Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL158W7.341ON95954902e-65
Ecym_45207.341ON91883531e-44
SAKL0F10956g7.341ON86892932e-35
KLTH0H01452g7.341ON86842514e-29
Kwal_YGOB_Anc_7.3417.341ON86842481e-28
Kpol_530.377.341ON88842116e-23
TDEL0C020607.341ON88841986e-21
TPHA0F029107.341ON1081001743e-17
NCAS0A140807.341ON78841691e-16
TBLA0E004707.341ON1161011701e-16
ZYRO0F11528g7.341ON121831683e-16
KLLA0C16709g7.341ON79791593e-15
CAGL0I03432g7.341ON149821583e-14
NDAI0A019507.341ON122881277e-10
KAFR0B009007.341ON78851203e-09
YDL160C-A (MHF2)7.341ON80671151e-08
Skud_4.957.341ON79841151e-08
Suva_4.847.341ON81841142e-08
KNAG0C038107.341ON82841124e-08
Smik_4.767.341ON80621064e-07
NCAS0H016105.357ON71440631.8
Kpol_462.1singletonON172679613.5
Smik_11.621.182ON39725603.8
Suva_15.1786.14ON47652604.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL158W
         (95 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...   193   2e-65
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...   140   1e-44
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...   117   2e-35
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...   101   4e-29
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...   100   1e-28
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    86   6e-23
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    81   6e-21
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    72   3e-17
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               70   1e-16
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    70   1e-16
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    69   3e-16
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    66   3e-15
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    65   3e-14
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    54   7e-10
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    51   3e-09
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    49   1e-08
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    49   1e-08
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    49   2e-08
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    48   4e-08
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    45   4e-07
NCAS0H01610 Chr8 complement(307433..309577) [2145 bp, 714 aa] {O...    29   1.8  
Kpol_462.1 s462 complement(798..5978) [5181 bp, 1726 aa] {ON} co...    28   3.5  
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    28   3.8  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...    28   4.4  

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score =  193 bits (490), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MSEKIELSQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLEN 60
          MSEKIELSQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLEN
Sbjct: 1  MSEKIELSQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLEN 60

Query: 61 KEKVKQETRADSFAEGPVLQHTDLEEISGVLILDF 95
          KEKVKQETRADSFAEGPVLQHTDLEEISGVLILDF
Sbjct: 61 KEKVKQETRADSFAEGPVLQHTDLEEISGVLILDF 95

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score =  140 bits (353), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 64/88 (72%), Positives = 76/88 (86%)

Query: 8  SQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQE 67
          SQEP +P+DTIAR+F  CSFTQDST+ITED +TL E+Y+KLF+REAVLRSLENK+KVK+E
Sbjct: 4  SQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKE 63

Query: 68 TRADSFAEGPVLQHTDLEEISGVLILDF 95
              S  EGPVL HTDLEEISG+L+LDF
Sbjct: 64 DGKGSLIEGPVLHHTDLEEISGILLLDF 91

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (80%), Gaps = 3/89 (3%)

Query: 7  LSQEPAIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQ 66
          +SQ+ ++P DTIAR+F TCSFTQDST+ITED V L  +Y++LF+REAVLRSLENKEKVK 
Sbjct: 1  MSQQ-SLPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKP 59

Query: 67 ETRADSFAEGPVLQHTDLEEISGVLILDF 95
          ET  +S   G VL H DLEEISG+L+LD 
Sbjct: 60 ET--ESLDNGTVLSHEDLEEISGLLLLDM 86

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score =  101 bits (251), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 65/84 (77%), Gaps = 1/84 (1%)

Query: 12 AIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRAD 71
          +IP+DTIAR+F TCSF  DST+ITE  ++LV+ Y+++F+REA+LRS+ENKE+VK E   D
Sbjct: 4  SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSE-HQD 62

Query: 72 SFAEGPVLQHTDLEEISGVLILDF 95
             +  VL H DLE +SG+L+LD 
Sbjct: 63 QLGDQVVLTHKDLERVSGLLLLDM 86

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 63/84 (75%), Gaps = 1/84 (1%)

Query: 12 AIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRAD 71
          ++P DTIAR+F TCSF  DST+ITE  +TLV+ Y+++F+REA+LRS+ENK++VK E   D
Sbjct: 4  SVPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDE-HQD 62

Query: 72 SFAEGPVLQHTDLEEISGVLILDF 95
                VL H DLE +SG+L+LD 
Sbjct: 63 QLGSQVVLTHKDLERVSGLLLLDM 86

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 85.9 bits (211), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 45/84 (53%), Positives = 62/84 (73%), Gaps = 4/84 (4%)

Query: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
          IP +TIARL  T SF   ST+ITED V  +++YM+LF+REA++RS+E K K+++E   +S
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEE---NS 63

Query: 73 FAEGPV-LQHTDLEEISGVLILDF 95
          F    V L HTDLEEI+G+L+LD 
Sbjct: 64 FTGVRVELTHTDLEEIAGLLLLDM 87

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 80.9 bits (198), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 59/84 (70%), Gaps = 1/84 (1%)

Query: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQE-TRAD 71
          IP +TIAR F   +F  +ST IT++ V ++++YM++F+REAVLRS  NKE++K E + A 
Sbjct: 5  IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64

Query: 72 SFAEGPVLQHTDLEEISGVLILDF 95
            +   VL H DLE I+G+L+LD 
Sbjct: 65 RNSNEIVLTHEDLENITGLLLLDM 88

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 71.6 bits (174), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 19/100 (19%)

Query: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRA-- 70
           IP DTIAR+    SF ++ T+I+ ++V ++++YM+LF+REAVLRS+EN+E+ +    A  
Sbjct: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68

Query: 71  ---------------DSFAEGPVLQHTDLEEISGVLILDF 95
                           SF  G  L H DLEEISG+L+LD 
Sbjct: 69  KAPAKANPDQLQTFQHSF-NGIELTHEDLEEISGLLLLDM 107

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 69.7 bits (169), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/84 (42%), Positives = 55/84 (65%), Gaps = 7/84 (8%)

Query: 12 AIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRAD 71
          AIP +TIA++    +F    TK+TE+ +++++RYM+LFIREA+ RSL+NKEK   +T   
Sbjct: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQT--- 58

Query: 72 SFAEGPVLQHTDLEEISGVLILDF 95
                V+   DLE + G+L+LD 
Sbjct: 59 ----DIVIDEKDLERVVGLLLLDM 78

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 70.1 bits (170), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 58/101 (57%), Gaps = 18/101 (17%)

Query: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENK-EKVKQETRAD 71
           +P +TIAR+  T SF  ++T+IT++ VT +++YM+LFIREA LRSLENK E++  E  A 
Sbjct: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75

Query: 72  SFAEG-----------------PVLQHTDLEEISGVLILDF 95
               G                   L H  LE I+G+L+LD 
Sbjct: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 69.3 bits (168), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 58/83 (69%), Gaps = 5/83 (6%)

Query: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
           +P +TI R+    +F  +ST ITE+ VT++++Y+++F+REAV RS+ NK+   Q +  D 
Sbjct: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKD--SQGSHGD- 98

Query: 73  FAEGPV-LQHTDLEEISGVLILD 94
             +G + L H DLE+I+G+L+LD
Sbjct: 99  -GDGEIQLNHEDLEKITGMLLLD 120

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 65.9 bits (159), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 51/79 (64%), Gaps = 9/79 (11%)

Query: 17 TIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADSFAEG 76
          TIAR+  T  F   +T+ITE+ + L+E Y++LF+RE VLRSLENK        AD  A+ 
Sbjct: 9  TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENK--------ADMLADK 60

Query: 77 PVLQHTDLEEISGVLILDF 95
           V    DLE ++G+L++DF
Sbjct: 61 TV-DFVDLEAVAGLLLMDF 78

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 65.5 bits (158), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 3/82 (3%)

Query: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
           +P DTIAR+    +F    T+I  D V  ++RY+ +F REAVLRS+E+ +  ++    + 
Sbjct: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQ 129

Query: 73  FAEGPVLQHTDLEEISGVLILD 94
             E   + HTDLE I+G+L+LD
Sbjct: 130 DKE---ITHTDLENIAGLLLLD 148

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 53.5 bits (127), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
           I  +TI ++  + SF    T IT++ + +++RYM LFI+EAV+RS ENK   + E   D 
Sbjct: 35  ILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFDDE 94

Query: 73  FAEGPV-----LQHTDLEEISGVLILDF 95
                      L H DLE I G+L+++ 
Sbjct: 95  EDADEEDKTIELTHLDLERIVGLLLMEL 122

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 50.8 bits (120), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 12 AIPTDTIAR-LFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRA 70
          +IP +TI+R L +  +   ++  I  + V  V +Y  + I E VLRSLENKE + + T  
Sbjct: 2  SIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENIAEAT-- 59

Query: 71 DSFAEGPVLQHTDLEEISGVLILDF 95
                P L   DLE+I G+L+LD 
Sbjct: 60 ------PTLDVDDLEKIIGLLLLDM 78

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score = 48.9 bits (115), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 44/67 (65%), Gaps = 5/67 (7%)

Query: 30 DSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADSFAEGPV-LQHTDLEEIS 88
          +  KI ++ V ++++Y+ +FI EAVLRSL++ + +  E R D   + P+ L H DLE I 
Sbjct: 18 NDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGE-RGD---KSPLELSHQDLERIV 73

Query: 89 GVLILDF 95
          G+L++D 
Sbjct: 74 GLLLMDM 80

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score = 48.9 bits (115), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 48/84 (57%), Gaps = 7/84 (8%)

Query: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
          +  D + ++    +F +D  KI +  + +++ Y+ +FI EA LRSL++++      R   
Sbjct: 2  LSKDALIKILSQNNFRKD-IKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHR--- 57

Query: 73 FAEGPV-LQHTDLEEISGVLILDF 95
            +GP+ L H DLE I G+L++D 
Sbjct: 58 --DGPLELSHLDLERIVGLLLMDM 79

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score = 48.5 bits (114), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 51/84 (60%), Gaps = 6/84 (7%)

Query: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
          +P + I ++  + + +  + KI +  + ++++Y+++FI EA LRSL++     +++    
Sbjct: 3  LPKEAIIKIL-SQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQS----HKDSSGAH 57

Query: 73 FAEGPV-LQHTDLEEISGVLILDF 95
            +GP+ L H DLE I G+L++D 
Sbjct: 58 DGDGPLELSHLDLERIVGLLLMDM 81

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 47.8 bits (112), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 48/84 (57%), Gaps = 12/84 (14%)

Query: 13 IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72
          I  +T++R+  T SF   ST I + A+T V++Y++ +++E +LRSLENK+          
Sbjct: 9  ISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------- 57

Query: 73 FAEGPV-LQHTDLEEISGVLILDF 95
              P  L   D+E I G+L+LD 
Sbjct: 58 LGVNPAELTERDIERILGLLLLDM 81

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score = 45.4 bits (106), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 34 ITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADSFAEGPVLQHTDLEEISGVLIL 93
          I+++ + ++++Y+ +FI EA LRSL++ + + +E       E   L H DLE + GVL++
Sbjct: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDPLE---LSHQDLERVVGVLLM 78

Query: 94 DF 95
          D 
Sbjct: 79 DM 80

>NCAS0H01610 Chr8 complement(307433..309577) [2145 bp, 714 aa] {ON}
           Anc_5.357 YHR074W
          Length = 714

 Score = 28.9 bits (63), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query: 2   SEKIELSQEPAIPTDT---IARLFHTCSF-TQDSTKITED 37
           + KI  S E  IPTD     +++FHTC   T++S+K T D
Sbjct: 395 ARKITRSGEDWIPTDPKDLASKIFHTCYMGTENSSKETRD 434

>Kpol_462.1 s462 complement(798..5978) [5181 bp, 1726 aa] {ON}
            complement(798..5978) [5181 nt, 1727 aa]
          Length = 1726

 Score = 28.1 bits (61), Expect = 3.5,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 10/79 (12%)

Query: 6    ELSQEP--------AIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRS 57
            +LS EP         I   +  R   +  FT D+ +  ED + ++ER  K   + A++ S
Sbjct: 975  QLSSEPPSSSGDNHTIEDLSTRRHLKSSPFTDDTIRTLEDKIRILERDSKQ--QSAIIAS 1032

Query: 58   LENKEKVKQETRADSFAEG 76
              +++K   E+ A    +G
Sbjct: 1033 FRSRQKNSNESIATDIFDG 1051

>Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa]
          {ON} YKL166C (REAL)
          Length = 397

 Score = 27.7 bits (60), Expect = 3.8,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 59 ENKEKVKQETRADSFAEGPVLQHTD 83
          +NKEK+K+E    +F   P+LQ+ D
Sbjct: 53 QNKEKMKEEATTGNFLSKPMLQYRD 77

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score = 27.7 bits (60), Expect = 4.4,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 30/52 (57%)

Query: 24  TCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADSFAE 75
           T +F     K+   A +L  RY+  F  ++ +RS+E+ +++ QE + +S ++
Sbjct: 50  TGNFHLQEPKVVYKAESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSK 101

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,354,698
Number of extensions: 262830
Number of successful extensions: 983
Number of sequences better than 10.0: 29
Number of HSP's gapped: 965
Number of HSP's successfully gapped: 29
Length of query: 95
Length of database: 53,481,399
Length adjustment: 66
Effective length of query: 29
Effective length of database: 45,913,443
Effective search space: 1331489847
Effective search space used: 1331489847
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)