPTRLTNLRNALRILAKHKNSSRLKFYVDYEPYSSIQRAFNILEVDESVDDD 591

Query: 543 XXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQS 602
              TAYSIKV+D PGLK+DC RALYT+AV+KRS+IL N LFQ+CP F  FY     +Y  
Sbjct: 592 IIQTAYSIKVNDTPGLKIDCDRALYTVAVSKRSMILINFLFQECPPFQDFYGPDQYTYSE 651

Query: 603 ALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLET 662
           ALQ L VN NA DD ILEIFQR+W+ D ++  +++L+LK  LTKI FERNSKLI+ +LET
Sbjct: 652 ALQKLQVNENAADDTILEIFQRRWTSDSVIDADEILSLKSVLTKIAFERNSKLISSYLET 711

Query: 663 GLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXX 722
           G+V+   LPA NWP G+NNIGNTCYLNSLLQYYF ISPLR Y+  Y  T           
Sbjct: 712 GVVNPGCLPADNWPAGLNNIGNTCYLNSLLQYYFCISPLRNYVADYQKTLEAVENCLEDG 771

Query: 723 XDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTE 782
            D  +RRIGGR I++ EVERSVQFVYQLR LF+EM+HS  R VTPT+EL YL+F+PS+ E
Sbjct: 772 WD--KRRIGGREINKVEVERSVQFVYQLRDLFNEMIHSSSRCVTPTKELAYLAFAPSNVE 829

Query: 783 VEFE 786
           VEF+
Sbjct: 830 VEFD 833

 Score =  399 bits (1024), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/362 (54%), Positives = 251/362 (69%), Gaps = 2/362 (0%)

Query: 1027 AEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLV 1086
             +  +TST VAKIS DQLEN LE+GRQQDVTECIGNVL+Q+ESAS P+SL+E+ EQ+DL+
Sbjct: 907  GKSTDTSTRVAKISFDQLENALELGRQQDVTECIGNVLFQLESASNPISLEEDDEQYDLI 966

Query: 1087 KQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDED 1146
            K+LFYGK KQ +IPL+  +  R KIERF+SLLVN+ DHPKD+YDALD YF D+ LT+DE 
Sbjct: 967  KKLFYGKTKQSIIPLKNNNEIRNKIERFVSLLVNVSDHPKDVYDALDLYFSDEYLTMDE- 1025

Query: 1147 DGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELN 1206
             G+V++S+AV E P +LQIQIQRVYYDRE+FMPFKS EPLPF E +YMDRY  T +A+L 
Sbjct: 1026 YGEVKKSLAVTEFPTILQIQIQRVYYDRERFMPFKSIEPLPFSETIYMDRYTETTDADLL 1085

Query: 1207 AKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQY 1266
             KK +                   ++N+ G++   A  +TR+FL +  L     +  E  
Sbjct: 1086 KKKDETFELKKQLSEMRKRQKELLSRNELGLSRKEAFMETRKFLSSDALEKQGIE-TENK 1144

Query: 1267 HATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGH 1326
                                    I +++  I  +FD F + GYSL AVFIHRGEASYGH
Sbjct: 1145 QMLIDRLTGALKDIDDELTKLYNDIVNIEAKIDRQFDKFQNIGYSLFAVFIHRGEASYGH 1204

Query: 1327 YWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKR 1386
            YWVYIKD    GIWRKYNDE++TEVPE+EVF+F+E NTATPYFLVYVK+ +  +IEPLKR
Sbjct: 1205 YWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATPYFLVYVKQENLNEIEPLKR 1264

Query: 1387 LL 1388
            ++
Sbjct: 1265 IV 1266

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/877 (44%), Positives = 552/877 (62%), Gaps = 43/877 (4%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRV-TVSLS-------EEGRE---VLRAPMLEYA 69
           DDG+ +LY ++A   P+KTSDRLLDDV   T+ L+       E+G +   +LR  ML Y+
Sbjct: 54  DDGKHLLYPDIATSLPLKTSDRLLDDVLCDTIFLNSTDPNVIEKGLQTSGILRESMLSYS 113

Query: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125
             R++ R  ++G L DQV +QT  EY S +C + N+++VF  V+ +P    Q+ +S D++
Sbjct: 114 SFRSSIRPNALGSLTDQVTIQTKTEYDSISCPRYNKIYVFQAVILNPSLSEQQISSFDDI 173

Query: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185
           V   IYHL+VTVKIR +LER ++H GV Q+H +D LH +D+ D   F+  DP ++D   Y
Sbjct: 174 VRIPIYHLKVTVKIRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPKLMDYGIY 233

Query: 186 VASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244
           V+  TN+L+ IE+ +PEF  P+E + FT + I+ RY ++C ++  L+  + PSQ +C  T
Sbjct: 234 VSDDTNKLILIEIFQPEFNSPEEHESFTTDAIKKRYNDLCLKNESLNKKEAPSQPDCFYT 293

Query: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EIEEDGQKIY-EY 302
           LFK+FK PL+R+  ++ +KTI + N VLN+ L A WL +K+GF+   EI+E+    + EY
Sbjct: 294 LFKIFKGPLTRKSKEEPIKTIDSGNLVLNTHLNAEWLTSKYGFQASSEIDEETNDPFTEY 353

Query: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361
            PPD   +V +W  R+ RES+++K L+LIF G+ S  L+  +  + N+K ++     QT 
Sbjct: 354 VPPDMVGYVGDWNKRKIRESFVKKCLQLIFWGQLSASLLTPNSSLKNTKSVKGLSSLQTS 413

Query: 362 FSHSFWYHLMGEYDHN---DFNQQMH-PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALD 417
           FS S W+HL+GE       + N+Q H P D   HF++LS ++YY+DRDII+NYEA  +LD
Sbjct: 414 FSTSPWFHLLGESRARILLNSNEQAHSPLDAEQHFINLSVSHYYTDRDIIRNYEALSSLD 473

Query: 418 PANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDE 477
           P N  +Y+D L+++AN KG+ QL+ Y  KQN++G EAL +AL  F +DP   +  +L++ 
Sbjct: 474 PDNIGLYFDALTYIANRKGAYQLIAYCGKQNIIGQEALENALVTFKIDPKEFNIAELNEA 533

Query: 478 FLLESYK-EVCKDSGPQKH--XXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLX 534
            LL  YK E    S    +              Y +SDKLKFYV+ EP+    QAY  L 
Sbjct: 534 TLLSIYKFETSNKSKVTSNHLTNFKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593

Query: 535 XXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYH 594
                      TAYSIK++D+PGLK+DC RALYT+A++KRS+ LFN L  +CP+F ++Y 
Sbjct: 594 IDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFLKYYG 653

Query: 595 MSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSK 654
              L YQ AL+ L VN NA+D+ +L+IF++KW  + +  P+Q L L+ ALT+I  ERNS 
Sbjct: 654 PEKLHYQEALKLLQVNENASDETVLKIFKQKWYDESVFEPDQFLILRAALTRISIERNSN 713

Query: 655 LINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXX 714
           LI +FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR YIL Y  T   
Sbjct: 714 LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILEYQKTLDN 773

Query: 715 XXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774
                     +  RRIGGR IS+ EVERS+QF+YQLR+LF+ MVHSRER VTP++EL YL
Sbjct: 774 FNDHLSNSGHV--RRIGGREISRGEVERSIQFIYQLRNLFYAMVHSRERCVTPSKELAYL 831

Query: 775 SFSPSSTEVEFEPVPPAVGTASNALVAN---EVYNE--------DTEVIDISMEE---CD 820
           +F+PS+ EVEFE     VG+   A+ A+   EV  E        D  +ID+ ME+    D
Sbjct: 832 AFAPSNVEVEFEVEGNKVGSNGAAISADSKGEVTQEAATTSEEKDPSLIDLEMEDKTNSD 891

Query: 821 EDSAINELGASNISVKLDSDIGTDSN-SNLATGAQTG 856
            D  I  + A+  +   D +I    N ++LA+  +  
Sbjct: 892 VDKDIENVKANEANEANDIEITVGENITDLASPTRVA 928

 Score =  402 bits (1032), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/373 (54%), Positives = 254/373 (68%), Gaps = 10/373 (2%)

Query: 1016 GKDITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLS 1075
            G++IT + SP        T VAKI SDQLEN LE+GRQQDVTECIGNVL+QIES S P+ 
Sbjct: 915  GENITDLASP--------TRVAKIGSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIR 966

Query: 1076 LDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSY 1135
             DE+ EQ+DL+KQLFYG  KQ ++PL   D+ RTK+ERF+SLLVNIGDHPKDIYDA DSY
Sbjct: 967  YDEDNEQYDLIKQLFYGTTKQSIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSY 1026

Query: 1136 FKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMD 1195
            FKD+ LT+ E+ G V+R+VAV   P +LQ+QIQRVYYDRE+FMPFKS EPLPF E +YMD
Sbjct: 1027 FKDEYLTM-EEYGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMD 1085

Query: 1196 RYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAEL 1255
            RY  T+N  L AKK++                    +++ G+T   A  ++ + L++  +
Sbjct: 1086 RYSDTENPLLLAKKEETEQMKQNLKVMKNRQRELLDRDESGLTRKDAFLESIKLLESNIV 1145

Query: 1256 TSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAV 1315
             + +    E                          I S++D I+H+FD F  YGYSL +V
Sbjct: 1146 VTEASN-SEDNKDVIRILKSNIIDIDNELMSLYNDINSLEDKISHQFDDFEEYGYSLFSV 1204

Query: 1316 FIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKE 1375
            FIHRGEASYGHYW+YIKD   GG+WRKYNDE+++EV E EVF+F+E NTATPYFLVYVK+
Sbjct: 1205 FIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYFLVYVKQ 1264

Query: 1376 AHELDIEPLKRLL 1388
              E DIEPLKR+L
Sbjct: 1265 GQESDIEPLKRIL 1277

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/802 (45%), Positives = 518/802 (64%), Gaps = 29/802 (3%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV--------SLSEEGRE---VLRAPMLEYA 69
           DDG+ +LY ++A   P+KTSDRLLDD+            S+ E+G +   +LR  ML Y+
Sbjct: 54  DDGKHLLYPDIATSLPLKTSDRLLDDILCDTIFLNSTDPSVIEKGLQTTGILRESMLSYS 113

Query: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125
             R++ R  ++G + DQVV+QT  EY S +C + N++HVF  V+ +P    Q  +S D++
Sbjct: 114 SFRSSIRPNALGSVTDQVVIQTKIEYDSYSCPKYNKIHVFQAVILNPSLTEQHVSSFDDI 173

Query: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185
           V   IYHL+VTVKIR +LER ++H GV Q+H +D LH +D+ DF  F+  DP ++D   Y
Sbjct: 174 VKIPIYHLKVTVKIRQELERLKKHVGVTQFHSIDFLHEYDRVDFSTFDSSDPNLMDYGIY 233

Query: 186 VASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244
           V+  TN+L+ IE+ +PEF  P+E + FT   I+ RY ++C  +  LD ++ PSQA+C  T
Sbjct: 234 VSDDTNKLILIEIFKPEFDSPEEHESFTINAIKRRYSDMCLNNESLDKNNTPSQADCFYT 293

Query: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EI-EEDGQKIYEY 302
           LFK+FK PL+R+   + +KTI + N  LN+ L   WL +K+GF++  EI EE  ++  EY
Sbjct: 294 LFKIFKGPLTRKSKTEPVKTIDSGNLALNTHLNPEWLTSKYGFQVSSEIDEETNERFTEY 353

Query: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361
            PPD  ++V++ +VR+ RES++RK L+L+F G+ S  L+  +  + N+K ++     QT 
Sbjct: 354 LPPDMVDYVDDLKVRKIRESFVRKCLQLLFWGQLSTSLLAPNSPLKNTKSVKGLSCLQTS 413

Query: 362 FSHSFWYHLMGEYDHN---DFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDP 418
           FS   W+HL+GE       + N+   P D   HFV+LS ++YY+DRDII+NYE+  +LDP
Sbjct: 414 FSSLPWFHLLGESRSRILLNSNESHSPLDAEPHFVNLSVSHYYTDRDIIRNYESLSSLDP 473

Query: 419 ANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEF 478
            N  +Y+D L+++AN KG+ QL+ Y  KQ+++G EAL +AL +F ++P   +  +L++  
Sbjct: 474 KNIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLVFKIEPKECNIAELNEAT 533

Query: 479 LLESYK--EVCKDSGPQKHXXXXXXXXXX-XXYKESDKLKFYVEVEPFPNELQAYKLLXX 535
           LL  YK     K      H             Y +SDKLKFYV+ EP+    QAY  L  
Sbjct: 534 LLSIYKFETSNKSQVTSGHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLSI 593

Query: 536 XXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHM 595
                     TAYS+K++D+PGLK+DC RALYT+A++K+S+ LFN L  +CP+F  +Y  
Sbjct: 594 DESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKKSLDLFNFLTDECPQFLTYYGA 653

Query: 596 SYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKL 655
             L YQ AL+ L VN NA+D+ IL+IF++KW  + +  P+Q L LK ALTKI  ERNS L
Sbjct: 654 EQLDYQEALKLLQVNENASDETILKIFKQKWFDESVYEPDQFLTLKAALTKISIERNSNL 713

Query: 656 INHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXX 715
           I++FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR YIL Y  T    
Sbjct: 714 ISNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYILDYQKTVENF 773

Query: 716 XXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLS 775
                    +  RRIGGR IS+ EVERSVQF+YQLR+LF+ MVHSRER VTP++EL YL+
Sbjct: 774 NDHLSNSGHV--RRIGGRKISKGEVERSVQFIYQLRNLFYAMVHSRERCVTPSKELAYLA 831

Query: 776 FSPSSTEVEF--EPVPPAVGTA 795
           F+PS+ EVEF  E   PA G A
Sbjct: 832 FAPSNIEVEFEVEGNKPADGAA 853

 Score =  400 bits (1029), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 196/371 (52%), Positives = 257/371 (69%), Gaps = 2/371 (0%)

Query: 1018 DITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLD 1077
            ++ +VG  +     + T VAKISSDQLEN LE+GRQQDVTECIGNVL+QIES S P+  D
Sbjct: 903  NVQIVGGDDTTDLNSLTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIKYD 962

Query: 1078 EEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFK 1137
            E+ EQ+DLVKQLFYG  KQ ++PL   ++ RTK+ERF+SLL+NIGDHPKDIYDA DSYFK
Sbjct: 963  EDNEQYDLVKQLFYGTTKQSIVPLSATNKVRTKVERFLSLLINIGDHPKDIYDAFDSYFK 1022

Query: 1138 DDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRY 1197
            D+ LT+ E+ G V R+VAV   P +LQ+QIQRVYYDRE+FMPFKS EPLPF E +YMDRY
Sbjct: 1023 DEYLTM-EEYGDVTRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRY 1081

Query: 1198 LATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTS 1257
              T+N  L AKK +                   ++++ G+T   A  ++ + L+++ +  
Sbjct: 1082 ADTENPLLLAKKNETEEMKQKLRVMKNRQRELLSRDNSGLTRKDAFLESIKLLESSVVEK 1141

Query: 1258 GSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFI 1317
             + + + +     +                  +I ++++ I+H+FD F  YGYSL +VFI
Sbjct: 1142 TTLKTEVKIDVINT-LRTNVNNIDNELMSLYNNINNLEEKISHQFDDFKEYGYSLFSVFI 1200

Query: 1318 HRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAH 1377
            HRGEASYGHYW+YIKD  + G+WRKYNDE+V+EV E EVF+F+E NTATPYFLVYVK+  
Sbjct: 1201 HRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYFLVYVKQGQ 1260

Query: 1378 ELDIEPLKRLL 1388
            E DIEPLKR+L
Sbjct: 1261 EADIEPLKRIL 1271

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/861 (43%), Positives = 540/861 (62%), Gaps = 54/861 (6%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRV-TVSLSE----------EGREVLRAPMLEYA 69
           DDG+ +LY ++A   P+KTSDRLLDD+   T+ L+           + R +L+  ML Y+
Sbjct: 54  DDGKHLLYPDIATNLPLKTSDRLLDDILCDTIFLNSTDPKVMQKGLQSRGILKESMLSYS 113

Query: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125
             R++ R   +G L DQVV QT  EY S +C + N++HVF  V+ +P    Q+ ++ D++
Sbjct: 114 TFRSSIRPNCLGSLTDQVVFQTKSEYDSISCPKYNKIHVFQAVIFNPSLAEQQISTFDDI 173

Query: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185
           V   IYHL+V+VK+R +LER ++H GV Q+H +D LH +D+ D   F+  DP ++D   Y
Sbjct: 174 VKIPIYHLKVSVKVRQELERLKKHVGVTQFHSLDHLHEYDRVDLSTFDSSDPNLLDYGIY 233

Query: 186 VASGTNRLVRIEVLRPEFG-PDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244
           V+  TN+L+ IE+ +PEF  P+E + FT + I+ RY  +C ++  LD S+ PSQ +C  T
Sbjct: 234 VSDDTNKLILIEIFKPEFNSPEEHESFTADAIKKRYNAMCVKNESLDKSETPSQVDCFYT 293

Query: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EIEEDGQKIY-EY 302
           LFK+FK PL+R+   +  KTI + N  LN+ L   WL +K+GF+   EI+E+  +I+ EY
Sbjct: 294 LFKIFKGPLTRKSKAEPTKTIDSGNLALNTHLNPEWLTSKYGFQASSEIDEETNEIFTEY 353

Query: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361
            PPD  ++V + E R+ RES++RK L+LIF G+ S  L+  +  + N+K ++     QT 
Sbjct: 354 VPPDMVDYVNDLETRKIRESFVRKCLQLIFWGQLSTSLLAPNSPLKNTKSVKGMSSLQTS 413

Query: 362 FSHSFWYHLMGEYDHN---DFNQQMH-PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALD 417
           FS   W+HL+GE       + N+Q H P D   HF++LS ++YY+DRDII+NYE+  +LD
Sbjct: 414 FSTLPWFHLLGESRARILLNSNEQTHSPLDAEPHFINLSVSHYYTDRDIIRNYESLSSLD 473

Query: 418 PANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDE 477
           P N  +Y+D L+++AN KG+ QL+ Y  KQ+++G EAL +AL +F ++P   +  +L++ 
Sbjct: 474 PENIGLYFDALTYIANRKGAYQLIAYCGKQDIIGQEALENALLMFKINPKECNISELNEA 533

Query: 478 FLLESYK-EVCKDSGPQKH--XXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLX 534
            LL  YK E    S    +              Y +SDKLKFYV+ EP+    QAY  L 
Sbjct: 534 TLLSIYKYETSNKSQVTSNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLS 593

Query: 535 XXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYH 594
                      TAYS+K++D+PGLK+DC RALYT+A++KRS+ LFN L ++CP+F  +Y 
Sbjct: 594 IDESVDEDIIKTAYSVKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTEECPQFSNYYG 653

Query: 595 MSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSK 654
              L YQ AL+ L VN NA+D+ IL+IF++KW  + +  P+Q L L+ ALTKI  ERNS 
Sbjct: 654 PEKLDYQEALKLLQVNENASDETILKIFKQKWFDENVYEPDQFLILRAALTKISIERNST 713

Query: 655 LINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXX 714
           LI +FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR Y+L Y  T   
Sbjct: 714 LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRRYVLEYQKTVEN 773

Query: 715 XXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774
                     +  RRIGGR IS+ EVERS+QF+YQLR+LF+ MVH+RER VTP++EL YL
Sbjct: 774 FNDHLSNSGHI--RRIGGREISRGEVERSIQFIYQLRNLFYAMVHTRERCVTPSKELAYL 831

Query: 775 SFSPSSTEVEFE----PVPPAVGTASNAL--VANEVYN---EDTEVIDISMEECDEDSAI 825
           +F+PS+ EVEFE     V    G  S++     ++ +    +DT +ID+ ME+       
Sbjct: 832 AFAPSNVEVEFEVEGNKVVDQTGVLSDSKKETTDDAFTTKIKDTSLIDLEMEDG------ 885

Query: 826 NELGASNISVKLDSDIGTDSN 846
                      L+ D+GTD+N
Sbjct: 886 -----------LNGDVGTDAN 895

 Score =  398 bits (1022), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/403 (51%), Positives = 261/403 (64%), Gaps = 14/403 (3%)

Query: 986  ESGLSDSAANAEYTSAGPLEDRQAVENDDSGKDITMVGSPEAEGPETSTYVAKISSDQLE 1045
            E GL+               D +  EN+D+    T + SP        T VAKISSDQLE
Sbjct: 883  EDGLNGDVGTDANRKKNESNDAEVSENEDT----TGLTSP--------TRVAKISSDQLE 930

Query: 1046 NTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPD 1105
            N LE+GRQQDVTECIGNVL+QIES S P+  DE+ EQ+DLVKQLFYG  KQ ++PL   +
Sbjct: 931  NALEMGRQQDVTECIGNVLFQIESGSEPIRYDEDNEQYDLVKQLFYGTTKQSIVPLSATN 990

Query: 1106 RKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQI 1165
            + RTK+ERF+SLL+NIGDHPKDIYDA DSYFKD+ LT+ E+ G V R+VAV   P +LQ+
Sbjct: 991  KVRTKVERFLSLLINIGDHPKDIYDAFDSYFKDEYLTM-EEYGDVIRTVAVTTFPTILQV 1049

Query: 1166 QIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXX 1225
            QIQRVYYDRE+ MPFKS EPLPF E +YMDRY  T+N  L AKK++              
Sbjct: 1050 QIQRVYYDRERLMPFKSIEPLPFKEVIYMDRYADTENPLLLAKKKETEEMKQKLKVMKNR 1109

Query: 1226 XXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXX 1285
                 +++D G+T   A  ++ + L++  +     ++ E  +                  
Sbjct: 1110 QRELLSRDDSGLTRKDAFLESIKLLESDTIKKTPLKI-EAANDVIKTLRNNVQNIDNELM 1168

Query: 1286 XXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYND 1345
                 I S+++ I+H+FD F  YGYSL +VFIHRGEASYGHYW+YIKD    GIWRKYND
Sbjct: 1169 KLYNDINSLEEKISHQFDDFKEYGYSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYND 1228

Query: 1346 ESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388
            E+++EV E EVF+F+E NTATPYFLVYVK+  E DIEPLKR+L
Sbjct: 1229 ETISEVQEEEVFNFNEGNTATPYFLVYVKQGQEGDIEPLKRIL 1271

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/792 (46%), Positives = 507/792 (64%), Gaps = 28/792 (3%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV--------SLSEEGRE---VLRAPMLEYA 69
           DDG+ +LY ++A   P+KTSDRLLDD+            S+ E G +   +L+  ML Y+
Sbjct: 54  DDGKHLLYPDIATYLPLKTSDRLLDDILCDTAFFNSTDPSVIERGLQTSGILKKSMLSYS 113

Query: 70  RQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG---QRFASQDEL 125
             R+  R  ++G L DQVVLQT  EY S +C Q N++ V   V+ +P    Q+ A+ D++
Sbjct: 114 NFRSRIRPDALGSLTDQVVLQTKTEYDSISCPQYNKIQVLQAVIFNPSLPEQQIAAFDDI 173

Query: 126 VNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATY 185
           V   IYHL+VTVKIR +LER ++H GV Q+H +D LH +D  D   F+  DP + D   Y
Sbjct: 174 VKIPIYHLKVTVKIRQELERLKKHVGVTQFHALDHLHEYDLADLSTFDSSDPNLKDYGIY 233

Query: 186 VASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNT 244
           V+  TN+L+ IE+  PEF  P+E   FT   I+ RY +VC ++  L+ ++ PSQ +C  T
Sbjct: 234 VSDDTNKLILIEIFNPEFDSPEERDSFTTAAIQKRYNDVCLKNESLNENETPSQPDCFYT 293

Query: 245 LFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELC-EI-EEDGQKIYEY 302
           LFK+FK PL+R+   D +KTI + N VLN+ L   WL +K+GF+   EI EE  +   EY
Sbjct: 294 LFKIFKGPLARKSTADPIKTIDSGNIVLNTHLNPEWLTSKYGFQASSEIDEETNESFTEY 353

Query: 303 KPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTH 361
            PPD  ++V +W++R+ RESY+RK L+LIF G+ S  L+  + ++ N+K ++     QT 
Sbjct: 354 VPPDMVDYVGDWKIRKIRESYVRKCLQLIFWGQLSASLLAPNSLLKNTKSVKGLSSIQTS 413

Query: 362 FSHSFWYHLMGEYDHN---DFNQQMH-PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALD 417
           FS   W+ L+GE       +FN+Q H P D   HF++LS ++YY+DRDII+NYEA  +LD
Sbjct: 414 FSILPWFQLLGESRARILLNFNEQAHSPLDAEPHFINLSVSHYYTDRDIIRNYEALSSLD 473

Query: 418 PANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDE 477
           P N  +Y+D L+++AN KG+ Q++ Y  KQ+++G EAL +AL +F +DP   D  +L++ 
Sbjct: 474 PENIGLYFDALTYIANRKGAYQIIAYCGKQDIIGQEALENALMVFKIDPKDYDIAELNEA 533

Query: 478 FLLESYK--EVCKDSGPQKHXXXXXXXXXX-XXYKESDKLKFYVEVEPFPNELQAYKLLX 534
            LL  YK     K+     H             Y +SDKLKFYV+ EP+    QAY  L 
Sbjct: 534 TLLSIYKFETSNKNKAASNHLTNLKNALRLLAKYTKSDKLKFYVDHEPYRALSQAYDTLA 593

Query: 535 XXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYH 594
                      TAYSIK++D+PGLK+DC RALYT+A++KRS+ LFN L  +CP+F  +Y 
Sbjct: 594 IDESVDEDIIKTAYSIKINDSPGLKLDCDRALYTIAISKRSLDLFNFLTDECPQFQNYYG 653

Query: 595 MSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSK 654
              L YQ AL+ L VN NA+D+ IL+IF+ KW  + +  P+Q L LK ALTKI  ERNS 
Sbjct: 654 PEKLDYQEALKLLQVNENASDETILKIFKGKWFDENVYEPDQFLILKAALTKISIERNSN 713

Query: 655 LINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXX 714
           LI +FL TG +D N LP  NWPTGINNIGNTCYLNSLLQYYF+I+PLR YIL Y  T   
Sbjct: 714 LITNFLLTGTIDPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQKTLNN 773

Query: 715 XXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774
                     +  RR+GGR IS+ EVERS+QF++QLR+LF+ MVHSRER VTP++EL YL
Sbjct: 774 FNDHLSNSEHV--RRVGGREISEGEVERSIQFIHQLRNLFYAMVHSRERCVTPSKELAYL 831

Query: 775 SFSPSSTEVEFE 786
           +F+PS+ EVEFE
Sbjct: 832 AFAPSNVEVEFE 843

 Score =  408 bits (1049), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/371 (53%), Positives = 258/371 (69%), Gaps = 2/371 (0%)

Query: 1018 DITMVGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLD 1077
            D+ ++ + +A    + T VAKISSDQLEN LE+GRQQDVTECIGNVL+QIES S P+  D
Sbjct: 901  DVEIIMTDDATDLASPTRVAKISSDQLENALEMGRQQDVTECIGNVLFQIESGSEPIRYD 960

Query: 1078 EEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFK 1137
            E+ EQ+DL+KQLFYG  KQ ++PL   D+ RTK+ERF+SLLVNIGDHPKDIYDA DSYF+
Sbjct: 961  EDNEQYDLIKQLFYGTTKQCIVPLSATDKVRTKVERFLSLLVNIGDHPKDIYDAFDSYFR 1020

Query: 1138 DDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRY 1197
            D+ LT+ E  G V+R+VAV   P +LQ+QIQRVYYDRE+FMPFKS EPLPF E +YMDRY
Sbjct: 1021 DEYLTMAE-YGDVKRTVAVTTFPTILQVQIQRVYYDRERFMPFKSIEPLPFKEVIYMDRY 1079

Query: 1198 LATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTS 1257
              TDN  L AKK++                    ++  G+T   A  +T + L+++ + +
Sbjct: 1080 ADTDNLTLLAKKEETEQLKQKSKDMKNRQRELLNRDGSGLTRKDAFLETIKLLESSIVEN 1139

Query: 1258 GSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFI 1317
                ++++ +   +                   I S++D I+H+FD F  YGYSL +VFI
Sbjct: 1140 TVLNIEDKKNLIKT-LKNKVTDIDNELMSLYSDINSLEDKISHQFDDFKEYGYSLFSVFI 1198

Query: 1318 HRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAH 1377
            HRGEASYGHYW+YIKD    G+WRKYNDE+++EVPE EVF+F+E NTATPYFLVYVK+  
Sbjct: 1199 HRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYFLVYVKQGQ 1258

Query: 1378 ELDIEPLKRLL 1388
            E DIEPLKR+L
Sbjct: 1259 EADIEPLKRIL 1269

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/774 (44%), Positives = 494/774 (63%), Gaps = 18/774 (2%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVT-VSLSEEGREVLRAPMLEYARQRANARTWS 79
           DDG+T+LYG++++  P KT DR+LDD+R++   L + G  V++ PML+Y+R+R   + W+
Sbjct: 39  DDGKTLLYGDISKSFPFKTCDRILDDIRISPWFLKKFGSSVMKQPMLQYSRERQQLQPWN 98

Query: 80  VGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCDPG---QRFASQDELVNYRIYHLRV 135
           + +L+DQV L++ ++Y S TC  +N + V   +L DP      F   D+   Y  +HL++
Sbjct: 99  LVHLIDQVNLRSRYDYDSMTCPGKNTISVMFALLVDPNFTPNDFDDIDKFPEY-FFHLKI 157

Query: 136 TVKIRPQLERARQHYGVAQYHLVD--ELHPWDKPDFCLFEDGDPAVVDSATYVASGTNRL 193
           TVK R  LE   +H G+  YH+++   LHP+DK D  + E+ D  +VD + +V++ TN+L
Sbjct: 158 TVKRRSYLENFNRHVGITHYHVLEPESLHPFDKRDIFIMEEKDCRLVDQSIFVSADTNKL 217

Query: 194 VRIEVLRPEFGPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVFKNPL 253
           + +E+++PEF  + L E+   +I  RY   C+    L+P DIPSQAECL TLF +FKNPL
Sbjct: 218 ILVEIIKPEFNSENLAEYRTAKIEERYKNACQEFDLLNPDDIPSQAECLKTLFMIFKNPL 277

Query: 254 SRQKAQDELKTISADNKVLNSQLEANWLVTKFGFEL--CEIEEDGQKIYEYKPPDFTEHV 311
            R+ A  E K IS D+  LNSQ+  +WL T F F L    +E++ Q   EYKPPD  +++
Sbjct: 278 QRKSANSEFKIISRDSVALNSQINTDWLTTMFDFSLQKTAVEDNVQSGEEYKPPDLVDYI 337

Query: 312 ENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSKLRSFQLYQTHFSHSFWYHLM 371
            +++VR  RE+Y RKS+E++ +GKQS+ L  +      +  + F       SH++W++++
Sbjct: 338 TDFKVRGIREAYTRKSMEVVLIGKQSMLLENELGTEKKTVAKCFSNQHFSASHTWWFNIL 397

Query: 372 GEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDDLSFV 431
                  F     PYD NYHF++LS  + Y D+DIIKNYE QIALD  N S Y+D L +V
Sbjct: 398 NHQHIEPF-----PYDINYHFINLSVAFKYIDKDIIKNYETQIALDQENISHYFDALQYV 452

Query: 432 ANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVCKDSG 491
            N+KGS QL+ Y  KQ+VVG+E L +AL++F LDP+  D   L    ++E Y      S 
Sbjct: 453 TNAKGSYQLIAYCGKQDVVGYEDLNNALQVFGLDPTDIDASLLDANTMIEYYNSHLLRSS 512

Query: 492 PQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXXXXXXTAYSIK 551
             +             Y  S K+ F VE EP+ N  QAY LL            TAY+I 
Sbjct: 513 DNQRKDLRNALRVLGKYLGSQKMLFLVEYEPYYNVQQAYTLLKVDETVDDDIIQTAYTIN 572

Query: 552 VSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVNV 611
           ++DAPGLK D  RA++T+A+ +RSI L N+L  +CP+F Q+Y+ + +SY  AL  + +++
Sbjct: 573 IADAPGLKKDYDRAIFTIALDRRSIFLLNVLTDECPEFAQYYNCTDISYDEALNIIEIDM 632

Query: 612 NATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDINYLP 671
           NA+DD+ILE+FQ+KWS+  +  P+ LL LK+AL  IGF RNSKLINHFL+TG+VD++ LP
Sbjct: 633 NASDDVILEVFQKKWSHGIMTGPDYLLKLKMALQNIGFTRNSKLINHFLDTGIVDVSCLP 692

Query: 672 AGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDMGRRRIG 731
              WP GINN+GNTCYLNSLLQ++FTI PLR++IL YD                 RRRIG
Sbjct: 693 VATWPAGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDASEYH---SRRRIG 749

Query: 732 GRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEF 785
           GR +S+ E  RSVQFVY LR LF++M+H+  R VTPT+ELVYL+F+PS+ EVEF
Sbjct: 750 GREVSKQEELRSVQFVYHLRDLFNDMIHTNSRCVTPTKELVYLAFAPSNVEVEF 803

 Score =  402 bits (1034), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/382 (55%), Positives = 264/382 (69%), Gaps = 13/382 (3%)

Query: 1018 DITMVGSP----------EAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQI 1067
            DI M  SP          EA   + S  VAKIS+DQLENTLEIGRQQDVTECIGNVL Q+
Sbjct: 837  DIIMCQSPVALPEHKTSSEAGTQQYSVQVAKISADQLENTLEIGRQQDVTECIGNVLAQL 896

Query: 1068 ESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKD 1127
            E AS PLSL+++ EQ DLVKQLFYG++KQ+LIP+      RTK ERF+SLLVN GDHPKD
Sbjct: 897  EIASEPLSLEDDLEQNDLVKQLFYGRIKQDLIPVNDEASVRTKYERFLSLLVNTGDHPKD 956

Query: 1128 IYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLP 1187
            IYDALD YF++D L L E+ G V+R+V+++ELP +LQIQIQRVYYDREKFMPFKS EPLP
Sbjct: 957  IYDALDFYFQNDYLNL-EEYGDVKRTVSISELPAVLQIQIQRVYYDREKFMPFKSIEPLP 1015

Query: 1188 FGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTR 1247
            FGE LYMDRY+AT++ +L A+ QQ                   ++N+ G+TL ++L +T+
Sbjct: 1016 FGETLYMDRYMATEDPKLLAEIQQNAELKQKLQDLKQRQRKLLSQNEIGLTLKSSLIETK 1075

Query: 1248 RFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSS 1307
            +FL +  L +      +   ++ ++                  I  ++  I+ +F  F  
Sbjct: 1076 KFLQSGTLKAHDID-ADNIPSSIAYIDILINNIDEELKSLFNKITDLETTISQQFSEFKH 1134

Query: 1308 YGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATP 1367
             GYSL AVFIHRGEASYGHYWVYIKD    GIWRKYND+SVTEVP+SEVF+F+E NTATP
Sbjct: 1135 IGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATP 1194

Query: 1368 YFLVYVKEAHELD-IEPLKRLL 1388
            YFLVYV+E  E + IEPLKR+L
Sbjct: 1195 YFLVYVREGQEQETIEPLKRIL 1216

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/794 (45%), Positives = 499/794 (62%), Gaps = 27/794 (3%)

Query: 17  LEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL-----SEEG-----------REV 60
           L + DDG  +LY NL    P+KTS+R+LDD+   + L     S+E              +
Sbjct: 64  LNELDDGSKLLYQNLMNMSPLKTSERILDDILSNIPLMKVINSKENCNTLRYNEQFNNSI 123

Query: 61  LRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCA-QNRVHVFMGVLCDPGQRF 119
           L+ PM+EY++ RA     S+G ++DQ+V+Q+ FEY S TC   N++ VFMGVL D  Q+ 
Sbjct: 124 LKQPMIEYSKLRATVHPDSIGSIVDQIVIQSKFEYKSVTCPNHNKIEVFMGVLIDSTQKA 183

Query: 120 ASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAV 179
            + D+L N  I H+++TVK R  LER R+  G++++HLV ELHP+D+ D   F+     +
Sbjct: 184 NTLDDLSNIIINHVKITVKTRTVLERTRRLMGLSKFHLVKELHPFDQKDLLTFDKNAANL 243

Query: 180 VDSATYVASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQ 238
           +D A YV+  TN+L+ IE+  PEF   +E   FT   I  RYL       +    DIP+ 
Sbjct: 244 IDHAIYVSEDTNKLILIEIFNPEFDSQEERGLFTPNVINQRYLHSLAEGEEPSTEDIPTG 303

Query: 239 AECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEED--- 295
            EC+NTLFKVFK PL+R+ + D +K I++DN +L   +   WLV+K+GF +  +E+D   
Sbjct: 304 IECINTLFKVFKGPLTRKSSNDPIKRINSDNPILRLHMNPEWLVSKYGFNMV-LEKDVET 362

Query: 296 GQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRS 354
           G +  EY+PPD T++V N + R+ RES  RK LELIF GK  + L+ K+ +  +SK LR+
Sbjct: 363 GDEFTEYEPPDLTDYVSNQQTRKIRESVTRKCLELIFFGKMMINLLSKEELEKSSKSLRT 422

Query: 355 FQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQI 414
           F L QT FS SF+  L+ E       +    Y+ +YHF++LS +Y+YS+RDII+ +E   
Sbjct: 423 FNLLQTSFSTSFFKLLIQERGVGLPIENQSNYNIDYHFINLSVSYHYSERDIIQMFEVIS 482

Query: 415 ALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQL 474
            +DP N   YYD L F+AN+KGS QL+ Y  K ++VG E+L +A++ F+LD S T    L
Sbjct: 483 KVDPDNIGHYYDSLQFIANAKGSYQLIAYCSKLDIVGQESLETAIKTFNLDLSVTALSSL 542

Query: 475 SDEFLLESYKEVCKDSG--PQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKL 532
            D  ++  Y+   K+     ++H            YK+S KLKF+V+ EP+ N   AY +
Sbjct: 543 EDSVIMSIYQAELKNKSLSQERHVNLRNALQVLASYKKSKKLKFFVDYEPYLNTRTAYNM 602

Query: 533 LXXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQF 592
           L            TAYSIKV+DAPGLK+DC RALYT+A+A+RSI LFN L +    F ++
Sbjct: 603 LEIDESIDDDIIQTAYSIKVNDAPGLKLDCDRALYTIAIARRSISLFNFLLENNLIFQEY 662

Query: 593 YHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERN 652
           Y     SY SAL  L VN NA+D+ ILE+FQ+KW  + +V+ + LL LK ALTKI F+RN
Sbjct: 663 YTADTFSYTSALSLLQVNENASDENILEVFQKKWFEEAMVAFDHLLKLKAALTKIAFQRN 722

Query: 653 SKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTX 712
           SKLI++FLETG++D + LPA NWPTG+NNIGNTCYLNSLLQYYF ISPLR+ I+ Y  T 
Sbjct: 723 SKLISNFLETGVIDPSCLPAENWPTGLNNIGNTCYLNSLLQYYFAISPLRDEIINYTKTV 782

Query: 713 XXXXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELV 772
                          RR+GGR  +  EVERSVQFVYQLR LF EM++S  R VTP +EL 
Sbjct: 783 DDIENNLQLQG--ITRRVGGRVTNTIEVERSVQFVYQLRDLFSEMIYSHSRCVTPKKELA 840

Query: 773 YLSFSPSSTEVEFE 786
           YL+F+PS+ EVEF+
Sbjct: 841 YLAFAPSNVEVEFD 854

 Score =  379 bits (974), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/360 (54%), Positives = 244/360 (67%), Gaps = 2/360 (0%)

Query: 1030 PETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQL 1089
            P TST VAKIS DQLEN LE+GRQQDVTECIGNVL Q+ESAS+PLSLD++ EQ DL+K  
Sbjct: 923  PVTSTRVAKISPDQLENALEMGRQQDVTECIGNVLNQLESASIPLSLDDDEEQNDLLKNC 982

Query: 1090 FYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGK 1149
            F  K KQ +IPLE     R KIERF+SLLVNIGDHPK+IYDALD YF D+LL + E+ G+
Sbjct: 983  FLVKTKQSIIPLEKSKPPRNKIERFLSLLVNIGDHPKNIYDALDLYFNDELLQM-EEYGE 1041

Query: 1150 VRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKK 1209
            VR+++++ E P +LQIQIQRVYYDREKF+PFKS EPLPFG  LYMDRY   DN EL   K
Sbjct: 1042 VRKTLSITEFPSILQIQIQRVYYDREKFIPFKSIEPLPFGNVLYMDRYAELDNKELIDTK 1101

Query: 1210 QQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHAT 1269
             +A                  ++N+ G++   +L +T+R L +  L +    +  +  + 
Sbjct: 1102 NKARIMKKELANMKKRQKELLSRNELGLSRKESLIETKRLLMSDVLDNNGIDVPMK-TSL 1160

Query: 1270 TSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWV 1329
             S                  +I  ++  I++ F  F S  Y+L AVFIHRGEASYGHYW 
Sbjct: 1161 ISQIEANLLEIDRELTTLFNNIRDMELNISNMFKEFQSIKYNLFAVFIHRGEASYGHYWT 1220

Query: 1330 YIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLLA 1389
            YIKD Q   IWRKYNDE++TEVP+SEVF+F E NTATPYFLVYVK  +  DIEPLKR+++
Sbjct: 1221 YIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATPYFLVYVKNENIDDIEPLKRIVS 1280

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/797 (44%), Positives = 493/797 (61%), Gaps = 27/797 (3%)

Query: 13  QNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL---------------SEEG 57
           Q  E+   DDG+ +LY N+    P+KT++RL+DD+   +S                +  G
Sbjct: 28  QRIEVRVADDGKQLLYPNVENHFPMKTAERLIDDIIADLSFLTGIAVDNGSRGDIDTMLG 87

Query: 58  REVLRAPMLEYARQRANARTWSVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPG 116
             +L+  ML Y++ +    ++ +G L+DQV LQT +EY S TC + N++ VF GVL +  
Sbjct: 88  NGILKQSMLNYSKVKNQPGSFEMGSLIDQVTLQTKYEYKSVTCPELNKLQVFFGVLFNNS 147

Query: 117 QRFASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGD 176
            +  + DE+  + IYHL+VTVK R  LE  ++H GV Q+HLVD+LH +DK D   F   D
Sbjct: 148 TQITNLDEVTQFPIYHLKVTVKTRNHLELTKKHAGVTQFHLVDQLHVYDKQDIPTFNPED 207

Query: 177 PAVVDSATYVASGTNRLVRIEVLRPEF-GPDELQEFTGERIRARYLEVCKRHPDLDPSDI 235
           P ++D A YV++ TN+L+ IEV +PEF   DE++ F  E I  RY + C++   L+P++ 
Sbjct: 208 PNLLDYAIYVSNDTNKLILIEVFKPEFQSADEIESFKSENINERYQKACEQFDTLNPNEP 267

Query: 236 PSQAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEED 295
           P+Q +CLNTLFKVFK PLSR+ + +  KTI + NK LNS +   WL +K+GF +  ++ED
Sbjct: 268 PTQLDCLNTLFKVFKGPLSRKSSDEPSKTIDSTNKTLNSHINPEWLTSKYGFNIV-VDED 326

Query: 296 ---GQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK- 351
               Q+  EY+PP+   +VE++EVRR RE+YIR+ L+LIF GK S+ L   D  + NSK 
Sbjct: 327 LPNAQQSVEYEPPELVNYVEDFEVRRLRETYIRRCLQLIFWGKLSINLRINDPTLKNSKS 386

Query: 352 LRSFQLYQTHFSHSFWYHLMGEYDHNDFN--QQMHPYDTNYHFVHLSSNYYYSDRDIIKN 409
            +S    QT+F+ +    L      N     +   P D N+HF++LS+ Y+Y+DRD+I+N
Sbjct: 387 YKSINALQTNFTITPLLQLFKGSGQNFLMGPESRSPLDFNFHFINLSACYHYTDRDVIRN 446

Query: 410 YEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSST 469
           YE    LDP N  +Y+D L+++AN+KGS QL+ Y  KQ++VG EAL  AL+ F+LDP   
Sbjct: 447 YERLCHLDPQNVGVYFDALNYIANTKGSYQLIAYCGKQDIVGQEALDQALKSFNLDPMEV 506

Query: 470 DPRQLSDEFLLESYKEVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQA 529
           D  +++D  LL  YK   K S                  K S KLKFY++ EP+    QA
Sbjct: 507 DITKINDSVLLTLYKNELKIST-SDIPNLKNAMRLFAKVKHSSKLKFYIDHEPYRRVAQA 565

Query: 530 YKLLXXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKF 589
           Y+ L            TAY IKV D+PGL MDC RALYT+A+ KRS++LF  L ++CP F
Sbjct: 566 YETLDIDESVDDDIVQTAYDIKVVDSPGLTMDCDRALYTIAIHKRSLLLFTFLIERCPDF 625

Query: 590 HQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGF 649
            ++Y     +Y  AL    VN NA D+LI++ FQ +W  + +  PE  +    AL +IG 
Sbjct: 626 QEYYCPDRFTYHDALSMFQVNENAADELIIKNFQARWFNESVFEPESFVICVHALVEIGL 685

Query: 650 ERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           +RNS LI++FL+TG +D N LP  +WP GINNIGNTCYLNSLLQYYF+I+PLR Y+L Y 
Sbjct: 686 QRNSSLISNFLQTGKIDPNCLPIKDWPAGINNIGNTCYLNSLLQYYFSIAPLRNYVLQYS 745

Query: 710 HTXXXXXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTR 769
            T             +  RRIGGR +S  EVERS+QF+YQLR LFH MV+S ER VTP R
Sbjct: 746 KTIEDFKTLENNASTV--RRIGGREVSNNEVERSIQFIYQLRDLFHAMVYSNERCVTPRR 803

Query: 770 ELVYLSFSPSSTEVEFE 786
           EL YL+F+PS+ EVEFE
Sbjct: 804 ELAYLAFAPSNIEVEFE 820

 Score =  399 bits (1025), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 215/424 (50%), Positives = 280/424 (66%), Gaps = 15/424 (3%)

Query: 968  SSDTANTGSTRPNPSSTPESGLSDSAANAEYTS--AGPLEDRQAVENDDSGKDITMVGSP 1025
            S D + + +  P  +   E  +++S  N + ++  + P +D    +N D     T+V + 
Sbjct: 853  SGDISMSDNITPKDAEEEEDQVAESNKNQDVSAIVSSPTKDIIMTDNTD-----TVVSN- 906

Query: 1026 EAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDE-EGEQFD 1084
              EG  TST VAKISSDQLEN LE+GRQQDVTECIGNVL+Q+ES S PL L E + EQ D
Sbjct: 907  --EG--TSTKVAKISSDQLENALEMGRQQDVTECIGNVLFQLESGSEPLDLHENDNEQDD 962

Query: 1085 LVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLD 1144
            LVKQLFYG+L+Q ++PL  PD++R K+ERF+SLLVNIGDHP+DIYDALD YFKD+ L ++
Sbjct: 963  LVKQLFYGELEQTIVPLANPDQRRPKLERFLSLLVNIGDHPRDIYDALDLYFKDEYLKME 1022

Query: 1145 EDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAE 1204
            E  G V+R+VAV + P +LQIQIQRVYYDREKFMPFKS EPLPF EK+YMDRY  TDN E
Sbjct: 1023 EY-GDVKRTVAVTKFPTILQIQIQRVYYDREKFMPFKSIEPLPFEEKIYMDRYSVTDNPE 1081

Query: 1205 LNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQE 1264
            L A+K + +                 ++N  G++   +  +  + L +  L S    L E
Sbjct: 1082 LIARKNETLLMKEKLVELKKKQRDLLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPE 1141

Query: 1265 QYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASY 1324
            +    +S                   I+ +++ I  +F+ F   GYS+ AVFIHRGEASY
Sbjct: 1142 KDEMVSS-LKTLTAGIDDELNQLYAEISQLEETINGQFNEFKGIGYSIFAVFIHRGEASY 1200

Query: 1325 GHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPL 1384
            GHYW+YIKD    GIWRKYNDE+V+EVPE EV++F+E NTATPYFLVYVKE  E +IEPL
Sbjct: 1201 GHYWIYIKDRSQNGIWRKYNDETVSEVPEEEVYNFTEGNTATPYFLVYVKEGEEQEIEPL 1260

Query: 1385 KRLL 1388
            KR++
Sbjct: 1261 KRII 1264

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/858 (42%), Positives = 528/858 (61%), Gaps = 39/858 (4%)

Query: 17  LEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVS------LSEEGREVLRAPMLEYAR 70
           L   DDG+ +LY  +    P KT DRL+DD+   ++      LS E + +L++  L Y++
Sbjct: 32  LPPNDDGKQLLYPAVGLNLPFKTPDRLIDDIVYDLAFINDSDLSSEFKGILKSSPLTYSK 91

Query: 71  QRANAR-TWSVGYLLDQVVLQTSFEYTSRTCA-QNRVHVFMGVLCDPG-QRFASQDELVN 127
           +R   R ++ +G  +DQ+ LQT +EY S +C   NR++VF GVL D   +   S D +  
Sbjct: 92  RRQELRPSYHLGTFIDQITLQTKYEYESISCPDHNRINVFFGVLIDSNMENPTSFDAVAE 151

Query: 128 YRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVA 187
             IYHL+VTVK R +LE  ++H G++ YHL+ ELHP+DK D   F++ D  ++D A YV+
Sbjct: 152 TPIYHLKVTVKTRTKLEHLKKHVGISHYHLITELHPFDKQDLLTFDESDENLIDFAAYVS 211

Query: 188 SGTNRLVRIEVLRPEFGPDELQEFTG-ERIRARYLEVCKRHPDLDPSDIPSQAECLNTLF 246
           S TN+L+ IE+ +PEF  +E  E    E I +RY  VC+++  L+   IPSQ +C  TLF
Sbjct: 212 SDTNKLILIEIFKPEFSSEEEIESFKTEHITSRYQLVCEQYDSLNSDTIPSQVDCFRTLF 271

Query: 247 KVFKNPLSRQKAQ-DELKTISADNKVLNSQLEANWLVTKFGFELCEIE--EDGQKIYEYK 303
           +VFK PL R+ A  D +KTI+A NK LNS +++ WLV+K+GF+    +  E   +  EY+
Sbjct: 272 RVFKGPLDRKSADLDPIKTINATNKALNSHMDSKWLVSKYGFQENSFQNPEANDQGLEYE 331

Query: 304 PPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVSNSK-LRSFQLYQTHF 362
           PPD  +H  +W++R+ R+SY RK L+L F GK S +L+ K  +    K  R F    TH 
Sbjct: 332 PPDLIDHKNDWKIRKLRDSYTRKCLQLAFWGKLSNKLLSKANIQKYEKSYRFFNKMHTHT 391

Query: 363 SHSFWYHLMGEYDHNDFNQQMH-------PYDTNYHFVHLSSNYYYSDRDIIKNYEAQIA 415
           S +  + +      ND  +++        P D NYHF++LSS+YYY+DRDII+NYE    
Sbjct: 392 STTALFQIF-----NDSARRLQQDDTSASPLDNNYHFINLSSSYYYTDRDIIQNYETLCN 446

Query: 416 LDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLS 475
           +D  N  IY+D L+++AN+KGS QL++Y  KQ+VVG E L ++LR+  LD +S D + L+
Sbjct: 447 IDTNNKGIYFDALTYIANTKGSYQLISYCGKQDVVGQEVLQNSLRVLGLDATSVDIKSLN 506

Query: 476 DEFLLESYKEVCKDS--GPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLL 533
           D  L   YK+    S    Q+                S KL+F+++ EP+PN + AY LL
Sbjct: 507 DSLLFSIYKQEQNASRGDMQRLTELKSAMRVMIKLMRSKKLQFFIDHEPYPNVMDAYNLL 566

Query: 534 XXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFY 593
                       TAY+I+++D+PGLKMDC +ALYT+A+  RSI LFN L +QCP F  +Y
Sbjct: 567 DIDESVDDDIVQTAYTIRINDSPGLKMDCDKALYTIAIRTRSITLFNFLMEQCPDFITYY 626

Query: 594 HMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNS 653
               LS+Q AL  L VN NATD+L+++IFQ++W    L   +QLL LK ALTKI  E+NS
Sbjct: 627 GPDCLSFQQALSLLQVNENATDELVIKIFQQRWGQKILNEYDQLLILKAALTKIASEKNS 686

Query: 654 KLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXX 713
           KLI++FLETG++D N L   NWP G+NNIGNTCYLNSLLQYYF+I+PLREYIL Y  +  
Sbjct: 687 KLISYFLETGVIDANLLQPENWPIGLNNIGNTCYLNSLLQYYFSIAPLREYILNYKGSIS 746

Query: 714 XXXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVY 773
                        +RRIGGR +S+ EVERS+QF+YQLR LF++M++S+ R +TP  EL Y
Sbjct: 747 NYEIDETS----NKRRIGGREVSENEVERSIQFMYQLRDLFNDMIYSKSRCITPKHELAY 802

Query: 774 LSFSPSSTEVEFEPVPPAVGTASNALVANEVYNE-DTEVIDISMEECDEDSAINELGASN 832
           L+F+PS+ EVEF     A        V      E D +++D+S +  +  +   E+  S+
Sbjct: 803 LAFAPSNIEVEF-----AASEVERTTVDLPFDKEGDIDLVDLSNDNLNTTNNAQEV-TSD 856

Query: 833 ISVKLDSDIGTDSNSNLA 850
           ISV  +  + T++++  A
Sbjct: 857 ISVATEDKVMTNTSTKTA 874

 Score =  364 bits (934), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 248/375 (66%), Gaps = 15/375 (4%)

Query: 1022 VGSPEAEGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGE 1081
            V + +     TST  AKISSDQLEN LE+GRQQDVTECIGNVLYQ+ESAS P+ LDE+ E
Sbjct: 859  VATEDKVMTNTSTKTAKISSDQLENALEMGRQQDVTECIGNVLYQMESASKPIKLDEDFE 918

Query: 1082 QFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLL 1141
            Q+DL+K+LFYGK KQE++PL    + RTK E F SLLVNI DHP+DIYDAL+S F  + L
Sbjct: 919  QYDLIKELFYGKTKQEIVPLSDISKTRTKYEGFSSLLVNISDHPRDIYDALESSFASEFL 978

Query: 1142 TLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATD 1201
             +DE  G V+R+V++   P +LQIQIQRVYYDRE+FMPFKS EPLPF   +YMDRY A D
Sbjct: 979  KMDE-YGDVQRTVSITNFPKILQIQIQRVYYDRERFMPFKSIEPLPFSNTIYMDRYAALD 1037

Query: 1202 NAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFL-DAAELTS--- 1257
            N  L  KK +                    +N+ G++   +  +T  FL D A +TS   
Sbjct: 1038 NELLQTKKNETKELRNKLKTLKARQVELLNRNELGLSRKESYLETINFLSDEATVTSQGL 1097

Query: 1258 ---GSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGA 1314
                  Q+ E+     S+                  I  +++ I H+FD F   GYSL A
Sbjct: 1098 SVLNRGQIIEKLRKAISN-------IDSELSQIYDEINLIENKIDHQFDEFRDIGYSLFA 1150

Query: 1315 VFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVK 1374
            VFIHRGEASYGHYWVYIKD +  GIWRKYNDE+VTEV E EVF+F+E NTATPYFLV+VK
Sbjct: 1151 VFIHRGEASYGHYWVYIKDPERSGIWRKYNDETVTEVNEEEVFNFTEGNTATPYFLVFVK 1210

Query: 1375 EAHELDIEPLKRLLA 1389
            + ++ DIEPLKR++A
Sbjct: 1211 DYYKGDIEPLKRIIA 1225

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/828 (44%), Positives = 512/828 (61%), Gaps = 27/828 (3%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL--------SEEGREVLRAPMLEYARQR 72
           DDG+ +LY +L    P+KTSDRL+DD+   +SL        SE+ + +L+   + Y++QR
Sbjct: 52  DDGKHLLYTDLKNGSPMKTSDRLIDDILCDLSLNGQSQCLLSEQSQGILKLLPIIYSKQR 111

Query: 73  ANARTWSV-GYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPGQRFASQDELVNYRI 130
              +  S+ G LLDQV+ QT FEY+S +C Q N++ VF+GVL +    F S D++V   +
Sbjct: 112 QQLQNVSILGSLLDQVLFQTKFEYSSVSCPQHNKLQVFLGVLLNVSSSFESTDDVVRSPL 171

Query: 131 YHLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASGT 190
           +HL+VTVK R QLE  ++H GV+Q+  VD LH +DK D   F+  D  ++D A YV+S T
Sbjct: 172 FHLKVTVKTRSQLELYKKHAGVSQFFSVDSLHSYDKEDLGTFDPEDTRLIDYAIYVSSDT 231

Query: 191 NRLVRIEVLRPEFG-PDELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVF 249
           N+LV IE+  PEF   +E++ FT + IR RY++ C R   L+P DIP+Q +CLNTL+K F
Sbjct: 232 NKLVLIEIFHPEFNTSEEIESFTVDGIRKRYVDTCSRLDSLNPEDIPNQFDCLNTLYKTF 291

Query: 250 KNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIYEYKPPDFTE 309
           KNP+++      L+TI A N +LNS + ANWL  ++GF L    E+     EY+PP+FT 
Sbjct: 292 KNPINKTDPSAPLQTIKASNPILNSHMNANWLTERYGFTLLP-GENEDDEDEYEPPNFTT 350

Query: 310 HVENWEVRRFRESYIRKSLELIFLGKQSLRLVPK----DVVVSNSKLRSFQLYQTHFSHS 365
           ++ + +VR+ +E YIRK L+LIF  K  + +V       +  S+   +S        +  
Sbjct: 351 YIMDPKVRKMKECYIRKCLQLIFWAKLMIEVVDNTQRSKLAASSKSFKSLSGIAVQNTSK 410

Query: 366 FWYHLMGEYDHNDF---NQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANAS 422
             Y L GE   N F   N Q + +DTNYHF+ LS++Y+Y+DRDII NYE    +D  N  
Sbjct: 411 PLYQLFGE-SKNAFLNSNDQNYMWDTNYHFIALSASYHYNDRDIIMNYETYSVIDKGNIG 469

Query: 423 IYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFLLES 482
           IY+D + F+AN KGS QLL Y  KQN+VGHEAL +A+R F LDP++ D  +L    LL  
Sbjct: 470 IYFDAIQFIANRKGSYQLLAYCGKQNIVGHEALEAAMRAFKLDPAAIDINKLDISLLLSM 529

Query: 483 YK-EVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXX 541
           YK E   +                  +K++  +KFYV+ EP+    QAY  L        
Sbjct: 530 YKHEQISNQNTSHLSDLKNALRVLAKFKDNRFVKFYVDHEPYKTVSQAYNELEVDESVDD 589

Query: 542 XXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQ 601
               TAYSIKV+D+PGLK++CIRALYT+A+ KRS+ LFN L ++CP+F  FY     SY+
Sbjct: 590 DIIQTAYSIKVNDSPGLKIECIRALYTIAINKRSMALFNYLIEECPEFQDFYGPEKYSYE 649

Query: 602 SALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLE 661
            AL  + VN NA+D++IL+IFQ+KW+ +PLV  +Q L+LK AL K+  E+NSKLI+HFL 
Sbjct: 650 QALAIIQVNENASDEMILQIFQKKWNDEPLVEYDQFLSLKAALLKLCIEKNSKLISHFLT 709

Query: 662 TGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXX 721
           TGL+D + LP  NWP G+NNIGNTCYLNSLLQYYF I+PLR YI +Y  T          
Sbjct: 710 TGLIDPSCLPVENWPIGLNNIGNTCYLNSLLQYYFAIAPLRNYICSYQSTTESFEATDTD 769

Query: 722 XXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSST 781
                 RRIGGR +  +EVERS+QF YQLR LF+ M+ S  R V+PT+EL YL+FSPS+ 
Sbjct: 770 AK--INRRIGGRQVCASEVERSIQFTYQLRDLFNGMIFSNSRCVSPTQELAYLAFSPSNI 827

Query: 782 EVEFEPVPPAVGTASNALVANEVYNEDTEVIDISMEECDEDSAINELG 829
           EVEF+      G AS +     +  +DT+     M   +ED  + E G
Sbjct: 828 EVEFD---AGSGIASESGGTFSLNGKDTDAPLTDM-PLNEDVTMTEAG 871

 Score =  402 bits (1033), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/443 (48%), Positives = 275/443 (62%), Gaps = 21/443 (4%)

Query: 958  PDDFSVRYQASSDTAN-TGSTRPNPSSTPESGLSDSAANAEYTSAGPLEDRQAVENDDSG 1016
            P +  V + A S  A+ +G T        ++ L+D   N + T     E +     DD+G
Sbjct: 824  PSNIEVEFDAGSGIASESGGTFSLNGKDTDAPLTDMPLNEDVTMTEAGEPQL----DDTG 879

Query: 1017 KDITMVGSPEAEGP-----------ETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLY 1065
                ++   EA+ P            +ST VAKI SDQLEN LE+GRQQDVTECIGNVLY
Sbjct: 880  ----LLAPVEADVPVDQMKLAKEVINSSTKVAKIGSDQLENALELGRQQDVTECIGNVLY 935

Query: 1066 QIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHP 1125
            Q+ESAS P+ LDE+ EQ+DL+K LFYGK +Q+++PL      R+K ERF+SLLVN+ DHP
Sbjct: 936  QLESASDPIKLDEDNEQYDLIKHLFYGKTRQDIVPLSNSTDVRSKYERFLSLLVNVSDHP 995

Query: 1126 KDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEP 1185
            KDIYDALDSYF ++ LTL E+ G VRR+VA+ E P +LQIQIQRVYYDRE+FMPFKS EP
Sbjct: 996  KDIYDALDSYFMEEYLTL-EEYGDVRRTVAITEFPTILQIQIQRVYYDRERFMPFKSIEP 1054

Query: 1186 LPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALAD 1245
            +PF   LYMDRY ATD+  +  K+++                   ++ND G++   A  +
Sbjct: 1055 IPFNSTLYMDRYAATDDPVMLTKRRETSELKTRLRECKVRQQELLSRNDMGLSRKEAYTE 1114

Query: 1246 TRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAF 1305
            T + L +  L        E   A  S                   I  ++  I H+FD+F
Sbjct: 1115 TMKMLQSDFLEQVPSVRGEDQTAVVSGLSDMVASIDEELVQLYTEIGQLETQIDHQFDSF 1174

Query: 1306 SSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTA 1365
               GYSL AVFIHRGEASYGHYWVY+KD +N GIWRKYNDE+V+EVPE EVF+F+E N A
Sbjct: 1175 QKVGYSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVFNFTEGNNA 1234

Query: 1366 TPYFLVYVKEAHELDIEPLKRLL 1388
            TPYFLV VK+ HE DIEPL R++
Sbjct: 1235 TPYFLVLVKQTHEQDIEPLHRII 1257

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/872 (40%), Positives = 524/872 (60%), Gaps = 60/872 (6%)

Query: 2   NQESREQIETEQNCELEQGDDGRTVLYGNLARQGPVKTSDRLLDDVRVTVS--LSEEGRE 59
           N+E   Q+  + N  + + DDG+ +LY + +     KT+DRLLDD+ + +S  L     E
Sbjct: 44  NEELANQLSQDSNI-IPEVDDGKHILYDSFSNHSFFKTADRLLDDLMIDLSYMLFNNSSE 102

Query: 60  -----------------------------------VLRAPMLEYARQRANARTWSVGYLL 84
                                              +LR P  +Y++ R +  T+++G ++
Sbjct: 103 HINDNNNNNDNNHNNNNNTSNSNNDTNEIKTYINGILRLPSHQYSKDRYSKFTFAMGTIV 162

Query: 85  DQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPGQRFASQDELVNYR-IYHLRVTVKIRPQ 142
           DQ+ LQT FE+ S TC + N VHV +GVL D      SQ  L  +  +YH ++TVK R  
Sbjct: 163 DQINLQTRFEFKSVTCPEFNDVHVLLGVLMDN----RSQAPLGTFLPVYHFKITVKTRSY 218

Query: 143 LERARQHYGVAQYHLVD--ELHPWDKPDFCL--FEDGDPAVVDSATYVASGTNRLVRIEV 198
           LE+ ++H G++ +HL+D  +LH +DK D  +   +    +++DSA +++  TN+LV +E+
Sbjct: 219 LEKTKKHVGISHFHLIDFDDLHEFDKKDLEITNHDINKKSLLDSAIFISEDTNKLVMLEI 278

Query: 199 LRPEFGP-DELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVFKNPLSRQK 257
            +PEF   +E++ F+ E I  RY+  C R P+LD   IP+Q ECLNT+FK+FK PL+ + 
Sbjct: 279 FKPEFNELEEIESFSQESIAERYINACSRFPNLDQQKIPTQLECLNTVFKIFKGPLNHKN 338

Query: 258 AQDELKTISADNKVLNSQLEANWLVTKFGF-ELCEIEEDGQKIY-EYKPPDFTEHVENWE 315
             + LK I+ADN +LNS    NWL+TK+GF E  +   D Q+ + EY PP+  +++ +  
Sbjct: 339 INEPLKAINADNPLLNSHWNPNWLLTKYGFIETLDNNPDTQEEFKEYLPPNLADYINDIN 398

Query: 316 VRRFRESYIRKSLELIFLGKQSLRLV-PKDVVVSNSKLRSFQLYQTHFSHSFWYHLMGEY 374
            R  RESYIRK LELIF+ K+++ L+ P D+  ++  +RSF + QT F+ SFW+  +  Y
Sbjct: 399 TRALRESYIRKCLELIFISKRNISLMGPNDLQYNSKAIRSFNILQTVFTTSFWHQFL--Y 456

Query: 375 DHNDFNQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDDLSFVANS 434
           +H       +  D  YH+++L +++YY++RDII+NY    ALDP N  IYYD L+++A S
Sbjct: 457 EHKPQLDTYNKLDYEYHYINLLTSFYYTERDIIRNYNCLTALDPVNIGIYYDALAYIAQS 516

Query: 435 KGSKQLLTYTYKQNVVGHEALMSALRLFHLDPS-STDPRQLSDEFLLESYKEVCKDSG-- 491
           K S QL+++  KQ+V+G EAL  AL LF++D + S+    L++  +   YK   K +   
Sbjct: 517 KNSYQLISFVSKQDVIGQEALNQALTLFNIDNNDSSAISTLTESMIFTIYKTERKQANIS 576

Query: 492 PQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXXXXXXXXTAYSIK 551
             +             YK SD+LKFY + EP+ +  Q Y  L            TAY+IK
Sbjct: 577 SARLAEMKNALRLLAKYKHSDRLKFYADYEPYFSASQGYNTLEVDESVDDDIIQTAYTIK 636

Query: 552 VSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVNV 611
           V+DAPGLK+DC RAL T+A  ++S+ LF  L Q+CP+F +FY +    Y  AL  L VN 
Sbjct: 637 VNDAPGLKIDCDRALLTVATRRKSLALFKFLLQECPQFTEFYGVDRFDYFQALNTLQVNE 696

Query: 612 NATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDINYLP 671
           NATD+ ILEIFQ++WS D  +  + +LNL+ AL+KI +E+NSKLI++F++TG+VD   LP
Sbjct: 697 NATDETILEIFQQRWSNDKSLDYDSMLNLQSALSKIAYEKNSKLISNFIDTGIVDPTCLP 756

Query: 672 AGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDM-GRRRI 730
             NWP G+NNIGNTCYLNSLLQYYF+I PLR++IL Y  T             +  RRRI
Sbjct: 757 VENWPAGLNNIGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIVLNKQLEKRRRI 816

Query: 731 GGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEFEPVPP 790
           GGR +++ EVERSVQF+YQ+R LF EM+ S+ R V+P +EL YL+F PS+ EVEFE    
Sbjct: 817 GGREVNELEVERSVQFIYQVRDLFKEMIFSQMRCVSPRQELAYLAFMPSNIEVEFESAST 876

Query: 791 A--VGTASNALVANEVYNEDTEVIDISMEECD 820
              +G  SNA  A  + +E     DI++ E +
Sbjct: 877 EDDMGDKSNAQDAVVLQDEAKNDTDINLTEVN 908

 Score =  381 bits (979), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/372 (52%), Positives = 247/372 (66%), Gaps = 23/372 (6%)

Query: 1028 EGPETSTYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLD-EEGEQFDLV 1086
            E    ST VAKISSDQLEN  E+GRQQDVTECIGNVL+Q+E+   P+SLD E+ EQ+DLV
Sbjct: 956  EDITISTRVAKISSDQLENAFEMGRQQDVTECIGNVLFQLETGFDPISLDNEDNEQYDLV 1015

Query: 1087 KQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDED 1146
            K+LFYGK KQ +IPL     +R K+ERF+SLLVNI DHPKDIYDAL+ YF D+ LT++E 
Sbjct: 1016 KELFYGKTKQSIIPLNHNSNERIKVERFLSLLVNITDHPKDIYDALNQYFADEFLTMEEY 1075

Query: 1147 DGKVRRSVAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELN 1206
             G V++++++ E P +LQIQIQRVYYDRE+FMPFKS EPLPF + +YMDRY  + + EL 
Sbjct: 1076 -GDVKKTLSMTEYPKILQIQIQRVYYDRERFMPFKSIEPLPFEQVIYMDRYAESSDPELI 1134

Query: 1207 AKKQQAIGXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGS------- 1259
            +KK++                   +KN+ G++   A+ +T +FL +  +           
Sbjct: 1135 SKKEETAQLKLKLKEYRARQKELLSKNELGLSRKEAMMETIKFLKSPVILENGIDTTNKD 1194

Query: 1260 ---RQLQEQYHATTSHXXXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVF 1316
               R+LQ+      +                   I  +Q+ I H+FD F    YSL AVF
Sbjct: 1195 VLVRELQQYVDGINNELSNLYN-----------KINQLQNRIDHQFDDFKKLAYSLFAVF 1243

Query: 1317 IHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEA 1376
            IHRGEASYGHYWVYIKD    GIWRKYNDESVTEVPE EVF+F+E NTATPYFLVYVK+ 
Sbjct: 1244 IHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATPYFLVYVKQD 1303

Query: 1377 HELDIEPLKRLL 1388
               DIEPLKR++
Sbjct: 1304 SLSDIEPLKRII 1315

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/787 (43%), Positives = 482/787 (61%), Gaps = 24/787 (3%)

Query: 21  DDGRTVLYGNLARQG-PVKTSDRLLDDVRVTVSLSEE-----GREVLRAPMLEYARQRAN 74
           D G T+LY +L     P+KTS+R++DD+   +S            +L+  M+ Y+++R N
Sbjct: 76  DPGNTLLYPDLGTANFPMKTSNRIIDDILCDLSFINGPNLSFKNGILQESMIMYSKERIN 135

Query: 75  ARTWSVGYLLDQVVLQTSFEYTSRTC-AQNRVHVFMGVLCDPGQRFASQDELVN-YRIYH 132
            + +  G ++DQV LQT +EY S TC A N++ V  G+L +      + DE+++   IYH
Sbjct: 136 NQAYLFGSMVDQVALQTKYEYNSLTCPANNKLEVQFGILMNLPSNITNVDEIISKVPIYH 195

Query: 133 LRVTVKIRPQLERARQHYGVAQYHLVD--ELHPWDKPDFCLFEDGDPAVVDSATYVASGT 190
           L++TVK R  LE +++  G+ QYHL+D  +LH +DK D   F+  +P ++D A YV+S T
Sbjct: 196 LKITVKTRQLLEVSKKQAGITQYHLLDFEDLHHFDKRDLMTFDPDNPDLLDYAIYVSSDT 255

Query: 191 NRLVRIEVLRPEFGPDELQE-FTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVF 249
           NRL+ IE+   EF   E +E F    I++RY E CK+   LDP  +P+  +CLNT+ K+ 
Sbjct: 256 NRLILIEIFSTEFDSREERESFQTATIKSRYQEACKKFDTLDPEAVPTGIDCLNTVLKLL 315

Query: 250 KNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGF--ELCEIEEDGQKIYEYKPPDF 307
           K PL+R+   D+++T+S++N +L+S     WL+ K+ F       E  GQ++ EY+PPD 
Sbjct: 316 KQPLTRKNNNDKIRTVSSNNPILHSHFNPEWLLEKYNFTKHYATDETTGQEVLEYEPPDL 375

Query: 308 TEHVENWEVRRFRESYIRKSLELIFLGK--QSLRLVPKDVVVSNSK-LRSFQLYQTHFSH 364
             +V+ ++VR  RE YIR+ L+LIF GK    LR+   D  +  SK  R+F L  T  S 
Sbjct: 376 ISYVQGYKVRSLREKYIRRCLQLIFWGKCLVQLRVDQSDPALRGSKSYRAFNLLNTTTST 435

Query: 365 SFWYHLMGEYDHNDF-----NQQMHPYDTNYHFVHLSSNYYYSDRDIIKNYEAQIALDPA 419
           +  Y L+ +   N       +      D N+HF++LS++ YY+DRDIIKNYE  IALDP 
Sbjct: 436 NPLYQLLNDSKSNFLASTRNDSDSMALDQNFHFINLSTSSYYTDRDIIKNYERLIALDPP 495

Query: 420 NASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSSTDPRQLSDEFL 479
           N   Y+D LS++AN KGS QL+ Y  KQ+VVG E +  AL+ F++DP+  +   + D  L
Sbjct: 496 NIGTYFDALSYIANRKGSYQLIAYCGKQDVVGQENINMALKCFNIDPNVVNLESIDDSLL 555

Query: 480 LESYKEVCKDSGPQKHXXXXXXXXXXXXYKESDKLKFYVEVEPFPNELQAYKLLXXXXXX 539
           L  YK      G                 + S +LKFYV+ EP+ N  QAY+ L      
Sbjct: 556 LSIYKNESVKEGAD-FVNLKNAMRLFAKIRNSPQLKFYVDHEPYRNVNQAYETLEIDSSV 614

Query: 540 XXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPKFHQFYHMSYLS 599
                 TAYSIK  DAPGLK+DC RALYT+A+ +RS+ILFN L + C +F  +Y++    
Sbjct: 615 DDDIIQTAYSIKTVDAPGLKIDCDRALYTIAIQRRSMILFNFLLENCSEFQAYYNIGRYD 674

Query: 600 YQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIGFERNSKLINHF 659
           Y+ AL  L VN NA D++IL+ FQ KW  + +   +Q LN K AL K+G ERNSKLIN+F
Sbjct: 675 YRQALGILQVNENANDEVILKNFQTKWFNEQIHEADQFLNYKCALMKLGLERNSKLINNF 734

Query: 660 LETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXX 719
           L  G++D + LP  NWPTGINNIGNTCYLNSLLQYYF+ISPLREY+L Y  T        
Sbjct: 735 LMNGVIDPSCLPVENWPTGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAK 794

Query: 720 XXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPS 779
                +  RRIGGR +   EVERS+QF+YQLR LF+ M+++ +R VTP REL YL+F+PS
Sbjct: 795 RNAKTI--RRIGGREVGDNEVERSIQFIYQLRDLFYAMIYTNKRCVTPRRELAYLAFAPS 852

Query: 780 STEVEFE 786
           + EVEFE
Sbjct: 853 NVEVEFE 859

 Score =  398 bits (1022), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 267/405 (65%), Gaps = 18/405 (4%)

Query: 996  AEYTSAGPLEDRQAVENDDSGKDITMVG-SPEAEGPET------STYVAKISSDQLENTL 1048
            AE T A P ED    ++D  G      G + E E  E       ST VAKISSDQLEN L
Sbjct: 894  AERTEASPTEDIYMTDDDMLGAAKATDGINKEDESTENGIDILPSTKVAKISSDQLENAL 953

Query: 1049 EIGRQQDVTECIGNVLYQIESASVPLSLD-EEGEQFDLVKQLFYGKLKQELIPLEFPDRK 1107
            E+GRQQDVTECIGNVLYQ+ES S PL ++ E+ EQ DLVKQLFYG++KQ++IPL      
Sbjct: 954  EMGRQQDVTECIGNVLYQLESGSEPLQINPEDNEQDDLVKQLFYGEIKQDIIPLSGVGET 1013

Query: 1108 RTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQI 1167
            R K+ERF+SLLVN+GDHP+DIYDALD YFKD+ LT+DE  G+V+R+VA+ + P +LQ+QI
Sbjct: 1014 RPKLERFLSLLVNVGDHPRDIYDALDMYFKDEFLTMDEY-GEVKRTVAITKFPTILQVQI 1072

Query: 1168 QRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXX 1227
            QRVYYDRE+FMPFKS EPLPF  K+YMDRY+ T + E+   +++                
Sbjct: 1073 QRVYYDRERFMPFKSIEPLPFSAKIYMDRYVDTADPEILETRERTAKMKAELVQLKKRQQ 1132

Query: 1228 XXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQ----EQYHATTSHXXXXXXXXXXX 1283
               ++N+ G++   A ++T  FL +  L     QLQ    E     ++            
Sbjct: 1133 ELLSRNEVGLSRKEAYSETVNFLQSNAL-----QLQGIVFEGQDELSTILKKAGTDIDDE 1187

Query: 1284 XXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKY 1343
                   I  +++ I+H+F+ F   GYSL AVFIHRGEASYGHYWVYIKD    GIWRKY
Sbjct: 1188 LSTIYNQITQLEETISHQFEQFKKVGYSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKY 1247

Query: 1344 NDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388
            NDE+V+EVP+ EVF+F+E NTATPYFLVYVKE  E DIEPLKR++
Sbjct: 1248 NDETVSEVPDEEVFNFTEGNTATPYFLVYVKEGSEKDIEPLKRII 1292

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/848 (39%), Positives = 500/848 (58%), Gaps = 43/848 (5%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTVSL--SEEGREVLRAPMLEYARQRANARTW 78
           DDGR +LY N+    P+KTSDRLLDD+  +V    S + + +L +  LEY++QR + +  
Sbjct: 39  DDGRQLLYPNIGTHLPLKTSDRLLDDILCSVGFLTSGDNKSILNSNTLEYSKQRPHIKGS 98

Query: 79  SVGYLLDQVVLQTSFEYTSRTCAQ-NRVHVFMGVLCDPGQRFASQ------DELVNYRIY 131
           +VG+  DQV++QT +EY S++C + N++ V MG+L   G  +  +       E+    IY
Sbjct: 99  AVGFFQDQVIIQTKYEYPSKSCPEHNKIFVIMGILI--GTDYLEKAEKKQISEVTEIPIY 156

Query: 132 HLRVTVKIRPQLERARQHYGVAQYHLVDELHPWDKPDFCLFEDGDPAVVDSATYVASGTN 191
           H++++VK+R  LE +++  GV++Y+ +D+LH +D+ DF  ++  D  ++DSA Y    TN
Sbjct: 157 HVKISVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSALYATDDTN 216

Query: 192 RLVRIEVLRPEFGP-DELQEFTGERIRARYLEVCKRHPDLDPSDIPSQAECLNTLFKVFK 250
           ++V IE+ +PEF P D+    +  +I+ R+ +  ++ P L   + P+Q + +NTLFK+FK
Sbjct: 217 KIVLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSINTLFKLFK 276

Query: 251 NPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCEIEEDGQKIYEYKPPDFTEH 310
            PL R+      K+I A++ +L S +  + LVT FGF        G    EY  PD   +
Sbjct: 277 GPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNENIPGG---EYMAPDLVNY 333

Query: 311 VENWEVRRFRESYIRKSLELIFLGKQSLRLVPKDVVVS---NSKLRSFQLYQTHFSHSFW 367
           + +  +++ R+++ RK LELI  G   +  +P+++  +   + K R  +  Q  FS   W
Sbjct: 334 LGDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYRILRTIQPEFSLFSW 393

Query: 368 YHLMGEY-----------DHNDFNQQ-------MHPYDTNYHFVHLSSNYYYSDRDIIKN 409
             L+G++           +H  ++ Q         P+D + +F +LS   +Y++RDII+N
Sbjct: 394 LQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLHYAERDIIQN 453

Query: 410 YEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVVGHEALMSALRLFHLDPSST 469
           YE  I LD  N  IY+D LS VAN KGS QLL+Y  KQ+V+G EAL ++L +F +D +  
Sbjct: 454 YERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLAVFGIDYTKV 513

Query: 470 DPRQLSDEFLLESYKEVCKDSGPQKHXX-XXXXXXXXXXYKESDKLKFYVEVEPFPNELQ 528
               L +  LL  YK   K++                  Y  SD LKFYV+ EP+    +
Sbjct: 514 TLESLDENLLLSVYKHEWKENPDNNRISDLKNALRLLAKYFTSDYLKFYVDYEPYRIIQK 573

Query: 529 AYKLLXXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILFNILFQQCPK 588
           AY LL            TAY+IK++DAPGLK+DC RALYT+A ++RS++LFN LF QCP+
Sbjct: 574 AYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLMLFNFLFDQCPE 633

Query: 589 FHQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLNLKIALTKIG 648
           F ++Y    L Y  + + L +N N T+  +L +FQ+KW    L  P+QLL  + ALTKI 
Sbjct: 634 FQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEEPDQLLKYRAALTKIA 693

Query: 649 FERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
            ERNS L+ +FLETG ++ N LPA NWPTGINNIGNTCYLNSLLQ+YF ISPLREYI+ Y
Sbjct: 694 LERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQY 753

Query: 709 DHTXXXXXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPT 768
             T             + +RRIGGR + + E+ERSVQF+YQLR L+++M+ S +R VTP 
Sbjct: 754 QKTIADLSSNPDSI--ISKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPK 811

Query: 769 RELVYLSFSPSSTEVEFEPV----PPAVGTASNALVANEVYNEDTEVIDISMEECDEDSA 824
           REL YL+F+PSS +VEFE      P +    SN+   ++      E ID +M+   E+  
Sbjct: 812 RELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMPSTGENIDHNMDIEQEERN 871

Query: 825 INELGASN 832
             E+ ++N
Sbjct: 872 NEEINSTN 879

 Score =  332 bits (850), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 194/399 (48%), Positives = 262/399 (65%), Gaps = 11/399 (2%)

Query: 995  NAEYTSAGPLEDRQAVENDDSGKDITMVGS-PEAEG----PETSTYVAKISSDQLENTLE 1049
            N E  S   +E    V N+    DI M+ +  E EG     +T+  VAKI  +QLEN LE
Sbjct: 872  NEEINSTNNIESNDLVSNN---HDIEMLDTDKENEGNMEIEDTAIKVAKIDPEQLENALE 928

Query: 1050 IGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLKQELIPLEFPDRKRT 1109
            +GRQQDVTECIGNVL+Q+ES+S P SL E+ EQ DL+K+LF+G+  Q + PL+     RT
Sbjct: 929  LGRQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRT 988

Query: 1110 KIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVAVAELPIMLQIQIQR 1169
            K+ERF+SLLVNI DHPKD+YDALD YFK++ LT+ E+ G+V+R +A+ + P +LQIQIQR
Sbjct: 989  KVERFVSLLVNIADHPKDVYDALDLYFKEEYLTM-EEYGEVKRELAIKKFPTILQIQIQR 1047

Query: 1170 VYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGXXXXXXXXXXXXXXX 1229
            VYYDRE+FMP+KS EPLPF   +Y+DRY  TD+ +L  K+++                  
Sbjct: 1048 VYYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKEL 1107

Query: 1230 XAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHXXXXXXXXXXXXXXXXX 1289
             ++N+ G++   A  +T  FL +  L + +  + +      +                  
Sbjct: 1108 LSRNELGLSRRDAYKETANFLRSEVLQNTNISISDP-DLLATKLEESASKVADELSDLYV 1166

Query: 1290 HIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVT 1349
             I ++++ I H+FD F+ +GY+L AVFIHRGEASYGHYWVYIKD  N  IWRKYNDE+VT
Sbjct: 1167 KITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHYWVYIKDFVN-SIWRKYNDETVT 1225

Query: 1350 EVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKRLL 1388
            EVPE EV +F+E NTATPYF+V+VK+ HE DIEPLKR++
Sbjct: 1226 EVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKRMI 1264

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score =  354 bits (908), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 245/787 (31%), Positives = 404/787 (51%), Gaps = 72/787 (9%)

Query: 57  GREVLRAPMLEYARQRANARTWSVGYLLDQV-VLQTSFEYTSRTCAQ-NRVHVFMGVLCD 114
            + +LR P  +Y++ R++   + +  L ++  ++   FEY S+T  Q N++  F  +L  
Sbjct: 136 NKGILRLPTTDYSKFRSSFSEYKIINLSNKNNLINYRFEYESKTNHQDNKILEFFSILHK 195

Query: 115 PGQ----------RFASQDELVNYRIYHLRVTVKIRPQLERARQHYGVAQYHLVDELHPW 164
           P            +F SQ+E      YHL+V++K R QLE +++H  +  ++++DE +  
Sbjct: 196 PKDASNLDYESMAKFWSQNEF-----YHLKVSIKTRNQLELSKKHTPIQHFYVIDEFNEE 250

Query: 165 DKPDFCLFEDGDPAVVDSATYVASGTNRLVRIEVLRPEFG-PDELQEFTGERIRARYLEV 223
           DK DF  F   +P ++D A +++S TN++V +E+ + EF   D+L      ++   Y + 
Sbjct: 251 DKLDFINFNPDNPNLLDYAIFISSNTNKVVLVEIFKSEFNLNDKLIILDDLQVLNNYEKY 310

Query: 224 CKRHPDLDPSDIPSQAECLNTLFKVF---KNPLSRQKAQDELKTISADNKVLNSQLEANW 280
              +  L    +P+Q + L  L   F   +N  +   ++DE+K    D+K +   L  +W
Sbjct: 311 KNSNHKLK---LPTQTDVLLVLMYCFNKQQNFDNIHSSEDEIKL--KDSKAIKISLNPSW 365

Query: 281 LVTKFGFELCEIEEDGQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRL 340
           L  +F  +    +ED   I+     +   ++   E RRF + + R  LEL  L K +   
Sbjct: 366 LTERFSLKF---QEDESLIFMNLRNNL--NLIKKEKRRF-DVFTRCLLELFVLIKSA--- 416

Query: 341 VPKDVVVSNSK----LRSFQLYQTHFSHSFWYHLMGEY----DHNDFNQQMHPYDTNYHF 392
            P+ +V  NSK    ++       + S SFW  ++GEY      N+FNQ    Y  +  F
Sbjct: 417 -PQKLVKCNSKDTNIIKVVDTISINSSLSFWSQILGEYKSILSQNNFNQ----YSKHAEF 471

Query: 393 VHLSSNYYYSDRDIIKNYEAQIALDPANASIYYDDLSFVANSKGS-KQLLTYTYKQNVVG 451
           ++LS    Y++ +I+KNYE    L+P    +Y+D L FV+      + L  Y  K  ++G
Sbjct: 472 INLSILPTYTESEIVKNYEILTILNPDKIGVYFDSLKFVSQCLTQYENLADYVNKNEIIG 531

Query: 452 HEALMSALRLFHLDPSSTDPRQLSDEFLLESYKEVCKDSG-PQKHXXXXXXXXXXXXYKE 510
           +E    +L++F +D    +    SD  L E Y    +D      H             K 
Sbjct: 532 NEEFNQSLKIFKMD--KLEFTNCSDSVLWEKYLTYYEDKNFDYNHAILRNSIKSLSIVKN 589

Query: 511 SDKLKFYVEVEPFPNELQAYKLLXXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLA 570
           S  LKF  + EP+ N   A+  L             +Y+ K++D    K    +AL T+A
Sbjct: 590 SPILKFLCKYEPYKNPDNAFVTLNIHESVDSDTIIVSYTTKINDMKDKKQHLDKALLTIA 649

Query: 571 VAKRSIILFNILFQQCPKFHQFYHMSYLSYQSALQYLHVN-VNATDDLILEIFQRKWSYD 629
           + ++ + LF+ L++ C  F   YH   + Y++ALQ +  + +N+ ++LIL  F+++W Y 
Sbjct: 650 IDRKDLSLFHTLYENCKDFVNLYHSMNIEYKTALQAIDSSELNSDNELILS-FKKRW-YR 707

Query: 630 PLVSPE-------QLLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNI 682
             V+ +        LL L+  +  I   RNS L+N+++E G+V+  +LP+ +WP G+NNI
Sbjct: 708 IDVNNDTFGDDTVNLLTLRKVMMVISSNRNSLLLNNYIEYGIVNPKFLPSKSWPVGLNNI 767

Query: 683 GNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDMGRRRIGGRAISQAEVER 742
           GNTCYLNSLLQYYF ISPLREY++ ++              ++ +RR+GGR +S AE  R
Sbjct: 768 GNTCYLNSLLQYYFAISPLREYLINFNDI----ELDGREMKNLEKRRVGGRNLSIAEFHR 823

Query: 743 SVQFVYQLRSLFHEMVHSRERYVTPTRELVYLSFSPSSTEVEFEPVPPAVGTASNALVAN 802
           S+QFVYQLR L+ EMVHS  R V+P  +L YL+F+PS T +EF           NA+  N
Sbjct: 824 SIQFVYQLRDLYGEMVHSSSRKVSPRLQLAYLAFAPSDTPIEFR------DGIQNAIGKN 877

Query: 803 EVYNEDT 809
           + Y++ T
Sbjct: 878 DYYSDKT 884

 Score =  312 bits (800), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 162/353 (45%), Positives = 215/353 (60%), Gaps = 47/353 (13%)

Query: 1034 TYVAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGK 1093
            T + KISS QLE TLE+G QQDVTECI NVL+QIE+AS P+S+DE+ EQ DLVKQLF+GK
Sbjct: 936  TLIPKISSSQLETTLEMGSQQDVTECIENVLFQIEAASNPISIDEDNEQVDLVKQLFFGK 995

Query: 1094 LKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRS 1153
             +Q++ P     +   K ERF+SLLV++ D P+DIYDALD+YFKD++  + E+ GKV++S
Sbjct: 996  TEQKIKPFNEVSKVHPKRERFLSLLVSVSDKPRDIYDALDTYFKDEVFDM-EEYGKVKKS 1054

Query: 1154 VAVAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAI 1213
            + ++  P +LQ+QIQRVYYD EK +PFK  EPL F E LY+DRY    + +L  KK +  
Sbjct: 1055 LTISSFPTILQVQIQRVYYDIEKGVPFKDLEPLRFSESLYLDRYANDIDEKLAEKKIEVA 1114

Query: 1214 GXXXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHX 1273
                              KND+                  E+ + S+++ +         
Sbjct: 1115 SLKKRLKGLITIKKELEKKNDN-----------------VEIRTISKEIND--------- 1148

Query: 1274 XXXXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKD 1333
                                V+  I   F  F  +GYSL AVFIHRG+A++GHYW+YIKD
Sbjct: 1149 --------------------VETKIDTAFSEFHKHGYSLFAVFIHRGQATFGHYWIYIKD 1188

Query: 1334 CQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIEPLKR 1386
             +N G WRKYND  VTE+   EVF+FSE N++TPYFLVY+K   E D+EPLKR
Sbjct: 1189 FKNHGTWRKYNDHEVTEILPIEVFNFSEGNSSTPYFLVYIKNGSEFDVEPLKR 1241

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score =  299 bits (765), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 219/807 (27%), Positives = 382/807 (47%), Gaps = 52/807 (6%)

Query: 21  DDGRTVLYGNLARQGPVKTSDRLLDDVRVTV---SLSEEGRE-------VLRAPMLEYAR 70
           DDG  +LY N+ ++G  KTS R+LDD+   +   SL  E  +       VL  P ++Y+ 
Sbjct: 69  DDGMHLLYQNIEKEGVFKTSQRILDDILTDIAFMSLDSEKSDDIDFKDGVLNLPTIKYSL 128

Query: 71  QRANARTWSVGYL-LDQVVLQTSFEYTSRTCAQNR-VHVFMGVLCDPGQR---FASQDEL 125
            R   + + +     +  V+    ++ S T  +N  +    G+L     R     + DE 
Sbjct: 129 WRKYIKPFKIILFNTNNPVVDVKLQHKSVTSPKNNTITELYGLLVPKIPRRSELNTFDEY 188

Query: 126 VNYR-IYHLRVTVKIRPQLERARQHYGVAQYHLVDE---LHPWDKPDFCLFEDGDPAVVD 181
           +  + +Y +R+TVK R +LE  ++H  +  Y L+D+   LH  DK DF  F      ++D
Sbjct: 189 IRSKPLYSIRITVKTRHRLEHKKKHIALTPYFLLDDFDKLHEVDKSDFPKFNKDSKDLLD 248

Query: 182 SATYVASGTNRLVRIEVLRPEFGPDELQEF-TGERIRARYLEVCKRHPDLDP-------- 232
            + Y++S TN+++ IE+ +P F   EL    +   +  R  E+   H +L P        
Sbjct: 249 FSIYISSDTNKIILIEIFKPAFNQTELDYLLSSASVLNRSNELDNLHEELQPDYNDAIVE 308

Query: 233 SDIPSQAECLNTLFKVFKNPLSRQKAQDELKTISADNKVLNSQLEANWLVTKFGFELCE- 291
             I +    L+ + +  K    R+  + +   + +D+  L + ++  WL   F  ++ E 
Sbjct: 309 EQIDTIEILLHCIMQNLKGSPERELEKQKTSFLLSDDVKLGTYVDIKWLEENFDIKVKEQ 368

Query: 292 -------IEEDGQKIYEYKPPDFTEHVENWEVRRFRESYIRKSLELIFLGKQSLRLVPKD 344
                  I  D      +  P+     +  ++ R+       ++EL++LGK        +
Sbjct: 369 KRKDHVSITLDEALKLSFDDPNPKNQAKFDKITRY-------AMELMYLGKVLQSFYSNE 421

Query: 345 VVVSNSKLRS-FQLYQTHFSHSFWYHLMGEYDHNDFNQQMHPYDTNYHFVHLSSNYYYSD 403
             +      + F+  + H + SFW  ++ EY     +Q+      + HF++L  +   S+
Sbjct: 422 EEIEEYMEDTIFKQVKVHHTTSFWTQILNEYQSIFSSQKTSTRCVDEHFINLCIDSNVSE 481

Query: 404 RDIIKNYEAQIALDPANASIYYDDLSFVANSKGSKQLLTYTYKQNVV-GHEALMSALRLF 462
           +DII NYE Q+  DP N S Y++ L +V+       +L    K+NV+    A + AL +F
Sbjct: 482 KDIITNYEIQLRTDPDNDSKYFESLKYVSRKFPDYIVLEKYCKENVIISKAAYLHALEIF 541

Query: 463 HLDPSSTDPRQLSDEFLLESYKEVCK---DSGPQKHXXXXXXXXXXXXYKESDKLKFYVE 519
                  +  +   E + + Y E+ +   ++  Q               K+S  L +  +
Sbjct: 542 KYSEEYFNAIEHVSE-IWDKYTELVQSNNNNDDQYRVDLVDSFYSLATVKKSSPLIYITK 600

Query: 520 VEPFPNELQAYKLLXXXXXXXXXXXXTAYSIKVSDAPGLKMDCIRALYTLAVAKRSIILF 579
            EPF + + AY  L             AY++++ + P  K+   RAL+ +A+ +  + L 
Sbjct: 601 YEPFFHPVTAYLKLNVDAKLDSENIVLAYTMQIREVPEHKIQFDRALFAIAIQRHDLSLL 660

Query: 580 NILFQQCPKFHQFYHMSYLSYQSALQYLHVNVNATDDLILEIFQRKWSYDPLVSPEQLLN 639
            +L Q C  F++      L+   A + + +   +++  I+  F + W      +P   + 
Sbjct: 661 YVLKQNCSAFNECISNIILTSDDAFEIIGMPKTSSELSIINTFTKYWKETDDSNPVNFIL 720

Query: 640 LKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTIS 699
              AL ++   R S L+ HF E G V+   + +  WPTGINNIGNTCYLNSLLQYYF+I+
Sbjct: 721 ASAALREVSKHRASALLRHFYEFGKVNPKMIDSELWPTGINNIGNTCYLNSLLQYYFSIT 780

Query: 700 PLREYILAYDHTXXXXXXXXXXXXDMGRRRIGGRAISQAEVERSVQFVYQLRSLFHEMVH 759
             RE+I  Y               +M +RR+GGR I   E+ RSVQF+YQ++ LF  MVH
Sbjct: 781 LFREFIENY---QSIESDLLNSNAEMSKRRVGGREIQNNEINRSVQFIYQVQDLFKLMVH 837

Query: 760 SRERYVTPTRELVYLSFSPSSTEVEFE 786
           ++ R VTP+ +L YL+F+P++ E++F+
Sbjct: 838 TKSRKVTPSNQLAYLAFAPNNAEIKFK 864

 Score =  193 bits (491), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 123/364 (33%), Positives = 181/364 (49%), Gaps = 72/364 (19%)

Query: 1036 VAKISSDQLENTLEIGRQQDVTECIGNVLYQIESASVPLSLDEEGEQFDLVKQLFYGKLK 1095
            VA ++ D LE TLEIG QQDVTECI  VLYQ+E+ S+PL LD + EQ DLVK+LFYG+  
Sbjct: 915  VAMVTRDDLETTLEIGNQQDVTECINTVLYQVETGSMPLYLDADNEQMDLVKELFYGETI 974

Query: 1096 QELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLTLDEDDGKVRRSVA 1155
            QE+ P++   +   K E + SLLVNI D P D+Y+ LD YF D+ +++ E+ G+V+++++
Sbjct: 975  QEICPIKKFIKGHEKRELYSSLLVNILDSPTDLYEVLDEYFADEYMSM-EEYGEVKKTLS 1033

Query: 1156 VAELPIMLQIQIQRVYYDREKFMPFKSTEPLPFGEKLYMDRYLATDNAELNAKKQQAIGX 1215
            + +LP +L IQIQRVYYD+EK +P+K    LPF  ++++DRY+  +  E           
Sbjct: 1034 ITKLPTILNIQIQRVYYDKEKLVPYKCGTALPFKNEIFLDRYIKGNKKE----------- 1082

Query: 1216 XXXXXXXXXXXXXXXAKNDHGVTLSAALADTRRFLDAAELTSGSRQLQEQYHATTSHXXX 1275
                             ND        L   R  L  A++    R+L  +Y++       
Sbjct: 1083 -----------------ND-------VLEKARLELKLAKV--KYRELVSEYNSVNK---- 1112

Query: 1276 XXXXXXXXXXXXXXHIASVQDAIAHRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQ 1335
                             S+ D I   +D        +        +  Y  + V+I   Q
Sbjct: 1113 -----------------SISDRIITTYDRIEELNAVIEEEVTKDAKIRYSLFAVFIHRGQ 1155

Query: 1336 N--GGIW-----------RKYNDESVTEVPESEVFDFSEENTATPYFLVYVKEAHELDIE 1382
               G  W           RKYND  VT   E E+F   + + +TPYFL YV  + +  ++
Sbjct: 1156 ASFGHYWVYIRDFENGIWRKYNDHQVTGAHEDEIFKCVDGDISTPYFLAYVDSSKKSIVK 1215

Query: 1383 PLKR 1386
            PL R
Sbjct: 1216 PLVR 1219

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 41/92 (44%), Gaps = 21/92 (22%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDMGRRRIGGRAI 735
           P GI N+GNTCY+N+ LQ  F I PLRE +L +D                       RAI
Sbjct: 101 PMGIANLGNTCYMNATLQGLFRIDPLREQVLEFDEK---------------------RAI 139

Query: 736 SQAEVERSVQFVYQLRSLFHEMVHSRERYVTP 767
            +       Q V +L+  F ++   +   +TP
Sbjct: 140 KEGVDTYHAQLVRELKVTFQKLKDRKGENITP 171

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 32/53 (60%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           N F+E    +     + + P G  N+GNTCYLNS LQ  + I PLRE IL+Y+
Sbjct: 88  NQFIEDLAPEEQLQRSSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSYN 140

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFS 1360
            Y L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++   S
Sbjct: 431  YELVGVITHQGANSESGHYQSFIRDDYDEDKWYKFNDDKVSVVDKEKIESLS 482

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 26/34 (76%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           P GI N+GNTCY+N+ LQ  + I PLRE ILA+D
Sbjct: 59  PMGIVNMGNTCYMNATLQGLYGIVPLREQILAFD 92

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  V  H+G  S  GHY  +++D  +   W K+ND+ VT + + ++
Sbjct: 377  YDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKI 424

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 25/36 (69%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHT 711
           P G+ N+GNTCYLN+ LQ  F I PLRE IL Y  +
Sbjct: 108 PIGLKNLGNTCYLNATLQCLFRIEPLREMILNYKQS 143

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  +  H+G  S  GHY  +I+D ++  IW K+ND+ VT V + ++
Sbjct: 434  YNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKI 481

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           N F+E     +      + P G+ N+GNTCY+N+ LQ  + I+PLRE IL +D
Sbjct: 84  NRFIEDLDPSVQMQKLSSTPIGLKNMGNTCYMNATLQALYQITPLREAILNFD 136

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ + + ++
Sbjct: 423  YDLIGVITHQGANSESGHYQAFIRDEMDENKWYKFNDDKVSVIEKEKI 470

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYDH 710
           + F+E    +  +  A + P G  N+GNTCYLN+ LQ  + I PLR+ IL Y+ 
Sbjct: 89  SQFIEDLAPEQQFQHANDLPIGFQNMGNTCYLNATLQALYRIEPLRDMILDYNQ 142

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  V  H+G  S  GHY  +I+D  +   W  +ND+ V+ VP+ ++
Sbjct: 425  YELIGVITHQGANSESGHYQSFIRDDMDEDKWYNFNDDKVSVVPKEKI 472

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%)

Query: 654 KLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           K  NHF+E    D       + P G+ N+GNTCY+N+ LQ  F +  +R+ IL YD
Sbjct: 84  KGTNHFIEDLTPDQQMQKFDSNPIGLQNMGNTCYMNATLQALFRVDSIRDLILNYD 139

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  +  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 424  YNLVGIITHQGANSESGHYQAFIRDETDENKWYKFNDDKVSVVEKEKI 471

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 42/99 (42%), Gaps = 27/99 (27%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAYDHTXXXXXXXXXXXXDMGRRRIGGRAI 735
           P G+ N+GNTCY N+ LQ  + I PLRE +LAY+                          
Sbjct: 105 PMGLRNMGNTCYFNASLQALYRIKPLREKVLAYN-------------------------- 138

Query: 736 SQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTRELVYL 774
            +   +   Q V QLR+ F+     +E+  TP   L  L
Sbjct: 139 -EPNPDLHGQLVIQLRNCFNAFAQRKEKEFTPIILLTVL 176

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +++D  +   W KYND+ V  V   +V
Sbjct: 415  YNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYNDDKVYVVTREKV 462

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 30/56 (53%)

Query: 654 KLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           K  +HF+E    D         P G  N+GNTCYLN+ LQ  F +  LRE IL YD
Sbjct: 85  KTASHFIEDLSPDQQVSRFNELPIGFKNMGNTCYLNATLQSLFRMDQLRELILNYD 140

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +  +W K+ND+ V+ V +  V
Sbjct: 430  YNLVGVITHQGANSDSGHYQAFIRDENDENVWYKFNDDKVSIVEKERV 477

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            +A  FD+  +  Y L  V IH G +  +GHY    K+ + G  W  ++DE+V  V E  V
Sbjct: 576  VASTFDSSIAKKYELTGVVIHMGGSPQHGHYVSLCKNDKFG--WLLFDDETVESVTEKTV 633

Query: 1357 FDFS--EENTATPYFLVYVKEAHELDIEPL 1384
             +F+    N AT Y L Y KE  E D +P+
Sbjct: 634  LEFTGDSSNQATAYVLFY-KELDEKDTKPV 662

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 670 LPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           LP G   N   G  N GNTCY NS+LQ  + ++ LR  +L Y
Sbjct: 127 LPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTELRLNLLEY 168

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 24/33 (72%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           P G+ N+GNTCY+NS LQ  + I PLRE IL +
Sbjct: 105 PVGLKNLGNTCYMNSTLQALYQIRPLREEILNF 137

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +   W ++ND+ V+ + + ++
Sbjct: 426  YNLIGVITHQGANSESGHYQSFIRDEADENKWYRFNDDKVSVIEKEKI 473

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           P G+ N+GNTCY+NS LQ  + I PLR+ +L Y
Sbjct: 59  PVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNY 91

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +   W ++ND+ V+ + + ++
Sbjct: 380  YNLIGVITHQGANSESGHYQSFIRDEVDENKWYRFNDDKVSIIEKEKI 427

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 41/78 (52%), Gaps = 5/78 (6%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            +A  FD+     Y L  V IH G +  +GHY    K+ + G  W  ++DE+V  V ES V
Sbjct: 680  VASTFDSSIEKAYELTGVVIHMGSSPQHGHYVSLCKNDKFG--WLLFDDETVESVSESTV 737

Query: 1357 FDFSEE--NTATPYFLVY 1372
             +F+ +  N AT Y L Y
Sbjct: 738  LEFTGDPNNQATAYVLFY 755

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 667 INYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY-DH 710
           I Y    N   G  N GNTCY NS+LQ  + +   R  +L Y DH
Sbjct: 162 IPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLYEFRLNMLEYSDH 206

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 1297 AIAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESE 1355
             ++  FD+  S  Y L +  IH G+   YGHY    K    G  W  ++DE+V  V E  
Sbjct: 546  TVSSTFDSKLSKRYELASAVIHLGDGPQYGHYISLCKTETFG--WLLFDDETVEAVDEQT 603

Query: 1356 VFDFSEENTATPYFLVYVKEAHELD 1380
            V  F+ EN+ T Y L Y  E  E D
Sbjct: 604  VLSFTGENSDTAYVLFY-NEVSEYD 627

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 6/53 (11%)

Query: 662 TGLVDI---NYLPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           T ++D+   N +P G   N   G  N GNTCY NS+LQ +F  S  R  +L++
Sbjct: 106 TAILDVKESNLMPYGDGSNKIFGYENFGNTCYCNSILQCFFNHSVFRTSMLSF 158

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 663 GLV--DINYLPAGNWPT---GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           GLV  +  +LP G+  T   G+ N GNTCY NS+LQ  F +S LR  IL Y
Sbjct: 114 GLVTRESEHLPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLSELRTNILMY 164

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            +  + D      Y L  + IH G    +GHY    K    G  W  Y+DE+V  + E  V
Sbjct: 625  VCTKSDTIVCKNYELNGIVIHMGGGPQHGHYVAICKHDMFG--WLLYDDETVESIDEETV 682

Query: 1357 FDF-SEENTATPYFLVYVKEA 1376
            F F  +E   T  ++++ KE 
Sbjct: 683  FKFVGDEKDMTTAYVLFFKEV 703

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           NHF+E    +       + P G  N+GNTCYLN+ LQ  + I  LR+ +L +D
Sbjct: 87  NHFIEDLTPEQQVQQFNDIPIGFKNMGNTCYLNATLQALYRIDDLRDAVLNFD 139

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  +  H+G  S  GHY  +I+D  +  IW K+ND+ V+ + + ++
Sbjct: 430  YDLVGIITHQGANSESGHYQAFIRDENDENIWYKFNDDKVSIIEKEKI 477

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           N+F+E    +         P G  N+GNTCYLN+ LQ  + ++ LRE IL Y+
Sbjct: 89  NNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLREMILNYN 141

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKI 477

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           P G+ N+GNTCYLN+ LQ  F    L++ IL YD
Sbjct: 108 PLGLQNMGNTCYLNATLQALFRADELKDLILQYD 141

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ + + ++
Sbjct: 426  YDLIGVITHQGANSESGHYQAFIRDESDENKWYKFNDDKVSPIEKEKI 473

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           NHF+E    D       + P G  N+GNTCY+N+ LQ  +    +R+ IL Y
Sbjct: 91  NHFIEDLSPDQQLQKMDSTPIGFQNMGNTCYMNATLQALYRTDDIRQMILDY 142

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  +  H+G  S  GHY  +++D  +   W K+ND+ VT V + ++
Sbjct: 433  YNLIGIITHQGANSESGHYQAFMRDENDENKWYKFNDDKVTVVEKEKI 480

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           N+F+E    +         P G  N+GNTCYLN+ LQ  + ++ LR+ IL Y+
Sbjct: 89  NNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNYN 141

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKI 477

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 659 FLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           F+E    D       + P G  N+GNTCY+NS LQ  F +  L++ IL Y
Sbjct: 91  FIEDLAPDQQMQKLNDLPIGFQNMGNTCYMNSTLQALFRVDVLKDMILNY 140

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  +  H+G  S  GHY  +I+D  +   W K+ND+ V+E  + ++
Sbjct: 436  YDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEKDKI 483

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 23/34 (67%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           P G  N+GNTCYLN+ LQ  + +  LR+ IL Y+
Sbjct: 108 PVGFKNMGNTCYLNATLQALYRVDDLRDMILNYN 141

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +   W K+ND+ V+ V + ++
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKI 477

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%)

Query: 669 YLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           Y    N   G  N GNTCY NS+LQ  + +SPLRE IL +
Sbjct: 132 YGDGSNKVFGYENFGNTCYCNSVLQCLYNLSPLRENILQF 171

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            ++  FD   S  Y L  V IH G    +GHY    K+ + G  W  Y+DE+V  V E  V
Sbjct: 592  VSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKNEKFG--WLLYDDETVESVSEETV 649

Query: 1357 FDFS-EENTATPYFLVYVKEAH 1377
              F+      T  ++++ KE H
Sbjct: 650  LKFTGHSGDQTTAYVLFYKEIH 671

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 659 FLETGLVDINYLPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
            L T + D+  +P G   N   G  N GNTCY NS+LQ  + I   R  +L Y
Sbjct: 117 ILFTSITDL--MPYGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 167

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            ++  FD+  S  Y L  V IH G    +GHY    K+ + G  W  Y+DE+V  + E  V
Sbjct: 581  VSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKNEKFG--WLLYDDETVESIREETV 638

Query: 1357 FDFSEE--NTATPYFLVYVKEAH 1377
              F+    +  T Y L Y KE H
Sbjct: 639  LKFTGHPGDQTTAYVLFY-KETH 660

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 659 FLETGLVDINYLPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
            L T + D+  +P G   N   G  N GNTCY NS+LQ  + IS  R  +L Y
Sbjct: 107 ILFTAMTDL--MPYGDGSNKVFGYENFGNTCYCNSVLQCLYNISEFRCNVLRY 157

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 676 PTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           P G+ N+GNTCY+NS LQ  + +  LR+ +L Y
Sbjct: 108 PIGLLNMGNTCYMNSTLQALYRVDGLRDMVLKY 140

 Score = 36.2 bits (82), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y L  V  H+G  S  GHY  +I+D ++   W K+ND+ V+ V   ++
Sbjct: 427  YDLIGVITHQGANSESGHYQSFIRDEKDENKWYKFNDDKVSVVEREKI 474

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           N+F+E    +         P G  N+GNTCYLN+ LQ  + +  +R+ IL Y+
Sbjct: 89  NNFIEDLAPEQQVQQFAQSPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYN 141

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 1310 YSLGAVFIHRGEAS-YGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            Y+L  V  H+G  S  GHY  +I+D  +   W K+ND+ VT V + ++
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDENKWYKFNDDKVTAVEKEKI 478

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 33/70 (47%)

Query: 637 LLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYF 696
           L NLKI       E   +  N+   +     N L       G+NN+GNTCY+NS LQ   
Sbjct: 302 LKNLKIETGDFVIEIKQEGKNYHWLSNYFHYNALTPSRGNIGLNNLGNTCYMNSALQCLV 361

Query: 697 TISPLREYIL 706
            I  LR+Y L
Sbjct: 362 HIPQLRDYFL 371

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
            (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DESVT V E+EV 
Sbjct: 687  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDESVTIVDEAEVL 731

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 5/68 (7%)

Query: 1292 ASVQDAIAHRFDA--FSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVT 1349
             ++   I  +FD+       YSL +V +H G  +YGHY  + K     G+W + +DE+V 
Sbjct: 702  GAIPQTIRKKFDSTPIGPLTYSLRSVIVHYGTHNYGHYIAFRK---YRGVWWRISDETVY 758

Query: 1350 EVPESEVF 1357
             V E+EV 
Sbjct: 759  IVDEAEVL 766

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 665 VDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705
           +D N L  G +  G+ N GNTC++NS+LQ   +   L +++
Sbjct: 116 MDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFL 156

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
            YMR304W
          Length = 1193

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 1307 SYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            S+ Y L  V +H G+ S GHY+  IK    G  W +++DE V +V   +VFD
Sbjct: 445  SHIYKLHGVLVHTGDISTGHYYTMIK-PDLGDQWYRFDDERVWKVDRKQVFD 495

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 237

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
            YMR304W
          Length = 1213

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 42/95 (44%), Gaps = 24/95 (25%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD----------- 1358
            Y L  V +H G+ S GHY+  IK       W +++DE V +V +++VFD           
Sbjct: 431  YKLHGVLVHAGDISTGHYYAMIKPSTEDQ-WYRFDDEKVWKVTKTQVFDENFGLDRIPDD 489

Query: 1359 ----FSEEN--------TATPYFLVYVKEAHELDI 1381
                 S E           + Y LVY++E  E D+
Sbjct: 490  EVRLMSREQYQNYLLARHTSAYMLVYIREDQEADL 524

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 221

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 1309 GYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
             Y+L  V +H G+ S GHY+  IK   +   W +++DE V  V + +VFD
Sbjct: 495  NYNLHGVLVHTGDISTGHYYAMIKPTTDDK-WYRFDDEKVWRVTKKQVFD 543

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLV 287

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           N L  G+  TG+ N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 355 NKLEPGSGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 1307 SYGYSLGAVFIHRGEASYGHYWVYIK-DCQNGGIWRKYNDESVTEVPESEVFD 1358
            S  Y+L  V +H G+ S GHY+  IK D Q+   W +++DE V +V + +VF+
Sbjct: 441  SCKYTLHGVLVHTGDISTGHYYAMIKPDLQDQ--WYRFDDEKVWKVTKKQVFE 491

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 235

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 65/131 (49%), Gaps = 15/131 (11%)

Query: 1053 QQDVTEC---IGNVLYQIESASVPLSLDEEGEQFD----LVKQLFYGKLKQELIPLEFPD 1105
            QQD  E    I N ++Q    S+P + + + E       +V  +F G L+  ++     +
Sbjct: 235  QQDAHEFWQFIINQIHQNYVLSLPSTKESDKENIKHCDCIVHTVFEGSLESSIVCPSCQN 294

Query: 1106 RKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLT-LDEDDGKVR------RSVAVAE 1158
              +T I+ FM L ++I D  K +Y+ LDS+ K +LL   +   G+        + + + +
Sbjct: 295  NSKTTIDPFMDLSLDIKD-KKKLYECLDSFHKKELLKDFNYHCGECNSTQDAIKQLGIHK 353

Query: 1159 LPIMLQIQIQR 1169
            LP +L +Q++R
Sbjct: 354  LPSVLVLQLKR 364

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L  +  H+G  + GHY  + K   +GG W K+ND  V+ + + EV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           NH   +     N L   +  TG+ N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 344 NHHWPSNYFAYNKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL 393

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
            Anc_2.307 YDL122W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L AV IH G  +YGHY  Y K       W + +DESV EV E EV 
Sbjct: 422  YDLKAVIIHYGTHNYGHYISYRKFMNQ---WWRISDESVIEVDEMEVL 466

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L  +  HRG  + GHY  + K   +GG W K+ND  VT + + EV 
Sbjct: 411  YELIGIVSHRGTVNEGHYIAFCKI--SGGQWFKFNDSVVTSIAQGEVL 456

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 1302 FDAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDF-- 1359
            FD+  S  Y L  V +H G   +  ++V +   +  G W  ++DE+V  V ES V DF  
Sbjct: 603  FDSSVSKSYRLQGVVVHMGNGPHHGHYVSLCHTELFG-WLLFDDETVESVDESYVLDFVG 661

Query: 1360 SEENTATPYFLVY 1372
            S E+  T Y L Y
Sbjct: 662  SHESPTTAYVLFY 674

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 670 LPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           LP G   N   G  N GNTCY NS+LQ  + +   R  +L Y
Sbjct: 151 LPFGDGSNKVFGYENFGNTCYCNSVLQCLYHLPEFRLRVLEY 192

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 5/78 (6%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            ++  FD   S  Y L  V IH G    +GHY    K+ + G  W  Y+DE+V  + E  V
Sbjct: 587  VSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKNEKFG--WLLYDDETVESIREETV 644

Query: 1357 FDFSEE--NTATPYFLVY 1372
              F+    +  T Y L Y
Sbjct: 645  LQFTGHPGDQTTAYVLFY 662

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 20/40 (50%)

Query: 669 YLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           Y    N   G  N GNTCY NS+LQ  + I   R  IL Y
Sbjct: 126 YGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNILQY 165

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y+L +V +H G  +YGHY  Y K     G+W + +DESV  V E+EV 
Sbjct: 689  YALRSVIVHYGTHNYGHYIAYRK---FRGVWWRISDESVYVVDEAEVL 733

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            Y+L  V +H GE S GHY+  IK    G  W +++D+ V  V + + FD
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKP-DVGDQWFRFDDDKVWRVTKEQAFD 486

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYI 705
           G+ N G TCYLNSLLQ YF     R+ +
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV 230

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREY 704
            G+NN+GNTCY+NS LQ    I P+R+Y
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDY 425

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
            (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 1309 GYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
             Y L  V +H G+ S GHY+  IK       W +++DE V +V + +VFD
Sbjct: 440  NYKLHGVLVHTGDISTGHYYAMIKPTLEDQ-WYRFDDEKVWKVDKKQVFD 488

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 232

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 658 HFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           H+L    +  N L      TG+ N+GNTCY+NS LQ    I  LR+Y L YD
Sbjct: 284 HWLSNYFI-YNTLQPSQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL-YD 333

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
            Anc_8.742 YMR223W
          Length = 483

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            Y L  +  HRG  + GHY  Y K     G+W ++ND  V +VP  ++           Y 
Sbjct: 423  YELTGIVTHRGTVNEGHYITYTKTAD--GVWYQFNDSVVMKVPLEQMLK------EQAYL 474

Query: 1370 LVYV 1373
            L+Y 
Sbjct: 475  LIYT 478

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%)

Query: 669 YLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           Y    N   G  N GNTCY NS+LQ  + +S LRE IL +
Sbjct: 132 YGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQF 171

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 9/66 (13%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            YSL ++ +H G   YGHY  Y +       W + +DESV +V E EVF      +A+  F
Sbjct: 428  YSLKSIVVHYGSHDYGHYISYRR---FEDQWWRISDESVLKVDEDEVF------SASGIF 478

Query: 1370 LVYVKE 1375
            +V+ ++
Sbjct: 479  IVFYEQ 484

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L  V +H G + S GHY V+ K  Q  G W  Y+DE + ++ E +V    E N    Y
Sbjct: 549  YQLTTVVVHEGRSLSSGHYIVHCK--QPDGTWATYDDEYINKITERDV--LKEPNA---Y 601

Query: 1369 FLVYVK 1374
            +L+Y +
Sbjct: 602  YLLYTR 607

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%)

Query: 669 YLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           Y    N   G  N GNTCY NS+LQ  + +S LRE IL +
Sbjct: 133 YGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSLRENILQF 172

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 40.4 bits (93), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 636 QLLNLKIALTKIGFERNSKLIN-HFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQY 694
           QL NL IA   +  E      N H+L    +  + +P+    TG+ N+GNTCY+NS LQ 
Sbjct: 280 QLKNLNIASGDLVIETEQHNKNYHWLSNYFIYNDLVPSLEI-TGLVNLGNTCYMNSALQC 338

Query: 695 YFTISPLREYIL 706
              I   REY L
Sbjct: 339 ITHIPVFREYFL 350

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 6/50 (12%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           NHF+       N L   +  TG+ N+GNTCY+NS LQ    +  LR+Y L
Sbjct: 347 NHFV------YNKLEPASGTTGLVNLGNTCYMNSALQCLVHLPQLRDYFL 390

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G+W  Y+DE + ++ + EV     E  A  Y
Sbjct: 673  YQLISVVVHEGRSLSSGHYVAHCK--QPDGLWATYDDEYINKISDKEVL---RETNA--Y 725

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 726  YLVYSR 731

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAYD 709
           N L   +  TG+ N+GNTCY+NS LQ    I  LR+Y L YD
Sbjct: 355 NKLEPASGTTGLVNLGNTCYMNSALQCLVHIPQLRDYFL-YD 395

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
            Anc_8.742
          Length = 493

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L ++  H+G  + GHY V +K   N G W K+ND  V+ + E E  
Sbjct: 433  YELTSIISHKGTVNEGHYIVVVK--VNDGQWFKFNDSMVSAITEEEAL 478

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 657 NHFLETGLVDINYLPAGNW-----------PTGINNIGNTCYLNSLLQYYFTISPLREYI 705
           N  +E   +D NY    N+             G++N+GNTCY+NS LQ    I  LR+Y 
Sbjct: 292 NFIIEVKQIDKNYHWVSNYFKYNDFHHAKGTMGLSNLGNTCYMNSALQCLVHIPQLRDYF 351

Query: 706 L 706
           L
Sbjct: 352 L 352

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 40.0 bits (92), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E ++    E N    Y
Sbjct: 639  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEKQLLK--EPNA---Y 691

Query: 1369 FLVYVK 1374
            FLVY +
Sbjct: 692  FLVYTR 697

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS+LQ  F  S  R+  L 
Sbjct: 588 TGLRNMGNTCYINSMLQCLFGCSQFRDLFLG 618

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
            uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
            Ubiquitin-specific protease that may play a role in
            ubiquitin precursor processing
          Length = 1190

 Score = 40.4 bits (93), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 1307 SYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            SY Y L  V +H G+ S GHY+  IK       W +++D+ V  V +++VF+
Sbjct: 440  SYIYDLHGVLVHTGDISTGHYYTMIKPSIEDQ-WYRFDDDKVWRVTKNQVFE 490

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLV 234

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIK-DCQNGGIWRKYNDESVTEVPESEVFD 1358
            Y+L  V +H G+ S GHY+  IK D ++   W +++DE V +V + +VF+
Sbjct: 438  YNLHGVLVHTGDISTGHYYAMIKPDLEDQ--WYRFDDEKVWKVTKKQVFE 485

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 229

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (51%), Gaps = 13/91 (14%)

Query: 611 VNATDDLILEIFQRKWSYDPLVSPEQLLNLKIA----LTKIGFERNSKLINHFLET-GLV 665
           V  +DD  +E    K+S+D        L+ K+A    LT++  E+N        ++ G  
Sbjct: 256 VKFSDDKTMESILTKFSFD--------LHNKLATEKTLTELQVEQNLNWDFKMTDSAGHE 307

Query: 666 DINYLPAGNWPTGINNIGNTCYLNSLLQYYF 696
            I   P GN+  G+ N+GN+CYLNS+LQ  F
Sbjct: 308 LIKLEPNGNFGCGLINLGNSCYLNSILQALF 338

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%)

Query: 636 QLLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYY 695
           QL +    +  +  E   K  N    +     N L A +   G++N+GNTCY+NS LQ  
Sbjct: 298 QLKDYDSQIISLVVEVKQKSSNQHWPSNFFHYNKLNAPSGIMGLSNLGNTCYMNSALQCL 357

Query: 696 FTISPLREYIL 706
             I  L EY L
Sbjct: 358 LHIPELNEYFL 368

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 39.7 bits (91), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            Y L A+  H G    GHY    +   NG IW K+ND  VT + E    D  +E     Y+
Sbjct: 409  YKLSAIISHHGTVHQGHYTTICRI--NGDIWAKFNDSMVTVISEE---DMLKEQAYLLYY 463

Query: 1370 LV 1371
            ++
Sbjct: 464  VI 465

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
            similar to uniprot|P25037 Saccharomyces cerevisiae
            YDL122W UBP1 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions irrespective of their size
            capable of cleaving polyubiquitin chains
          Length = 791

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K   + G W + +DE+V  V E+EV 
Sbjct: 708  YSLRSVIVHYGTHNYGHYIAFRK---HRGFWWRISDETVYIVDEAEVL 752

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 39.7 bits (91), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E +V   S       Y
Sbjct: 645  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKITERDVLRES-----NAY 697

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 698  YLVYTR 703

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 13/103 (12%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            ++  FD   S  Y LG + +H G    +GHY    K    G  W  ++DE+V  + E  V
Sbjct: 562  VSSTFDESVSKDYELGGLVVHIGIGPQHGHYISVCKTSDYG--WLLFDDETVECISEDTV 619

Query: 1357 FDF-SEENTA-TPYFLVY--------VKEAHELDIEPLKRLLA 1389
              F  + N+A T Y L Y        V+ +    +E +++LLA
Sbjct: 620  LSFVGDSNSAGTAYVLFYKEINSSRNVERSQNEHLENVEKLLA 662

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILA 707
           G+ N GNTCY NS+LQ  + ++  RE IL 
Sbjct: 132 GLENFGNTCYCNSILQCLYNMNEFRENILG 161

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 40.0 bits (92), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 28/100 (28%)

Query: 1307 SYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD-------- 1358
            S  Y+L  V +H G+ S GHY+  IK   +   W +++D+ V +V + +VF+        
Sbjct: 433  SMMYNLHGVLVHTGDISTGHYYAMIKPGLDDK-WYRFDDDKVWQVTKKQVFEQNFGFDRL 491

Query: 1359 -------FSEEN--------TATPYFLVYVKEAHELDIEP 1383
                    S+E           + Y LVY+KE    D+EP
Sbjct: 492  PEYELRSLSKEQYQNYLIARQTSAYMLVYIKE----DMEP 527

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 17/22 (77%), Gaps = 1/22 (4%)

Query: 677 TGINNIGNTCYLNSLLQ-YYFT 697
            G+ N G TCYLNSLLQ YYFT
Sbjct: 199 VGLKNQGATCYLNSLLQSYYFT 220

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 39.7 bits (91), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            I+  FD   S  Y L ++ +H GE+   GHY    K    G  W  Y+DE+V  V +  V
Sbjct: 575  ISSVFDDSISKKYELNSIVVHIGESPQLGHYVTLCKHKSYG--WLIYDDETVQAVSDELV 632

Query: 1357 FDF--SEENTATPYFLVY 1372
                 +E+ +AT Y L Y
Sbjct: 633  SRILNNEQRSATAYLLFY 650

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 18/36 (50%)

Query: 672 AGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILA 707
            G    G  N G TCY NS+LQ  F I   R+ I+ 
Sbjct: 101 VGERVFGFQNFGYTCYCNSILQALFNIGSFRDGIIG 136

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 39.7 bits (91), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           N L   +  TG+ N+GNTCY+NS LQ    I  LR+Y L
Sbjct: 284 NQLTPSSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL 322

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
            UBP15Ubiquitin-specific protease involved in protein
            deubiquitination; catalytic activity regulated by an
            N-terminal TRAF-like domain and and C-terminal sequences;
            physically interacts with anaphase-promoting
            complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 1308 YGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y Y+L  V +H G+ S GHY+  IK       W +++DE V  V + +VF
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVF 495

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 39.7 bits (91), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 24/97 (24%)

Query: 1308 YGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF---------- 1357
            Y Y+L  V +H G+ S GHY+  IK       W +++DE V  V + +VF          
Sbjct: 447  YIYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVFQENFGCDRLP 505

Query: 1358 -------------DFSEENTATPYFLVYVKEAHELDI 1381
                         ++  +   + Y LVY+++  E D+
Sbjct: 506  DEKVRTMTRDDYQNYIIQRHTSAYMLVYIRQEQEQDL 542

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
            (REAL)
          Length = 1231

 Score = 39.7 bits (91), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 1308 YGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y Y+L  V +H G+ S GHY+  IK       W +++DE V  V + +VF
Sbjct: 447  YVYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVF 495

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
            (REAL)
          Length = 1230

 Score = 39.7 bits (91), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 1303 DAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            D  + Y Y+L  V +H G+ S GHY+  IK       W +++DE V  V + +VF
Sbjct: 441  DNGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQ-WYRFDDERVWRVTKKQVF 494

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R+ +
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLV 233

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 39.7 bits (91), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query: 657 NHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           NHF    L+     P G   TG++N+GN+CY+NS LQ    I  L++Y L
Sbjct: 320 NHFYYNKLLP----PRGT--TGLSNLGNSCYMNSALQCLVHIPELKDYFL 363

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
            YDL122W
          Length = 764

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 624  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVGIVTEAEVL 668

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILAYDH 710
           TG+ N+GNTCY+NS+LQ  F  +  R   L++ +
Sbjct: 753 TGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKY 786

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 1085 LVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLLT-L 1143
            +V  +F G L+  ++     +  +T I+ FM L ++I D  K +Y+ LDS+ K +LL   
Sbjct: 274  IVHTVFEGSLESSIVCPGCQNNSKTTIDPFMDLSLDIKDKQK-LYECLDSFHKKELLKDF 332

Query: 1144 DEDDGKVR------RSVAVAELPIMLQIQIQR 1169
            +   G+        + + +  LP +L +Q++R
Sbjct: 333  NYHCGECNSTQDAIKQLGIHRLPSVLVLQLKR 364

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L  +  H+G  + GHY  + K   +GG W K+ND  V+ + + EV 
Sbjct: 413  YELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 458

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E +V    E N    Y
Sbjct: 657  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGNWATYDDEYINKISERDV--LKEPNA---Y 709

Query: 1369 FLVYVKEAHELDIEPLKR 1386
            +L+Y +   +L   PL +
Sbjct: 710  YLLYTRLTPKLISLPLAK 727

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score = 39.3 bits (90), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS+LQ  F     R+  L+
Sbjct: 556 TGLRNMGNTCYINSMLQCLFATRKFRDLFLS 586

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 643 ALTKIGFERNSKLINHFLETGLVDINYLPAGN-WPTGINNIGNTCYLNSLLQYYF 696
            L ++  E+N       +++   ++ +LPA   +  G+NN+GN+CY+NS+LQ  F
Sbjct: 278 TLVELQVEQNMNWDFQMVDSKGNELKHLPASKEYGCGLNNLGNSCYMNSVLQVLF 332

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
            (REAL)
          Length = 790

 Score = 39.3 bits (90), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 682  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 726

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 665 VDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705
           +D   L  G +  G+ N GNTC++NS+LQ   +   L E++
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSKELMEFL 129

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
            YDL122W
          Length = 782

 Score = 39.3 bits (90), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1306 SSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            S   YSL +V +H G  +YGHY  + +     G W + +DESV  V E+EV 
Sbjct: 670  SPLTYSLRSVIVHYGTHNYGHYIAFRR---YRGCWWRISDESVYIVEEAEVL 718

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 651 RNSKLINHFLET-GLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705
           RN+  +N FL +   +D   L  G    G+ N GNTC++NS+LQ   +   L E++
Sbjct: 59  RNNSTLNRFLPSYNSMDDTILKRGGHIAGLVNDGNTCFMNSVLQSLASSRTLVEFL 114

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
            (REAL)
          Length = 787

 Score = 39.3 bits (90), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 683  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 727

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 39.3 bits (90), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 669 YLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           Y    N   G  N GNTCY NS+LQ  + +S +RE IL +
Sbjct: 133 YGDGSNKVFGYENFGNTCYCNSVLQCLYNLSSVRENILQF 172

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa] {ON}
            YMR304W (UBP15) - putative deubiquitinating enzyme
            [contig 363] FULL
          Length = 1191

 Score = 39.3 bits (90), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD--FSEENTATP 1367
            Y+L  V +H G+ S GHY+  IK       W +++D+ V +V +++ FD  F  +N    
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNVTDQ-WFRFDDDKVWKVTKTQAFDENFGHDNLPDE 497

Query: 1368 YFLVYVKEAHE 1378
                + +E ++
Sbjct: 498  KLRTFTREQYQ 508

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYI 705
           G  N G TCYLNSLLQ YF     R+ +
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV 230

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 39.3 bits (90), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E +V    E N    Y
Sbjct: 669  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKISERDV--LKEPNA---Y 721

Query: 1369 FLVYVKEAHELDIEPLKR 1386
            +L+Y +   ++   PL +
Sbjct: 722  YLLYTRLTPKVIPLPLAK 739

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 39.3 bits (90), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS+LQ  F  +  R+  ++
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATTKFRDLFVS 638

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
            (REAL)
          Length = 793

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 685  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 729

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 39.3 bits (90), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 18/93 (19%)

Query: 632 VSPEQLLNL--KIALTKIGFERNSKLINHFLETGLVDI----------------NYLPAG 673
           ++P Q +    KI LT+  FE   K  +  LE  ++++                NYL   
Sbjct: 351 INPRQFIEFGSKIRLTREHFETILKDCDFPLEDFVIEVKPKGKQHHWLSNYFKYNYLVPS 410

Query: 674 NWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
               G+ N+GNTCY+NS LQ    +    EY L
Sbjct: 411 TGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFL 443

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
            UBP1Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; cleaves at the C terminus of
            ubiquitin fusions irrespective of their size; capable of
            cleaving polyubiquitin chains
          Length = 809

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 681  YSLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVDEAEVL 725

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 665 VDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705
           +D   L  G +  G+ N GNTC++NS+LQ   +   L E++
Sbjct: 89  LDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFL 129

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E  V           Y
Sbjct: 638  YQLISVVVHEGRSLSSGHYIAHCK--QPDGTWATYDDEYINKITERNVL-----KEVNAY 690

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 691  YLVYTR 696

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
            YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
            FULL
          Length = 757

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y+L +V +H G  +YGHY  + K     G+W + +DE+V  V E+EV 
Sbjct: 678  YALRSVIVHYGSHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL 722

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P50101 Saccharomyces cerevisiae YMR304w UBP15
          Length = 1196

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            Y+L  V +H G+ S GHY+  IK       W +++DE V +V +++VF+
Sbjct: 439  YNLHGVLVHAGDISTGHYYTLIKPGLEDQ-WYRFDDERVWKVTKNQVFE 486

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 758

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y+L +V +H G  +YGHY  + K     G+W + +DE+V  V E+EV 
Sbjct: 679  YALRSVIVHYGTHNYGHYIAFRK---FRGLWWRISDETVYVVDEAEVL 723

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 677  TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
            TG+ N+ NTCY+NS+LQ  F+ S  R   L+
Sbjct: 1105 TGLRNMSNTCYINSMLQCLFSTSAFRNLFLS 1135

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] {ON}
            Anc_2.307 YDL122W
          Length = 770

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 644  YSLRSVIVHYGTHNYGHYIAFRK---FRGCWWRISDETVYIVDEAEVL 688

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%)

Query: 631 LVSPEQLLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNS 690
           L++  Q +  K++     F+ N+         G +D   L  G +  G+ N GNTC++NS
Sbjct: 45  LLTNLQFIKYKMSDLTNKFKNNNMFRRWIPRAGNIDDKILKKGGFVGGLVNDGNTCFMNS 104

Query: 691 LLQ 693
           +LQ
Sbjct: 105 VLQ 107

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E +V    +E  A  Y
Sbjct: 644  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISERDVL---KETNA--Y 696

Query: 1369 FLVYVK 1374
            +L+Y +
Sbjct: 697  YLLYTR 702

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L  +  H+G  + GHY  + K   +GG W K+ND  V+ + + EV 
Sbjct: 411  YELIGIVSHKGTVNEGHYIAFCK--ISGGQWFKFNDSMVSSISQEEVL 456

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E EV    E N    Y
Sbjct: 662  YELLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEREV--LKERNA---Y 714

Query: 1369 FLVYVK 1374
            +++Y +
Sbjct: 715  YVLYTR 720

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 9/81 (11%)

Query: 1303 DAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSE 1361
            D+     Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E E+    E
Sbjct: 748  DSILPVKYQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKISEREM--LKE 803

Query: 1362 ENTATPYFLVYVK-EAHELDI 1381
             N    Y+L+Y +   HE+ +
Sbjct: 804  PN---AYYLLYTRLTPHEVSL 821

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] {ON}
            Anc_2.307 YDL122W
          Length = 678

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + K     G W + +DE+V  V E+EV 
Sbjct: 577  YSLRSVIVHYGTHNYGHYIAFRK---YRGYWWRISDETVYIVDETEVL 621

 Score = 36.2 bits (82), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%)

Query: 637 LLNLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQ 693
           +L L    TK  +  N+          + D  ++  G +  G+ N GNTC++NS+LQ
Sbjct: 18  ILKLSYPFTKRMYNNNNFFSRKMYNNAINDKKFIKRGGYIAGLVNDGNTCFMNSVLQ 74

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 670 LPAGNWPT---GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           LP G+  T   G  N GNTCY NS+LQ  + ++  R  IL Y
Sbjct: 105 LPFGSGSTKVFGYENFGNTCYCNSVLQCLYNLTEFRTEILKY 146

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            Y L  V +H G+ S GHY+  IK       W +++DE V +V + + FD
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLEDQ-WYRFDDERVWKVSKKQAFD 487

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV 231

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score = 38.5 bits (88), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA--YDH 710
           TG+ NIG TCY+NS+LQ  F     R+  L+  Y+H
Sbjct: 556 TGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEH 591

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           G  N GNTCY NS+LQ  F ++  R  IL +
Sbjct: 115 GYENFGNTCYCNSILQCLFNLTEFRNSILQF 145

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 46/87 (52%), Gaps = 4/87 (4%)

Query: 1298 IAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEV 1356
            +A +FD   S  Y L  V +H G    +GHY V +    N G W  ++DE+V  + E +V
Sbjct: 583  VASKFDPSVSKKYELTGVVLHMGGGPQHGHY-VSVCKTDNFG-WLFFDDETVETLDEPQV 640

Query: 1357 FDFSEENTATPY-FLVYVKEAHELDIE 1382
             +F+ + T +   ++++ KE  E D E
Sbjct: 641  LNFTGDTTTSTTAYVLFYKETDEGDDE 667

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2.307
            YDL122W
          Length = 824

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            Y L +V +H G  +YGHY  + K     G W + +DE+V  V E+EV      +T + + 
Sbjct: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSVFM 723

Query: 1370 LVY 1372
            L Y
Sbjct: 724  LFY 726

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 666 DINYLPAGNWPT---GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           D   LP G+      G+ N GNTCY NS+LQ  + +  LR  +L Y
Sbjct: 85  DRRLLPFGDGTPKVFGLENYGNTCYCNSVLQCLYNLKELRVNVLKY 130

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL122W
            (UBP1)
          Length = 775

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 1306 SSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            S   YSL +V +H G  +YGHY  + K     G+W + +DE+   V E+EV 
Sbjct: 670  SPLTYSLRSVIVHYGTHNYGHYIAFRK---FRGVWWRISDETAYIVDEAEVL 718

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L  V +H G + S GHY V+ K  Q  G W  Y+DE +  + E +V    E N    Y
Sbjct: 587  YQLITVVVHEGRSLSSGHYIVHCK--QPEGHWATYDDEYINNINEKDV--LREPNA---Y 639

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 640  YLVYTR 645

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 664 LVDINYLP-AGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           L++I  L  + N   G  N GNTCY NS+LQ  + I  LR+ ++ Y
Sbjct: 98  LLEITKLSDSSNKVFGYENFGNTCYCNSVLQCLYNIPELRDNVIKY 143

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS+LQ  F     R+  L 
Sbjct: 608 TGLRNLGNTCYINSMLQCLFATRRFRDLFLT 638

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYIL 706
            G++N+GN+CY+NS LQ    I  LR+Y L
Sbjct: 298 VGLSNLGNSCYMNSALQCLVHIPELRDYFL 327

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           G  N GNTCY NS+LQ  +  S LR+ ++ Y
Sbjct: 128 GFENFGNTCYCNSVLQCLYNFSELRDNLILY 158

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 8/88 (9%)

Query: 1089 LFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLL-TLDEDD 1147
            +F G+LK  ++  E  +  +T I+ FM L ++I D   D+Y  LDS+ K + L   +   
Sbjct: 279  IFQGELKSSIVCPECQNDSKTIIDPFMDLSLDIKD-KTDLYQCLDSFHKKEKLHDFNYHC 337

Query: 1148 GKVRRSV------AVAELPIMLQIQIQR 1169
             +   S+       + +LP ML +Q++R
Sbjct: 338  SRCNTSLDPIKQFTINKLPPMLVLQLKR 365

 Score = 35.8 bits (81), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L  +  H G  + GHY V +K   N G W K+ND  ++ + E E  
Sbjct: 406  YELTGILSHIGSINEGHYVVVLK--INDGRWFKFNDSMISVIKEDEAL 451

>Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {ON}
           YER098W (UBP9) - ubiquitin carboxyl-terminal hydrolase
           [contig 33] FULL
          Length = 711

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 670 LPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           LP G   N   G  N GNTCY NS+LQ  + +  LR ++L Y
Sbjct: 133 LPYGDGSNKVFGYENFGNTCYCNSVLQVLYNLPELRVHLLEY 174

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 1303 DAFSSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            D+ ++  Y+L  V +H G+ S GHY+  IK       W +++D+ V  V + +VF+
Sbjct: 420  DSPANAKYNLHGVLVHTGDISTGHYYAMIKPGLEDA-WYRFDDDKVWRVTKKQVFE 474

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 17/22 (77%), Gaps = 1/22 (4%)

Query: 677 TGINNIGNTCYLNSLLQ-YYFT 697
            G+ N G TCYLNSLLQ YYFT
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFT 211

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
            bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 4/54 (7%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEEN 1363
            Y L  V +H G+ S GHY+  I+   +G  W +++D+ V +  + +VF   EEN
Sbjct: 431  YILHGVLVHSGDISTGHYYAMIQPDAHGS-WYRFDDDRVIKATDKQVF---EEN 480

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILA 707
           GI N+GNTCY+NS+LQ  F  +  R+  L 
Sbjct: 214 GIRNMGNTCYMNSMLQCLFGSTQFRDLFLT 243

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           N +   N   G+ N+GNTCY+NS LQ    I   ++Y L
Sbjct: 340 NQMTPSNGTVGLGNLGNTCYMNSALQCLVHIPEFKDYFL 378

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY++S+LQ  F  + LR+  + 
Sbjct: 625 TGLRNLGNTCYISSMLQCLFATTTLRDLFIT 655

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 20/94 (21%)

Query: 632 VSPEQLLNLKIALTKIGFERNSKLINHFLETGL-VDINYLP---AGNWPT---------- 677
           ++P Q L+   A+TKI  +   K +  F  T     I   P   + +WP+          
Sbjct: 267 LNPIQFLSFN-AITKITTQLMDKQMKEFTPTSFDFVIETKPKQKSSHWPSNFLIYNNLQS 325

Query: 678 -----GINNIGNTCYLNSLLQYYFTISPLREYIL 706
                G+ N+GNTCY+NS LQ    I   R+Y L
Sbjct: 326 SPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFL 359

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + +  Q  G W  Y+DE + ++  SE+   +E N    Y
Sbjct: 761  YQLLSVVVHEGRSLSSGHYIAHCR--QPDGTWATYDDELINKI--SELKLLTEPNA---Y 813

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 814  YLVYTR 819

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 5/62 (8%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            + L A+  H+G    GHY    +   NG +W K+ND  VT + E    D  +E     Y+
Sbjct: 412  FKLSAIIPHQGTVDKGHYTTICRI--NGDVWAKFNDSMVTLISEE---DMLKEQAYLLYY 466

Query: 1370 LV 1371
            ++
Sbjct: 467  VI 468

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E ++           Y
Sbjct: 395  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWSTYDDEYINKISEKQML-----KEPGAY 447

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 448  YLVYTR 453

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           +G+ N+GNTCY+NS+LQ  F  +  R   L+
Sbjct: 446 SGLRNLGNTCYINSMLQCLFATTAFRNLFLS 476

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
            YDL122W
          Length = 747

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFS 1360
            Y L +V +H G  +YGHY  + K     G W + +DE+V  V E+EV   S
Sbjct: 658  YVLRSVIVHYGTHNYGHYIAFRK---YRGCWWRISDETVYVVEEAEVLSTS 705

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 663 GLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYI 705
           G VD + L  G +  G+ N GNTC++NS++Q   + + L +++
Sbjct: 78  GQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL 120

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + +  Q  G W  Y+DE + ++ E  V        A  Y
Sbjct: 691  YELLSVVVHEGRSLSSGHYIAHCR--QPDGSWATYDDEYINKISELNVL-----KEANAY 743

Query: 1369 FLVYVK 1374
            +L+Y +
Sbjct: 744  YLLYTR 749

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 668 NYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYIL 706
           N L +     G++N+GNTCY+NS LQ    I   ++Y L
Sbjct: 337 NQLLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFL 375

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score = 37.4 bits (85), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS++Q  F     R   ++
Sbjct: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFIS 721

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 15/58 (25%)

Query: 664 LVDINYLPAGNWPT---------------GINNIGNTCYLNSLLQYYFTISPLREYIL 706
           +++   L  G WP+               G++N+GNTCY+NS LQ    I  LR+Y  
Sbjct: 261 IIETRNLNDGKWPSYFFMYNNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFF 318

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%)

Query: 639 NLKIALTKIGFERNSKLINHFLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTI 698
           NL      +  E      +H   +     N L   +   G+ N+G+TC++NS+LQ    I
Sbjct: 313 NLHFTAADLAVEVKEPGKSHHWTSHYFVYNRLSPSSGTMGLANLGSTCHINSVLQCLTHI 372

Query: 699 SPLREYIL 706
           + LR+Y L
Sbjct: 373 TELRDYFL 380

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            Y L  V +H G+ S GHY+  IK       W +++D+ V    + ++FD
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKPSTKDE-WYRFDDDRVWRATKKQIFD 487

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 16/22 (72%), Gaps = 1/22 (4%)

Query: 677 TGINNIGNTCYLNSLLQ-YYFT 697
            G  N G TCYLNSLLQ YYFT
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFT 224

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score = 37.4 bits (85), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+G+TCY+NS+LQ  F     R+  L+
Sbjct: 613 TGLRNLGSTCYINSMLQCLFATRKFRDIFLS 643

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS+LQ  F     R+  ++
Sbjct: 678 TGLRNLGNTCYINSMLQCLFATRLFRDLFIS 708

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
            YMR223W
          Length = 440

 Score = 36.6 bits (83), Expect = 0.42,   Method: Composition-based stats.
 Identities = 23/59 (38%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 1300 HRFDAFSSYGYSLGAVFIHRGEASYGHYWVYIK-DCQNGGIWRKYNDESVTEVPESEVF 1357
            H  +  SS  Y L  V  H G  + GHY   +K D  N   W K+ND  VT + E EV 
Sbjct: 370  HTEENNSSIIYELNGVISHIGTVNEGHYIATLKLDSNN---WFKFNDSMVTSISEEEVL 425

 Score = 34.3 bits (77), Expect = 2.6,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 10/93 (10%)

Query: 1085 LVKQLFYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLL--- 1141
            L+  +F GKLK  ++  E  D  +T  + ++ L ++I D    +Y  LDS+ K + L   
Sbjct: 251  LIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIKDKAT-LYQCLDSFHKKETLHDY 309

Query: 1142 -----TLDEDDGKVRRSVAVAELPIMLQIQIQR 1169
                   D     +++ + + +LP +L +Q++R
Sbjct: 310  NYHCPNCDTMQDPIKQ-LTIDKLPPVLVLQLKR 341

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+ NTCY+NS+LQ  F+ +  R   L+
Sbjct: 746 TGLRNMSNTCYINSMLQCLFSTTEFRNLFLS 776

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 37.0 bits (84), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE + ++ E ++           Y
Sbjct: 627  YQLISVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINKITEKQML-----KEPGAY 679

Query: 1369 FLVYVK 1374
            +L+Y +
Sbjct: 680  YLIYTR 685

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 745

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            YSL +V +H G  +YGHY  + +     G W + +DE+V  V E+EV 
Sbjct: 654  YSLRSVVVHYGTHNYGHYIAFRR---YRGYWWRISDETVYIVDETEVL 698

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 47/88 (53%), Gaps = 10/88 (11%)

Query: 1090 FYGKLKQELIPLEFPDRKRTKIERFMSLLVNIGDHPKDIYDALDSYFKDDLL-------- 1141
            F G LK  ++  +  +  +T I+ FM L ++I D   ++Y+ LDS+ K + L        
Sbjct: 276  FQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIKD-KSNLYNCLDSFHKKERLHDFNYHCP 334

Query: 1142 TLDEDDGKVRRSVAVAELPIMLQIQIQR 1169
              +     ++R +++ +LP +L +Q++R
Sbjct: 335  NCNTSQDAIKR-LSIYKLPSVLVLQLKR 361

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGI-WRKYNDESVTEVPESEVFDF-SEENTAT 1366
            Y L  + +H G    +GHY   +  C+N    W  ++DE+V  V E  V DF  + +T T
Sbjct: 658  YELSGIVVHMGGGPQHGHY---VSLCKNDNFGWLLFDDETVESVSEKTVLDFVGDSSTLT 714

Query: 1367 PYFLVYVKE 1375
              ++++ +E
Sbjct: 715  TAYVLFYRE 723

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 659 FLETGLVDINYLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
              T   ++ Y    N   G  N GNTCY NS+LQ  + ++  R  +L +
Sbjct: 113 LFTTSTENMPYGDGSNKVFGFENFGNTCYCNSVLQCLYNMTEFRIQMLQH 162

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
           Anc_7.390 YBL067C
          Length = 1171

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           G  N GNTCY NS+LQ  + ++ LR  IL +
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNILQF 547

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 20/40 (50%)

Query: 669 YLPAGNWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           Y    N   G  N GNTCY NS+LQ  + I   R  +L Y
Sbjct: 126 YGDGSNKVFGYENFGNTCYCNSVLQCLYNIPEFRCNVLRY 165

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score = 36.6 bits (83), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS++Q  F     R   ++
Sbjct: 609 TGLRNLGNTCYINSMIQCLFAAKTFRTLFIS 639

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 36.6 bits (83), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+N +LQ  F  + L+   ++
Sbjct: 648 TGLRNLGNTCYINCMLQSLFATNELKNLFIS 678

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 5/52 (9%)

Query: 660 LETGLVDINYLPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           L T   D+  LP G   N   G  N GNTCY NS+LQ  + ++  R  +L Y
Sbjct: 128 LSTHTTDL--LPYGDGSNKVFGYENFGNTCYCNSVLQCLYNLTEFRLNVLQY 177

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILAYDH 710
           TG+ N+GNTCY+NS++Q  F     R   ++ ++
Sbjct: 598 TGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNY 631

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 36.2 bits (82), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + K  Q  G W  Y+DE +  + E +V    E N    Y
Sbjct: 674  YQLLSVVVHEGRSLSSGHYIAHCK--QPDGSWATYDDEYINIISERDV--LKEPNA---Y 726

Query: 1369 FLVYVK 1374
            +L+Y +
Sbjct: 727  YLLYTR 732

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + S GHY  + +  Q  G W  Y+DE + ++ E  V    E N    Y
Sbjct: 607  YQLISVVVHEGRSLSSGHYIAHCR--QPDGSWAIYDDEYINKISERNV--LKEPNA---Y 659

Query: 1369 FLVYVK 1374
            +L+Y +
Sbjct: 660  YLIYTR 665

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1196

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFD 1358
            Y+L  V +H G+ S GHY+  I+   +   W +++D+ V  V + + FD
Sbjct: 441  YNLHGVLVHAGDISTGHYYTMIRPGVSDE-WYRFDDDKVWRVTKKQAFD 488

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 16/29 (55%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYI 705
            G  N G TCYLNSLLQ YF     R  +
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLV 231

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 5/79 (6%)

Query: 1297 AIAHRFDAFSSYGYSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESE 1355
             +   FD      Y L  V +H G + ++GHY    K  + G  W  Y+DE++  +PE  
Sbjct: 570  TVCSCFDNSLCKTYELTGVVLHVGASPTHGHYVSICKHEKYG--WLMYDDETIESIPEEA 627

Query: 1356 VFDFSEE--NTATPYFLVY 1372
            V     E  N  T Y L Y
Sbjct: 628  VTSHVGEPNNPITAYVLFY 646

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score = 36.2 bits (82), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N+GNTCY+NS++Q  F     R   ++
Sbjct: 602 TGLRNLGNTCYINSMIQCLFAAKVFRTLFIS 632

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 35.8 bits (81), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 8/64 (12%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            + L  +  HRG  + GHY  + K     G W K+ND  V+ + E E+           Y 
Sbjct: 405  FELIGIIAHRGTVNEGHYIAFTK--VTTGHWFKFNDSMVSSITEEELLQ------EQAYL 456

Query: 1370 LVYV 1373
            L YV
Sbjct: 457  LFYV 460

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 1310 YSLGAVFIHRGEA-SYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
            Y L +V +H G + + GHY  + K  Q  G W  Y+DE + ++ E ++           Y
Sbjct: 648  YQLISVVVHEGRSLTSGHYIAHCK--QPDGSWSTYDDEYINKISERQML-----KEPGAY 700

Query: 1369 FLVYVK 1374
            +LVY +
Sbjct: 701  YLVYTR 706

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
           TG+ N  NTCY+NS++Q  F  +P R+  L 
Sbjct: 292 TGLQNPCNTCYINSIIQCLFGSTPFRDLFLT 322

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score = 35.8 bits (81), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILAYDH 710
           TG+ N+GNTCY+NS++Q  F     R   ++ ++
Sbjct: 601 TGLRNLGNTCYINSMIQCLFAAKIFRTLFISANY 634

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 21/29 (72%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYIL 706
           G++N+GNTCY+NS LQ    I  +R+Y +
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFV 350

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar to
            uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions irrespective of their size capable of
            cleaving polyubiquitin chains
          Length = 771

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L +V +H G  +YGHY  + +     G W + +DESV  V E EV 
Sbjct: 681  YVLRSVIVHYGTHNYGHYIAFRR---FRGCWWRISDESVYIVDEQEVL 725

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
            Anc_3.270 YBR058C
          Length = 785

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 1310 YSLGAVFIHRGEASY-GHYWVYIKDCQNGGI-WRKYNDESV 1348
            Y L AV  H+G++++ GHY  +I+   +G + W  YNDE +
Sbjct: 721  YKLTAVVCHKGQSAHSGHYVAFIRKIVDGKLSWVLYNDEKI 761

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 643 ALTKIGFERNSKLINHFLETGLVDINYLPAGN-WPTGINNIGNTCYLNSLLQYYF 696
            L ++  E+N       +++   ++  L AG+ +  G+ N+GN+CYLNS+LQ ++
Sbjct: 291 TLVELQVEQNMNWNFQMVDSEGKELKSLKAGDDFGVGLINLGNSCYLNSILQCFY 345

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 22/42 (52%), Gaps = 3/42 (7%)

Query: 670 LPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           LP G   N   G  N GNTCY NS+LQ  + +   R  IL Y
Sbjct: 116 LPFGDGSNKVFGYENFGNTCYCNSVLQCLYNLPEFRLNILQY 157

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 643 ALTKIGFERNSKLINHFLETGLVDINYLPAGN-WPTGINNIGNTCYLNSLLQ 693
            L ++  E+N       +++   ++  LPA N +  G+ N+GN+CYLNS++Q
Sbjct: 288 TLVQLQIEQNENWQFKMVDSSGKELKKLPASNEYGCGLINLGNSCYLNSVMQ 339

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 670 LPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           LP G   N   G  N GNTCY NS+LQ  + +  LR  +L +
Sbjct: 133 LPYGDGSNKVFGYENFGNTCYCNSVLQVIYNLPELRVNLLEF 174

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
            Anc_3.270 YBR058C
          Length = 765

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 1299 AHRFDAFSSYGYSLGAVFIHRGEASY-GHYWVYIKDCQNGGIWRKYNDESVTEV 1351
            A +F       Y L  +  H+G ++  GHY  YI+  Q  G W  YNDE +  V
Sbjct: 696  ARKFGHPGGSIYKLYGIVCHKGNSTQSGHYVAYIR--QRDGQWTLYNDEKIVCV 747

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
            to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
            Ubiquitin-specific protease that specifically
            disassembles unanchored ubiquitin chains
          Length = 770

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 1304 AFSSYGYSLGAVFIHRGEASY-GHYWVYIKDCQNGG-IWRKYNDESVTEVPESEVFDFSE 1361
            + +S  Y L AV  H+G + + GHY  +IK    G   W  YNDE +    +   F+  E
Sbjct: 699  SIASAKYKLTAVICHKGNSVHSGHYVAFIKKVVEGKEQWVLYNDEKILLANDEPNFEDIE 758

Query: 1362 ENTATPYF 1369
            +N    +F
Sbjct: 759  KNGYMFFF 766

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 652 NSKLINHFLETGLVDIN-----YLPAG---NWPTGINNIGNTCYLNSLLQYYFTISPLRE 703
           N + I  FL+  +  I       LP G   N   G  N GNTCY NS+LQ  F +   R 
Sbjct: 89  NHQAIEEFLDIDIKRITPSISEVLPYGDGSNKIFGYENFGNTCYCNSILQCLFFLDDFRI 148

Query: 704 YILAY 708
            IL +
Sbjct: 149 DILKH 153

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLRE 703
           TG+ N+G TCY+NS+LQ  F  +  R+
Sbjct: 599 TGLRNLGATCYINSMLQCLFATNMFRD 625

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            Y L AV  H G  + GHY    K    GG W ++ND  +  + E E            Y 
Sbjct: 394  YELVAVISHEGSVNQGHYTSMCKI--PGGQWFRFNDSMIVSISEEEAL------RQQAYL 445

Query: 1370 LVYV 1373
            L YV
Sbjct: 446  LFYV 449

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 51/122 (41%), Gaps = 15/122 (12%)

Query: 733 RAISQAEVERSVQFVYQLRSLFHEMVHSRERYVTPTR----------ELVYLSFSPSSTE 782
           RAI    V+R   FV  +  L++   H +   +   R          +L Y+ F  +   
Sbjct: 61  RAIKDGLVKREELFV--VSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKP 118

Query: 783 VEFE-PVPPAVGTASNALVANEVYNEDTEVIDI--SMEECDEDSAINELGASNISVKLDS 839
           V FE   PP + T      A  +  E   ++D   ++EEC E+  I  +G SN S  +  
Sbjct: 119 VSFEEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIML 178

Query: 840 DI 841
           D+
Sbjct: 179 DL 180

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 8/65 (12%)

Query: 1309 GYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPY 1368
             Y L  V  H+G    GHY    K     G W K+ND  VT V E +V +         Y
Sbjct: 388  AYDLLNVVSHQGTVDQGHYTTVSKT--EDGQWFKFNDSVVTSVTEEQVLE------QQAY 439

Query: 1369 FLVYV 1373
             L Y+
Sbjct: 440  LLFYI 444

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 34.3 bits (77), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVF 1357
            Y L  +  H+G  + GHY    K    GG W K+ND  VT V E +V 
Sbjct: 394  YELIGLISHQGSVNQGHYTSICK--IPGGQWFKFNDSMVTAVAEIDVL 439

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 34.3 bits (77), Expect = 2.7,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 8/64 (12%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            Y L  +  H G  + GHY  + K  +NG  W K+ND  VT++ E +V           Y 
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCK-IENGE-WFKFNDSMVTKILEKDVL------KEQAYL 452

Query: 1370 LVYV 1373
            L Y+
Sbjct: 453  LFYI 456

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 2/65 (3%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEE--NTATP 1367
            Y L  V  H G +S G ++      Q+   W + +D +VTE+ + EV    EE  ++ T 
Sbjct: 767  YKLTGVVYHHGLSSSGGHYTADVLHQDEEKWYRIDDTTVTEINKEEVVTGGEEGSHSRTA 826

Query: 1368 YFLVY 1372
            Y L+Y
Sbjct: 827  YILIY 831

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           G  N GNTCY NS+LQ  + +   R  +L Y
Sbjct: 151 GYENFGNTCYCNSVLQCLYNLPEFRNDMLRY 181

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%)

Query: 678 GINNIGNTCYLNSLLQYYFTISPLREYILAY 708
           G  N GNTCY NS+LQ  + ++  R  +L +
Sbjct: 125 GYENFGNTCYCNSVLQCLYNLTEFRLLLLQH 155

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707
            G+ N GNTCY+NS++Q  F    LR+  ++
Sbjct: 238 VGLRNQGNTCYINSMVQCLFGTKVLRDLFIS 268

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 8/70 (11%)

Query: 1306 SSYGYSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTA 1365
            +S  Y L  V  H G  + GHY   ++   N G W K+ND  ++ V   +V         
Sbjct: 392  TSIVYRLSGVVSHSGTVNEGHYTAVLQ--LNSGEWFKFNDSMISVVSAEDVL------RE 443

Query: 1366 TPYFLVYVKE 1375
              Y L+Y  E
Sbjct: 444  QAYLLLYTVE 453

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
            YBR058C (UBP14) - Ubiquitin-specific protease [contig
            183] FULL
          Length = 762

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 1310 YSLGAVFIHRGEASY-GHYWVYIK-DCQNGGIWRKYNDESVT 1349
            + L AV  H+G + + GHY  +IK D +N   W  YNDE + 
Sbjct: 698  FRLSAVICHKGSSVHSGHYVAFIKKDVENETKWVLYNDEKMV 739

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
           similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 865 LNTGIRTCMPNDTAINMATGNATAPNKGIVNS-EANFEHLMTPAPHEGTDKPI--GNDQS 921
           +N G  T +  DT +  +    + P+ G+V+S      H++ P P++G   PI   +D+S
Sbjct: 767 INVG--TSIAVDTKVTTSVSELSTPSDGVVSSYTPASSHVLVPKPYKGATNPIRKSSDES 824

Query: 922 VVPN 925
           VV N
Sbjct: 825 VVTN 828

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%)

Query: 670 LPAGNWPTGINNIGNTCYLNSLLQ 693
           LP  ++  G+ N+GN+CYLNS+LQ
Sbjct: 316 LPNKDYGCGLINLGNSCYLNSVLQ 339

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 1310 YSLGAVFIHRG-EASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEE--NTAT 1366
            Y L  V  H G   S GHY   +   Q    W + +D +VTE+ + +VF   +E  ++ T
Sbjct: 723  YRLTGVVYHHGLSPSGGHYTADVLH-QTQDKWYRIDDNNVTEIRQEDVFKRGDEASDSKT 781

Query: 1367 PYFLVY 1372
             Y L+Y
Sbjct: 782  AYILIY 787

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 8/64 (12%)

Query: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369
            Y L AV    G  + GHY    K    GG W ++ND  +  + E +V           Y 
Sbjct: 393  YELVAVISQEGSVNQGHYTCMCK--VPGGQWFRFNDTMIVSITEEDVL------RQQAYL 444

Query: 1370 LVYV 1373
            L YV
Sbjct: 445  LFYV 448

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 143,851,630
Number of extensions: 6421443
Number of successful extensions: 20515
Number of sequences better than 10.0: 252
Number of HSP's gapped: 20799
Number of HSP's successfully gapped: 360
Length of query: 1389
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1267
Effective length of database: 39,492,147
Effective search space: 50036550249
Effective search space used: 50036550249
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)