Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL159W7.340ON41341322350.0
Ecym_45197.340ON43240515910.0
SAKL0F10978g7.340ON4054126902e-86
KLLA0C16687g7.340ON3984164915e-57
Kwal_56.246047.340ON3813874102e-45
KLTH0H01474g7.340ON3813903805e-41
TPHA0D045507.340ON4374532562e-23
NCAS0A140707.340ON1732071728e-14
TBLA0A055601.92ON31252741.3
KNAG0H034802.162ON79642704.3
TBLA0B033708.761ON106465688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL159W
         (413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No ...   865   0.0  
Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar...   617   0.0  
SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {...   270   2e-86
KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON} cons...   193   5e-57
Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [con...   162   2e-45
KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {...   150   5e-41
TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340    103   2e-23
NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7....    71   8e-14
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    33   1.3  
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    32   4.3  
TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {...    31   8.8  

>ACL159W Chr3 (77497..78738) [1242 bp, 413 aa] {ON} NOHBY310; No
           homolog in Saccharomyces cerevisiae
          Length = 413

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/413 (100%), Positives = 413/413 (100%)

Query: 1   MEVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRN 60
           MEVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRN
Sbjct: 1   MEVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRN 60

Query: 61  CFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKNS 120
           CFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKNS
Sbjct: 61  CFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKNS 120

Query: 121 RAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQ 180
           RAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQ
Sbjct: 121 RAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQ 180

Query: 181 PLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIE 240
           PLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIE
Sbjct: 181 PLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIE 240

Query: 241 TEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDR 300
           TEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDR
Sbjct: 241 TEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDR 300

Query: 301 SQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDI 360
           SQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDI
Sbjct: 301 SQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDI 360

Query: 361 EEEARPLDQGDAWCILPLKLLRDGLHLLNVLVTIGDWQVNLNLHFKQHIATIT 413
           EEEARPLDQGDAWCILPLKLLRDGLHLLNVLVTIGDWQVNLNLHFKQHIATIT
Sbjct: 361 EEEARPLDQGDAWCILPLKLLRDGLHLLNVLVTIGDWQVNLNLHFKQHIATIT 413

>Ecym_4519 Chr4 (1034982..1036280) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii ACL159W
          Length = 432

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/405 (71%), Positives = 350/405 (86%), Gaps = 1/405 (0%)

Query: 1   MEVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRN 60
           MEVRYQC+C+ LVKWSDLN C+EC+S+SCFRCQ FEPV+KYCPKCLEEPGK+DQIFCNRN
Sbjct: 22  MEVRYQCICKNLVKWSDLNICRECYSLSCFRCQGFEPVVKYCPKCLEEPGKMDQIFCNRN 81

Query: 61  CFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKNS 120
           CFQCPRC+ISLVISSEK+  D K Y+F CTGCKW+FTTPPTGKIKSLTKY+LELY+SKN+
Sbjct: 82  CFQCPRCDISLVISSEKMDSDKKCYLFNCTGCKWTFTTPPTGKIKSLTKYILELYSSKNA 141

Query: 121 RAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQ 180
           RAYEL+THLHNKKQLLQWEG+AFKFDEIV+ALEGNAPRS VQRLA GEKLH LI+E++  
Sbjct: 142 RAYELITHLHNKKQLLQWEGKAFKFDEIVSALEGNAPRSIVQRLAVGEKLHQLISEQIPL 201

Query: 181 PLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIE 240
           PL+ D   VLYPKR HLKC+YRY CP+C+HTLS+PD +P+SS+LHKESFAMN+LP IRIE
Sbjct: 202 PLKDDSNEVLYPKRLHLKCKYRYTCPQCNHTLSVPDDSPSSSRLHKESFAMNILPRIRIE 261

Query: 241 TEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDR 300
             A ALG+D QDP+A AI+V+NP P R+++  L+ASDTLF+P+RKF IP+V+ +D ++ +
Sbjct: 262 KLAVALGMDHQDPSAFAIVVINPNPSRSIECTLTASDTLFMPIRKFNIPAVSVNDYKIIK 321

Query: 301 SQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDI 360
           + GKD+NLQILE Y KF PT MLGNDHK+NRAERTRRLG+RF FQ S + +  N +DYDI
Sbjct: 322 NSGKDINLQILEQYAKFTPTYMLGNDHKINRAERTRRLGSRFPFQNSTTNS-INLLDYDI 380

Query: 361 EEEARPLDQGDAWCILPLKLLRDGLHLLNVLVTIGDWQVNLNLHF 405
           +E+A+ +D+GD WCILPLKLL  G HLLN+LV I  ++V LNLHF
Sbjct: 381 DEDAKAIDKGDGWCILPLKLLNKGNHLLNLLVNIEGFEVRLNLHF 425

>SAKL0F10978g Chr6 complement(859590..860807) [1218 bp, 405 aa] {ON}
           conserved hypothetical protein
          Length = 405

 Score =  270 bits (690), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/412 (36%), Positives = 226/412 (54%), Gaps = 12/412 (2%)

Query: 1   MEVRYQCVCQQLVK-WSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNR 59
           M V   C C    K  S LN C+ C+ +SC +CQ FEPVLKYCP C+E P + DQ  C +
Sbjct: 1   MRVLVLCDCSSKCKSLSQLNLCQACYRVSCTQCQLFEPVLKYCPLCMEVPSRADQTHCTK 60

Query: 60  NCFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKN 119
           NCFQCPRC + LVISS    + +K YVF C GC W + TP  GKI+SLTKY+  L  ++ 
Sbjct: 61  NCFQCPRCKLGLVISSGSCDDGNKKYVFKCMGCHWDYKTPSVGKIRSLTKYIKSLKANEC 120

Query: 120 --SRAYELMT-HLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINE 176
             SR +E++  H H+K+QLL W          ++       R+ +QRL+ G+KL  L++E
Sbjct: 121 LLSRRFEVLERHYHSKRQLLDWGLTKTPLKIPLDGSLVADRRNVLQRLSQGDKLFELLDE 180

Query: 177 ELAQPLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPH 236
               PL    + +  P + HL+C+Y+Y CP C +TL  P+  P S K +  SFA+  LP 
Sbjct: 181 PCPMPLNDTSDALELPLQMHLRCKYKYSCPYCLNTLLKPETQPKSLKFYTTSFAVKYLPA 240

Query: 237 IRIETEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDS 296
           + +   ++ +     D T  A+++ NP     +   +S SD LF+P+ +  I +V P   
Sbjct: 241 LSLAPRSQ-IDNKVYDDTRFALVINNPTSSEEMHITMSGSDGLFIPITEVRIRAVTPVT- 298

Query: 297 QLDRSQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPV 356
                  +D  L+ +E ++  +PT  L  D KL+R ERT+RLG +     S +      +
Sbjct: 299 ----PSHQDHGLKTIEQFILSVPTYKLTADTKLSRVERTKRLGKKNLNVYSTANNSSTSL 354

Query: 357 DYDIEEEARPLDQGDAWCILPLKLLRDG-LHLLNVLVTIGDWQVNLNLHFKQ 407
             D+ E+ + LDQG  WCI+P+ +L +  +H L + V    ++V +N   K+
Sbjct: 355 LEDL-EDYKLLDQGSGWCIVPVNVLNNASVHSLFITVATQKFKVTMNCVIKK 405

>KLLA0C16687g Chr3 (1461624..1462820) [1197 bp, 398 aa] {ON}
           conserved hypothetical protein
          Length = 398

 Score =  193 bits (491), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 135/416 (32%), Positives = 211/416 (50%), Gaps = 40/416 (9%)

Query: 2   EVRYQCVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRNC 61
           + RY+  C     + DLN C +CH ISC +CQ+FE V KYC +C ++  K D ++C++NC
Sbjct: 3   QFRYRSGCGLESNFLDLNLCTKCHLISCQQCQDFEVVGKYCSQCGKDASKNDAVYCHKNC 62

Query: 62  FQCPRCNISLVISSEK--VTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLEL-YNSK 118
           FQCP C +SL I S K     D +SY F C GC WS+ TP   KIKSLTKY++EL Y++ 
Sbjct: 63  FQCPCCAMSLQIISNKDENNTDHRSYSFKCQGCNWSYCTPVVPKIKSLTKYIIELEYSTD 122

Query: 119 NSRAYELMT---HLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLIN 175
             R +E +    H  N    L  +  + KFD    AL+ +   S+ +RLA GE L  LIN
Sbjct: 123 THRRFESLRQFYHTRNTLNSLSLKPESLKFD----ALDPSNLNSWWKRLANGEPLWKLIN 178

Query: 176 EELAQP---LQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMN 232
           EE A P   L+Q+ +H L P    L+ +Y Y CP C   ++  D TP + K  K     +
Sbjct: 179 EENAIPFDELKQENKHWL-PSLCKLRPKYNYFCPYCKRCMTRMDPTPDTVKWVKTPPIYS 237

Query: 233 VLPHIRI--ETEARALGVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPS 290
            +P I +    +   L  +      L +++ N          ++A ++L +P  + +I +
Sbjct: 238 GIPRISVISSYQCTQLYKEFDHDNNLMLLIENTRQDSNATLKINAEESLLVPNHELSIFA 297

Query: 291 VAPDDSQLDRSQGKDVNLQILEHYVKFIPTCMLG---NDHKLNRAERTRRLGNRFQFQGS 347
                  +  +Q +  NL+ L+  +  +PT ML    +  KL R E TRRLG   +   S
Sbjct: 298 A------IKTNQKRKDNLEQLQDVLHSLPTHMLNTSPDSDKLLRVENTRRLGLLNKRLSS 351

Query: 348 ASPTPPNPVDYDIEEEARPLDQGDAWCILPLKLL-RDGLHLLNVLVTIGDWQVNLN 402
                         +  R +D+G  W ++PL ++ R   + +++ V   DW ++++
Sbjct: 352 --------------DNLRIIDEGTGWIVIPLMIINRKPRYEIDIFVHFEDWDLSMS 393

>Kwal_56.24604 s56 (1071942..1073087) [1146 bp, 381 aa] {ON} [contig
           161] FULL
          Length = 381

 Score =  162 bits (410), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 186/387 (48%), Gaps = 39/387 (10%)

Query: 1   MEVRYQCVCQ-QLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNR 59
           M V++ C C    +   DLN C++CH +SC  CQ+ E ++K+CP C +     +Q+ CN+
Sbjct: 1   MRVKWLCNCSTDPISLYDLNLCRKCHRVSCRWCQKPELLIKFCPGCSKGAETKNQMSCNK 60

Query: 60  NCFQCPRCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKN 119
           NCF+CPRC +++ +S  K  + ++ +   C GC W +TTP   K + LT++V EL   ++
Sbjct: 61  NCFECPRCQLAVSVSMRKQGDGARCFELVCNGCLWKYTTPAMTKARPLTQFVKELQEKED 120

Query: 120 SRAYELMTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELA 179
                 ++     +  +Q     F+  E  + ++ +     V       KL  L+NEE  
Sbjct: 121 PHEQRFISLRKLYRDKIQ-----FQNLETTDVIDPSFATKEVAERLNNMKLFELVNEEFP 175

Query: 180 QPLQQD--MEHVLYPKRTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHI 237
            P+ +        +P+   L+ ++ Y CP C   L+     P SS+   ESFAM+ LP +
Sbjct: 176 LPIHKGTFTSWNSFPRARALRGKFNYRCPACGEYLTKCHPDPKSSRFMLESFAMHQLPDL 235

Query: 238 RIETEARAL---GVDTQDPTALAIIVMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPD 294
           ++   +R+L    +D ++  AL     +   + A D  + +  T  +PVR+FT+    P 
Sbjct: 236 QV--VSRSLIDPKIDDENSMALVFKASSSAHV-ATDITIVSCATAHIPVRQFTLTRDIPS 292

Query: 295 DSQLDRSQGKDVNLQILEHYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPN 354
            ++L +        + ++     +PT  L  + K+  AE++RR             T  N
Sbjct: 293 RNELTQ--------EAIKRLASEVPTFQLNTNTKILAAEKSRR-------NSKVERTHKN 337

Query: 355 PVDYDIEEEARPLDQGDAWCILPLKLL 381
            +          +DQG+ WCI+P+ +L
Sbjct: 338 EI----------IDQGNGWCIIPMYIL 354

>KLTH0H01474g Chr8 complement(134657..135802) [1146 bp, 381 aa] {ON}
           conserved hypothetical protein
          Length = 381

 Score =  150 bits (380), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 107/390 (27%), Positives = 178/390 (45%), Gaps = 38/390 (9%)

Query: 18  LNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRNCFQCPRCNISLVISSEK 77
           LN C +CH +SC  CQ+ E ++KYCP C        Q+ C  NC +CPRC + L +S EK
Sbjct: 19  LNICAKCHRVSCNWCQKPELLIKYCPGCFRVAESEGQLRCVHNCLECPRCELILSVSMEK 78

Query: 78  VTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKN--SRAYELMTHLHNKKQL 135
           +    K +   C GC W + TP    +K+LT  V EL   ++  ++ +  +   +  K+ 
Sbjct: 79  LASGHKRFEMVCNGCSWRYKTPEVSTLKTLTGCVEELRKKEDPYTQRFNSLREFYGFKRE 138

Query: 136 LQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQPLQ--QDMEHVLYPK 193
           LQ+       +E     E  A +    RL    KL+ +INEE     +  +D   +  P 
Sbjct: 139 LQY------MEEGGEVSESIASKELFDRLNET-KLYKMINEECPIEFKDTKDSGDIALPL 191

Query: 194 RTHLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIETEARALGVDTQDP 253
              L+ ++ Y CP C   L+     P SS+   ESFA ++LP + I   ++ +     D 
Sbjct: 192 PLRLRAKFDYRCPSCGEWLTKSHPDPRSSRFLLESFAAHMLPSLEIVHRSK-VEPSVSDE 250

Query: 254 TALAII-VMNPIPMRAVDFVLSASDTLFLPVRKFTIPSVAPDDSQLDRSQGKDVNLQILE 312
            A+A++   +      V+  +  S T+ +PVR+FT+    P           +  ++ ++
Sbjct: 251 NAMALVFTASDQSDTPVEITILGSATIHIPVRQFTLAYDGPVKC--------ESTMETIK 302

Query: 313 HYVKFIPTCMLGNDHKLNRAERTRRLGNRFQFQGSASPTPPNPVDYDIEEEARPLDQGDA 372
             V  +PT  L ++  +   E++RRL        +   T P+  +         +DQG  
Sbjct: 303 RLVTRVPTYQLNSNTNILATEKSRRL--------TRPETAPHKNNM--------IDQGSG 346

Query: 373 WCILPLKLLRDG-LHLLNVLVTIGDWQVNL 401
           WCILP+ +L     H + + + I    V L
Sbjct: 347 WCILPMYILEPAKTHRIQLTIPIKGVYVTL 376

>TPHA0D04550 Chr4 (993082..994395) [1314 bp, 437 aa] {ON} Anc_7.340
          Length = 437

 Score =  103 bits (256), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 111/453 (24%), Positives = 185/453 (40%), Gaps = 73/453 (16%)

Query: 1   MEVRYQCVC-------------QQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLE 47
           M++++ C C             Q  + +S LN C++CH ISC  CQ F+   K+CP C  
Sbjct: 1   MKIKWTCNCCKERNHYNGNDAQQYGIDFSRLNLCRKCHKISCDSCQLFQDYEKFCPYCCR 60

Query: 48  EPGKID-------------------QIFCNRNCFQCPRCNISLVIS---SEKVTE-DSKS 84
                D                     +C   CFQCP+CN SL +S   +E++ + + K+
Sbjct: 61  NNKVPDCADGSRLSFEERYCQEICYDEYCTNGCFQCPKCNNSLALSLCKNERLKDPNGKT 120

Query: 85  YVFTCTGCKWSFTTPPTGKIKSLTKYVLELY---NSKNSRAYELMTHLHNKKQLLQWEGR 141
             F C  C WS++T   G +K L+K++  L+   + K  R  +L     N          
Sbjct: 121 ISFQCYCCSWSWSTELPGNVKLLSKHIFSLHLNLDPKFQRFKQLSNIYLNDSSDCSNNDP 180

Query: 142 AFKFDEI-VNALEGNAPRSFVQRLAAGEKLHH------LINEELAQPLQQDMEHVLYPKR 194
           ++   +I +   +  + R  +  +   ++         L+N++       D  +   P+ 
Sbjct: 181 SYSVKDIYLKQGDLQSARGLLDIINNKKETSFNTSSTVLLNDQFPHQNLYDDTNTSLPEL 240

Query: 195 THLKCRYRYMCPKCHHTLSMPDQTPASSKLHKESFAMNVLPHIRIETEARALGVDTQDPT 254
           + L  ++ Y CP C  T+  P     SS    ESFA   LP I    E  A+    QD  
Sbjct: 241 SKLVMKFEYKCPHCEETILKPSSELYSSDNTYESFAFTQLPTI----EVSAIKDLKQD-- 294

Query: 255 ALAIIVMNPIPMRAVDFV---LSASDTLFLPVRKFTIPSVAPDDSQLDRSQGKDVNLQIL 311
              +++M  I     DFV   +  SD + L   KF       D  Q D+S+     +  L
Sbjct: 295 --LVLIMKNIEDNLNDFVQAEIITSDNIQLSQNKFIFMKSTGDKLQ-DKSKYYAELMSYL 351

Query: 312 EHYVKFIPTCMLGNDHKLNRAERTRRLG--NRFQFQGSASPTPPNPVDYDIEEEARPLDQ 369
           E    F        ++K  R E+ RRL   N      +A+     P++Y         ++
Sbjct: 352 EGLPSFDLNLCDNVNNKFVRIEKQRRLAKNNNIAVMNNANS----PMNYK--------EE 399

Query: 370 GDAWCILPLKLLRD-GLHLLNVLVTIGDWQVNL 401
            D + + P+K+L +  L+ L V      ++V+L
Sbjct: 400 SDRYIVSPIKILTETALNKLLVKYKFKTYEVSL 432

>NCAS0A14070 Chr1 (2767470..2767991) [522 bp, 173 aa] {ON} Anc_7.340
          Length = 173

 Score = 70.9 bits (172), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 93/207 (44%), Gaps = 38/207 (18%)

Query: 7   CVCQQLVKWSDLNSCKECHSISCFRCQEFEPVLKYCPKCLEEPGKIDQ-IFCNRNCFQCP 65
           C C +  +   + +CK CH+ +C  C+ F+P+ + CP+C      +D+   C  +CFQCP
Sbjct: 3   CPCSRDPQVPHVTNCKVCHNTTCPDCELFQPLQRECPQCQTITMHMDEDTRCKNDCFQCP 62

Query: 66  RCNISLVISSEKVTEDSKSYVFTCTGCKWSFTTPPTGKIKSLTKYVLELYNSKNSRAYEL 125
            C  +L +   K +   K Y FTC  C + + TP              +  +      ++
Sbjct: 63  NCETALTVLLAKSSR-KKRYKFTCKHCDYDYVTP-------------SMSVTDERSISQI 108

Query: 126 MTHLHNKKQLLQWEGRAFKFDEIVNALEGNAPRSFVQRLAAGEKLHHLINEELAQPLQQD 185
           + HL+   + L  E    +F E+   +E          L  G      I+  +  PL  D
Sbjct: 109 VDHLN---ETLNVE--YLRFQELKKNIE----------LGGG------IDNVVVLPLCGD 147

Query: 186 MEHVLYPKRTHLKCRYRYMCPKCHHTL 212
              V+ P+RT L C+++ +CP C+H +
Sbjct: 148 --DVILPRRTKLVCQFQSICPHCYHVV 172

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {ON}
           Anc_1.92 YGL128C
          Length = 312

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 9/52 (17%)

Query: 195 THLKCRYRYMCPKCHHTLSMPDQTPAS----SKLHKESFAMNVLPHIRIETE 242
             +K RYR +  K H     PD+TP       K HK + A+N+L + +++TE
Sbjct: 31  NEIKKRYRSLALKYH-----PDKTPNDLTLVEKFHKITIALNILTNNQLKTE 77

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 22/42 (52%)

Query: 173 LINEELAQPLQQDMEHVLYPKRTHLKCRYRYMCPKCHHTLSM 214
           L NE +A P+     +  +P +T  + + ++ CP CHH  + 
Sbjct: 442 LDNESMASPMSSQSPNESFPAQTPQQQQKKHECPYCHHKFAQ 483

>TBLA0B03370 Chr2 complement(784352..787546) [3195 bp, 1064 aa] {ON}
            Anc_8.761 YMR231W
          Length = 1064

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 13/65 (20%)

Query: 20   SCKECHS-----ISCFRCQEFEPVLKYCPKCLEEPGKIDQIFCNRNCFQCPRCNISLVIS 74
            +C+ CHS     I  FRC        Y  KCL E             F+CP+C I L  S
Sbjct: 963  TCRMCHSSLDLPIVFFRCNHI-----YHQKCLNEETNFKD---GEKLFRCPKCVIDLQTS 1014

Query: 75   SEKVT 79
             + V+
Sbjct: 1015 QKLVS 1019

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,674,571
Number of extensions: 2028268
Number of successful extensions: 4995
Number of sequences better than 10.0: 20
Number of HSP's gapped: 5122
Number of HSP's successfully gapped: 22
Length of query: 413
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 301
Effective length of database: 40,638,807
Effective search space: 12232280907
Effective search space used: 12232280907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)