Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL157C7.342ON5151949031e-115
Ecym_47317.342ON5142576351e-75
SAKL0F10934g7.342ON4981744925e-55
KLLA0C16731g7.342ON4781274802e-53
TDEL0C020507.342ON5011274724e-52
Kwal_56.246107.342ON5081744716e-52
KLTH0H01430g7.342ON5021274698e-52
TPHA0D045607.342ON4871284443e-48
Skud_4.947.342ON4471274396e-48
YDL161W (ENT1)7.342ON4541274397e-48
NCAS0H006707.342ON4831274391e-47
CAGL0A03872g7.342ON5101274401e-47
Smik_4.757.342ON4602564371e-47
Suva_4.837.342ON4621274372e-47
Suva_10.3007.342ON6181274442e-47
Smik_12.2647.342ON6121274442e-47
YLR206W (ENT2)7.342ON6131274433e-47
Kpol_2001.707.342ON5331274393e-47
ZYRO0F11550g7.342ON5381274384e-47
Skud_12.2707.342ON6261274407e-47
TBLA0E004807.342ON5991304362e-46
KAFR0L014607.342ON5501274272e-45
KNAG0C038007.342ON4471234063e-43
NDAI0D006107.342ON486894032e-42
KNAG0B026507.342ON6461274048e-42
KAFR0B008907.342ON4141233931e-41
TBLA0E020407.342ON7011274014e-41
Kwal_47.168574.346ON3821272272e-19
TBLA0E047604.346ON4261272255e-19
NDAI0D032004.346ON4351272221e-18
KLTH0D16896g4.346ON4011272221e-18
KNAG0M003804.346ON4031272202e-18
KLLA0B04587g4.346ON4001272166e-18
TPHA0B004004.346ON3991272141e-17
KAFR0B067404.346ON3991272112e-17
TDEL0D007104.346ON3751272103e-17
SAKL0G17952g4.346ON4151272094e-17
Kpol_1001.24.346ON4181272086e-17
ZYRO0B14784g4.346ON4241272071e-16
YJR125C (ENT3)4.346ON4081262051e-16
Smik_10.4184.346ON4091262051e-16
AER155C4.346ON3641242032e-16
NCAS0A062104.346ON4231242052e-16
CAGL0H04323g4.346ON4121242033e-16
Skud_10.3494.346ON4101262014e-16
Suva_12.2164.346ON4101262006e-16
Ecym_11334.346ON3921241873e-14
Kwal_55.206114.17ON2541101442e-09
KLTH0E05874g4.17ON2551101442e-09
ACL061C4.17ON2341001396e-09
SAKL0H25762g4.17ON2621101407e-09
TPHA0F002304.17ON2801101353e-08
Kpol_388.54.17ON2681151311e-07
TBLA0G006504.17ON4231101312e-07
Ecym_84074.17ON2541001247e-07
TBLA0B062204.346ON3391131186e-06
KLLA0D03949g4.17ON2251211141e-05
ZYRO0G07876g4.17ON259991132e-05
TDEL0G017404.17ON2571261132e-05
CAGL0E03806g4.17ON260981113e-05
NDAI0H002804.17ON3101121114e-05
KAFR0B058008.335ON382971081e-04
TBLA0H012108.335ON4911501081e-04
NCAS0B036608.335ON4161021081e-04
Kpol_1036.768.335ON3681321062e-04
AGR046C8.335ON387971043e-04
NDAI0J009308.335ON418971054e-04
NCAS0C058404.17ON2671071034e-04
TBLA0A040408.335ON415961026e-04
KNAG0A051008.335ON421971026e-04
KNAG0J028704.17ON329125990.001
TPHA0A015008.335ON40797990.001
ZYRO0F13684g8.335ON40797990.001
TDEL0F045908.335ON361102980.002
CAGL0E01199g8.335ON41297970.003
KLLA0D16654g8.335ON399133960.004
Smik_4.3988.335ON416105950.005
YDR153C (ENT5)8.335ON411105950.005
Suva_2.3158.335ON403105940.006
Smik_8.2455.84ON62795940.007
Skud_8.2255.84ON62195940.008
Skud_4.4128.335ON40697930.009
TBLA0B057705.84ON68082930.009
YHR161C (YAP1801)5.84ON63795930.011
Kpol_344.88.335ON384102920.012
KAFR0I014604.17ON275103890.023
TPHA0C007408.335ON38597880.034
KAFR0E021805.84ON61283870.051
Kwal_YGOB_27.112618.335ON404106860.059
KLTH0G11902g8.335ON39997850.087
SAKL0H15290g8.335ON393132840.096
TDEL0G010805.84ON51583830.16
Kwal_27.11263singletonOFF275106820.16
NCAS0D014605.84ON67882820.23
NDAI0C032805.84ON71982800.42
ZYRO0F13508g5.84ON687125790.47
Ecym_42648.335ON40869780.54
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL157C
         (515 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   352   e-115
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   249   1e-75
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   194   5e-55
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   189   2e-53
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   186   4e-52
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   186   6e-52
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   185   8e-52
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   175   3e-48
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   173   6e-48
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   173   7e-48
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    173   1e-47
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   174   1e-47
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   172   1e-47
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   172   2e-47
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   175   2e-47
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   175   2e-47
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   175   3e-47
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   173   3e-47
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   173   4e-47
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   174   7e-47
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   172   2e-46
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   169   2e-45
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   160   3e-43
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   159   2e-42
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   160   8e-42
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   155   1e-41
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   159   4e-41
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    92   2e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    91   5e-19
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    90   1e-18
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    90   1e-18
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    89   2e-18
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    88   6e-18
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    87   1e-17
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    86   2e-17
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    86   3e-17
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    85   4e-17
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    85   6e-17
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    84   1e-16
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    84   1e-16
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    84   1e-16
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    83   2e-16
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    84   2e-16
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    83   3e-16
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    82   4e-16
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    82   6e-16
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    77   3e-14
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    60   2e-09
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    60   2e-09
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    58   6e-09
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    59   7e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    57   3e-08
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    55   1e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    55   2e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    52   7e-07
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    50   6e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    49   1e-05
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    48   2e-05
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    48   2e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    47   3e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    47   4e-05
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    46   1e-04
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    46   1e-04
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    46   1e-04
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    45   2e-04
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    45   3e-04
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    45   4e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    44   4e-04
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    44   6e-04
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    44   6e-04
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    43   0.001
TPHA0A01500 Chr1 (293819..295042) [1224 bp, 407 aa] {ON} Anc_8.3...    43   0.001
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    43   0.001
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    42   0.002
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    42   0.003
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    42   0.004
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    41   0.005
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    41   0.005
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    41   0.006
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    41   0.007
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    41   0.008
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    40   0.009
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    40   0.009
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    40   0.011
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    40   0.012
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    39   0.023
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    39   0.034
KAFR0E02180 Chr5 complement(432775..434613) [1839 bp, 612 aa] {O...    38   0.051
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    38   0.059
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    37   0.087
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    37   0.096
TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.8...    37   0.16 
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    36   0.16 
NCAS0D01460 Chr4 (276159..278195) [2037 bp, 678 aa] {ON} Anc_5.8...    36   0.23 
NDAI0C03280 Chr3 complement(745118..747277) [2160 bp, 719 aa] {O...    35   0.42 
ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]...    35   0.47 
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    35   0.54 

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  352 bits (903), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 173/194 (89%), Positives = 173/194 (89%)

Query: 322 SGPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRAXXXXXXXXXXXXXXXXXXXXXHS 381
           SGPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRA                     HS
Sbjct: 322 SGPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRASSSPSLPQQKQQPQVLQQPGQHS 381

Query: 382 SPVPQLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHT 441
           SPVPQLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHT
Sbjct: 382 SPVPQLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHT 441

Query: 442 KTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGN 501
           KTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGN
Sbjct: 442 KTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGN 501

Query: 502 SNKPNEQNISLIDI 515
           SNKPNEQNISLIDI
Sbjct: 502 SNKPNEQNISLIDI 515

 Score =  345 bits (885), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 177/252 (70%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 121 QIIRVKAXXXXXXXXXXXXXXXXXXXXXXXNPRNRQASVPPPAEDLDPDLQRALXXXXXX 180
           QIIRVKA                       NPRNRQASVPPPAEDLDPDLQRAL      
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDLDPDLQRALEESRIT 180

Query: 181 XXXXXXXXXXKTNQQQDNEELEVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
                     KTNQQQDNEELEVA                                    
Sbjct: 181 AEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQPQ 240

Query: 241 AMYYDIFGNPIS 252
           AMYYDIFGNPIS
Sbjct: 241 AMYYDIFGNPIS 252

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  249 bits (635), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 133/257 (51%), Positives = 157/257 (61%), Gaps = 7/257 (2%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQLLRSAKNV+NGYS AQ+LVRNATSN+EYGPS+DQMEELAER+YSAVEFFEI+VMLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           +RL+DKPK+WRHVAKSLTVTD+LVRTGAE CVDWAREN+++ R+LTEF HVDES+G DHG
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 121 QIIRVKAXXXXXXXXXXXXXXXXXXXXXXXNPRNRQASVPPPAED-LDPDLQRALXXXXX 179
           Q+IRVKA                         +N Q +VP    D +DPDL+RAL     
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQ-NVPETNPDGVDPDLKRALEESRI 179

Query: 180 XXXXXXXXXXXKTNQQQDNEELEVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
                         + +D EEL+ A                                   
Sbjct: 180 TAEEEERRRKL-AEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQV 238

Query: 240 XA----MYYDIFGNPIS 252
                 MYYDIFGNPI+
Sbjct: 239 QYQQQPMYYDIFGNPIT 255

 Score =  196 bits (497), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/193 (56%), Positives = 129/193 (66%), Gaps = 6/193 (3%)

Query: 323 GPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRAXXXXXXXXXXXXXXXXXXXXXHSS 382
           G NNPFSL NMHKL S+  + +    ST+ G P                         + 
Sbjct: 328 GVNNPFSLNNMHKLESENYEKTA---STSFGSPPGGTAGRSSSSTPLQQQPPQKPFPQTQ 384

Query: 383 PVPQLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTK 442
           P  Q          QLQ TRTGNQSI+DKY ELN LLA+GTG+DTFGNTGQ RI +QHTK
Sbjct: 385 PPSQSQSQPQSQPQQLQATRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTK 444

Query: 443 TGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNS 502
           T TFINS GTG+KQV NEPPKHNPF+ TQYTGLPSTN+VPSHTGYGFGNA + FQQ+  +
Sbjct: 445 TETFINSHGTGFKQVSNEPPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNA-SSFQQT--A 501

Query: 503 NKPNEQNISLIDI 515
           +KPN+Q +SLID+
Sbjct: 502 SKPNDQGMSLIDL 514

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  194 bits (492), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 99/174 (56%), Positives = 119/174 (68%), Gaps = 1/174 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSK LLR+AKNVVNGYS  Q+LVRNATSNE  GP++DQ++ELAE++Y  VEFFEI+ MLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W++ENLY+ + L EF H DE  GVDHG
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDE-MGVDHG 119

Query: 121 QIIRVKAXXXXXXXXXXXXXXXXXXXXXXXNPRNRQASVPPPAEDLDPDLQRAL 174
           QIIRVKA                         + R+       E+ D DLQRAL
Sbjct: 120 QIIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEEYDDDLQRAL 173

 Score =  166 bits (420), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 87/94 (92%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L PTRTGNQSI+ KY++LN LLASGTGLDTFGNTGQTRIPAQHT+TG FINSQGTGYKQV
Sbjct: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            N+ PK+NPF+A QYTGLPST++VPS+TGYGFGN
Sbjct: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  189 bits (480), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 106/127 (83%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSK  LRSAKN+VNGYS AQ+LVR+ATSN++ GPS+DQ+EELAER++  VEFFEI+ MLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK ++WRHVAKSLT  DFLVR G+E CV W +ENLY+ + L EF H DE T +D+G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 121 QIIRVKA 127
           +I+RVKA
Sbjct: 121 EIVRVKA 127

 Score =  162 bits (411), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 71/90 (78%), Positives = 84/90 (93%)

Query: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461
           RTGNQSI+DK+SELN LLASGTG+DTFGNTG+TR+PAQHTKTGTFINSQGTGYKQ+ N+ 
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
           PKHNPF+ +QYTG+PS+ + PS+TGYGFGN
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFGN 449

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  186 bits (472), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 106/127 (83%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKNVV GYS AQ+LVRNAT+NE  GPS+D+++ELAE++Y +VEFFEI+ M+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRH+AKSLTV D+LVR G+E CV W RENLY+ + L EF + D+  GVD G
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRN-DDDGGVDQG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  154 bits (388), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 93/117 (79%), Gaps = 2/117 (1%)

Query: 399 QPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVG 458
           +P RTG+ ++T+KY ELN LLA+GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGY+QV 
Sbjct: 387 KPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT 446

Query: 459 NEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQNISLIDI 515
            E PK NPF+ +QYTG+PS+N+VP+HTGYGFGN  +   Q+       +Q +SLID+
Sbjct: 447 GE-PKKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQTA-DQGVSLIDL 501

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  186 bits (471), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 116/174 (66%), Gaps = 5/174 (2%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSK L+R AKNVVNGYS  Q+L+R ATSN+  GPS+D M+E+AERS+ +V FFEI+ MLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV WA+ENLY+ + L EF H DE  G+D G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDE-LGIDQG 119

Query: 121 QIIRVKAXXXXXXXXXXXXXXXXXXXXXXXNPRNRQASVPPPAEDLDPDLQRAL 174
           QI+RVKA                         +NR+    P A   D DLQRA+
Sbjct: 120 QIVRVKARELTALLLDDERLREERSLRT----KNRKPRRRPTAGSEDEDLQRAM 169

 Score =  166 bits (419), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/115 (75%), Positives = 98/115 (85%), Gaps = 1/115 (0%)

Query: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460
           TRTGNQSIT+K+SELN LLASGTGLDTFGNTGQTRIPAQHTKTG FINSQGTGYKQV + 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSS- 453

Query: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQNISLIDI 515
            PKHNPF+  QYTGLPSTN+VPS+TGYGFGN  N  QQ+ N +   +Q +SLID+
Sbjct: 454 TPKHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNGADQGMSLIDL 508

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  185 bits (469), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 86/127 (67%), Positives = 104/127 (81%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSK L+R AKNVVNGYS  Q+L+R ATSN+  GPS+D M+E+AERS+ +V FFEI+ MLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV WA+ENLY+ + L EF H DE TGVD G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119

Query: 121 QIIRVKA 127
           QI+RVKA
Sbjct: 120 QIVRVKA 126

 Score =  174 bits (441), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 99/118 (83%), Gaps = 5/118 (4%)

Query: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460
           TRTGNQS+TDK+S+LN LLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 461 PP-KHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPN--EQNISLIDI 515
           P  KHNPF+  QYTGLPST++VPS+TGYGFGN     Q+  N N+ N  +Q +SLID+
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN--QNVQKQTNQNRANGADQGVSLIDL 502

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  175 bits (444), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 80/128 (62%), Positives = 102/128 (79%), Gaps = 1/128 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MS Q +RS KNVV GYS  Q+LVRNAT+NE  GP++D + ++AE++Y + +FFEI+ MLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDE-STGVDH 119
           KRL+DK K+W+H+AKSLTV D+LVR G+E CV W +ENLYL + LTEF + DE S GVD 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 120 GQIIRVKA 127
           GQIIRVKA
Sbjct: 121 GQIIRVKA 128

 Score =  135 bits (340), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 115/208 (55%), Gaps = 47/208 (22%)

Query: 322 SGPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRAXXXXXXXXXXXXXXXXXXXXXHS 381
           +G NNPF+L N    N++   AS          PD                        +
Sbjct: 313 TGSNNPFALNNQQTNNNNVQAAS--------ELPD-----------------------FT 341

Query: 382 SPVPQLPRPQSQPGPQLQ--------------PTRTGNQSITDKYSELNTLLASGTGLDT 427
            P  Q  +P   P  Q++                RTGN+ +T+KY+ELN LLASGTG+DT
Sbjct: 342 KPQAQSYQPAKLP-EQIEIQQPVQQPVQQPLQQNRTGNKEMTNKYNELNQLLASGTGIDT 400

Query: 428 FGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGY 487
           FGNTG+TRIPAQHT+TGTFINSQGTGY+Q   E  K NPF++ QYTGLPS+N++P+ TGY
Sbjct: 401 FGNTGETRIPAQHTQTGTFINSQGTGYRQQSGE-SKVNPFLSNQYTGLPSSNIIPTQTGY 459

Query: 488 GFGNAGNGFQQSGNSNKPNEQNISLIDI 515
           GFGN     Q      + N Q +SLID+
Sbjct: 460 GFGNQPQQQQYQQQQQQNNNQGVSLIDL 487

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  173 bits (439), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (78%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN+V GYS  Q+LVRNATSN+ +  S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W +ENLY+ + L EF H D+  GVD G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GVDQG 119

Query: 121 QIIRVKA 127
           QI+RVKA
Sbjct: 120 QIVRVKA 126

 Score =  156 bits (394), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 93/118 (78%), Gaps = 4/118 (3%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L  TRTGNQS+TDKY +LN LLA+GTG+DTFGN G +R+PAQHTKTGTFINSQGTGY+QV
Sbjct: 334 LTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQV 393

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQNISLIDI 515
            N+ PK NPF+ +QYTGLPSTN+VP+ TGYGFGN      Q+  SN    Q  +LID+
Sbjct: 394 SND-PKQNPFLNSQYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNS---QGYTLIDL 447

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  173 bits (439), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (78%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN+V GYS  Q+LVRNATSN+ +  S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W RENLY+ + L EF H D+  G+D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDE-GIDQG 119

Query: 121 QIIRVKA 127
           QI+RVKA
Sbjct: 120 QIVRVKA 126

 Score =  149 bits (375), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (90%), Gaps = 1/88 (1%)

Query: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461
           RTGNQS+TDKYS+LN LLA+GTG+DTFGN G+ RIPAQHTKTGTFINSQGTGY+QV ++ 
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDD- 403

Query: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGF 489
           P HNPF+ +QYTGLPST++VP+ TGYGF
Sbjct: 404 PNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  173 bits (439), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 100/127 (78%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN+V GYS  Q+LVR+ATSN+   PS + + ELA+RS+ +V+FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W +ENLY+ + L EF H D+  G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDG-GADQG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  159 bits (401), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 97/117 (82%), Gaps = 4/117 (3%)

Query: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460
           TRTGNQSITDKYS+LNTLLA+GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+QV N+
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGNA--GNGFQQSGNSNKPNEQNISLIDI 515
            PK+NPF+ +QYTGLPSTN+V + TGYGFGNA      QQ     +P +Q  SLID+
Sbjct: 429 -PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRP-DQGFSLIDL 483

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  174 bits (440), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (78%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           M  QL+RSAKN+V GYS  Q++VR+AT+N+   PS+  +E+LA+++Y  VEFFEI+ MLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W +ENLY+ + L EF H DE +G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 121 QIIRVKA 127

 Score =  167 bits (422), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 86/90 (95%), Gaps = 1/90 (1%)

Query: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460
           TRTGNQSI+DKYSELN LLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV NE
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490
            PK+NPF+++QYTGLPSTN+VPSHTGYGFG
Sbjct: 421 -PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  172 bits (437), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/256 (39%), Positives = 132/256 (51%), Gaps = 21/256 (8%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN+V GYS  Q+LVRNATSN+ +  S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W +ENLY+ + L EF H D+  G+D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GIDQG 119

Query: 121 QIIRVKAXXXXXXXXXXXXXXXXXXXXXXXNPRNRQA----SVPPPAEDLDPDLQRALXX 176
           QI+RVK+                         RNR+          + D D DLQRAL  
Sbjct: 120 QIVRVKSKELTALLSDDERLNEERNMNIKG--RNRKGRSRRGTGRSSNDNDNDLQRALDA 177

Query: 177 XXXXXXXXXXXXXXKTNQQQDNEELEVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
                            +++ +E+ E A                                
Sbjct: 178 SRMTAEEDE-------KRRKMDEDYETA-------LQLSKEEEELKRLQDLQRMQQLQTQ 223

Query: 237 XXXXAMYYDIFGNPIS 252
                MYYDIFGNPI+
Sbjct: 224 QQQQPMYYDIFGNPIT 239

 Score =  154 bits (390), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 1/93 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L  TRTGNQS+TDKY++LN LLA+GTG+DTFGN G  R+PAQHTKTGTFINSQGTGYKQV
Sbjct: 347 LTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQV 406

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490
            N+ PK+NPF++ QYTGLPSTN+VP+ TGYGFG
Sbjct: 407 SND-PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  172 bits (437), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 99/127 (77%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQL+RSAKN+V GYS  Q+LVRNATSN+    S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W +ENLY+ + L EF H D+  G D G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH-DDDEGTDQG 119

Query: 121 QIIRVKA 127
           QI+RVKA
Sbjct: 120 QIVRVKA 126

 Score =  166 bits (420), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 81/118 (68%), Positives = 95/118 (80%), Gaps = 4/118 (3%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L  TRTGNQS+TDKYS+LN LL +GTG+DTFGN G TR+PAQHTKTGTFINSQGTGY+QV
Sbjct: 349 LTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQV 408

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPNEQNISLIDI 515
            N+ PKHNPF+ +QYTGLPSTN+VP+ TGYGFGN     QQ   +N  N Q  +LID+
Sbjct: 409 SND-PKHNPFLNSQYTGLPSTNVVPAQTGYGFGNQP---QQQSQTNGTNSQGYALIDL 462

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  175 bits (444), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 102/127 (80%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN+V GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  156 bits (394), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/94 (78%), Positives = 86/94 (91%), Gaps = 1/94 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L  TRTGNQSI+DKY++LN LLA+GTG DTFGNTG++RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 434 LTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQV 493

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            NE PK+NPF+ +QYTGLPST++VP+ TGYGFGN
Sbjct: 494 VNE-PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  175 bits (444), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 102/127 (80%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN++ GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  161 bits (407), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/94 (80%), Positives = 87/94 (92%), Gaps = 1/94 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L+ TRTGNQSI+DKY++LNTLLA+GTG DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 426 LKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 485

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            NE PK+NPF++ QYTGLPSTN+VP+ TGYGFGN
Sbjct: 486 INE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 518

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  175 bits (443), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 102/127 (80%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN++ GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  164 bits (415), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 88/94 (93%), Gaps = 1/94 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L+ TRTGNQSI+DKYS+LNTLLA+GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 425 LKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 484

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            NE PK+NPF++ QYTGLPSTN+VP+ TGYGFGN
Sbjct: 485 TNE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 517

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  173 bits (439), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 101/127 (79%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           M KQ +RSAKNVV GYS  Q++VRNATSN+  GP +D ++ LAE++Y +VEFFEI+ MLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+W+H+AKSLTV D+LVR G+E CV W +ENLY+ + L EF ++D+S   D G
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDH-DQG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  161 bits (407), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 1/91 (1%)

Query: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460
           TRTGNQ ITDK+ ELN LLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGY+QV N+
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            PK+NPF+ +QYTGLPSTN+VPSHTGYGFGN
Sbjct: 443 -PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  173 bits (438), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 100/127 (78%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           M  Q +RSAKN + GY+ AQ+LVR+AT+NE  GPS+D ++ELA RSY +VEFFEI+ M+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W RENLY+ + L EF H D+ T  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQ-DGG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  159 bits (402), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 109/171 (63%), Gaps = 17/171 (9%)

Query: 322 SGPNNPFSLENMHKLNSDGPQASGPYISTAGGFPDRAXXXXXXXXXXXXXXXXXXXXXHS 381
           +G NNPF+L  M   ++  PQA+    S   G  +                         
Sbjct: 358 TGSNNPFALNGMPLQSNSKPQAA----SDLAGLNNWGNNSTGQLEMPKY----------- 402

Query: 382 SPVPQLPRPQSQPGPQ-LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQH 440
            P PQ P+  + P PQ +QP RTGNQSI+DKY++LN LLA  TG+DTFGN G  RIPAQH
Sbjct: 403 QPRPQQPQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQH 462

Query: 441 TKTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
           TKTGTFINSQGTG+KQ  NE PK NPF+ TQ+TG+P++++VPSHTGYGFGN
Sbjct: 463 TKTGTFINSQGTGFKQYSNE-PKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  174 bits (440), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 101/127 (79%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           M KQ +RSAKN+V GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  160 bits (405), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 75/94 (79%), Positives = 87/94 (92%), Gaps = 1/94 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L+ TRTGNQSI+DKY++LN LLA+GTGLDTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 451 LEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQV 510

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            +E PK+NPF++ QYTGLPSTN+VP+ TGYGFGN
Sbjct: 511 TSE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 103/130 (79%), Gaps = 3/130 (2%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ LRS KN+V GYS  QILVR+AT+N+E  PS+D ++++AE++Y +V+FFEI+ MLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFY---HVDESTGV 117
           KRL+DK K+W+HVAKSLTV D+L+R G+E CV W +ENLYL + L EF     +D +TG 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 118 DHGQIIRVKA 127
           D GQI+RV+A
Sbjct: 121 DQGQIVRVRA 130

 Score =  160 bits (404), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 110/172 (63%), Gaps = 18/172 (10%)

Query: 322 SGPNNPFSLENMHKLNSDGPQASGPYI--STAGGFPDRAXXXXXXXXXXXXXXXXXXXXX 379
           +G NNPFSL N++      PQ   P +  S++   PD +                     
Sbjct: 404 TGTNNPFSLSNIN-----NPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTN 458

Query: 380 HSSPVPQLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQ 439
            SS  PQ       P PQ+   RTGNQ I+DKY+ LNTLLA+GTG+DTFGNTG  RIPAQ
Sbjct: 459 ASSLPPQ-------PIPQM---RTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQ 508

Query: 440 HTKTGTFINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
           HT TGTFINSQGTGYKQ  N+ PK+NPF++ QYTGLPSTN+VPS+TGYGFGN
Sbjct: 509 HTATGTFINSQGTGYKQYIND-PKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  169 bits (427), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 101/127 (79%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKNV+ GYS  Q+LVR+ATSN+    ++D ++++A RSY +V+FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+W+H+ KSLTV D+LVR G+E CV W +ENLY+ + L EF + D+ TG+D G
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDD-TGIDQG 119

Query: 121 QIIRVKA 127
           QIIRVKA
Sbjct: 120 QIIRVKA 126

 Score =  160 bits (404), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 81/90 (90%)

Query: 402 RTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNEP 461
           RTGN+ IT+KYSELN LLA GTG+DTFGNTGQ RIPAQHTKTGTFINSQGTGYKQV NE 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 462 PKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
            K+NPF+ TQYTGLPS+N+VPS TGYGFGN
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFGN 478

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  160 bits (406), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 98/123 (79%), Gaps = 1/123 (0%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLS 64
           +LRSAKN+V GYS  ++LVR+AT+N    PS + +++LA++SY++VEFFEI+ MLDKR++
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHGQIIR 124
           DK K+WRHVAK+LTV D+LVR G+E CV W +ENLY+ + L EF H D + G D G+IIR
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED-AGGEDEGKIIR 119

Query: 125 VKA 127
           VKA
Sbjct: 120 VKA 122

 Score =  149 bits (377), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 88/106 (83%), Gaps = 4/106 (3%)

Query: 386 QLPRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGT 445
           + P  Q++P   L  TR+GNQ+I+DKYS LN LLASGTG+DTFGNTG+ RIPAQHT+TGT
Sbjct: 326 ETPATQTKP---LTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGT 382

Query: 446 FINSQGTGYKQVGNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
           FINSQGTGY+QV N+  K NPF+  QYTGLPSTN+VP+ TG+GFGN
Sbjct: 383 FINSQGTGYRQVNND-DKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  159 bits (403), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 72/89 (80%), Positives = 81/89 (91%)

Query: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460
           TRTGNQSI+DKY+ELN LLASGTG+DTFGNTG  RIPAQHT+TGTFINSQGTGYKQ+ N+
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGF 489
           P K NPF+  QYTGLPS+N+VPSHTGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

 Score =  157 bits (397), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/127 (55%), Positives = 98/127 (77%), Gaps = 2/127 (1%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MSKQ +RSAKN++ GYS  Q+LVR+ATSN+   PS + + E+++RS+ +V+FFEI+ MLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+DK K+W+H+AKSLTV D+LVR G+E CV W ++NLY+ + L EF   D++  VD  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN--VDES 118

Query: 121 QIIRVKA 127
            IIRVKA
Sbjct: 119 SIIRVKA 125

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  160 bits (404), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 97/127 (76%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MS+Q +RSAKNV+ GYS  Q+LVR+AT+N+   P +D +E++A  S+ +V+FFEI+ +L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           KRL+D  K+WRH+ KSLTV D+LVR G+E C DWAR++L+L + L  F  VD+  G D G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 121 QIIRVKA 127
           QI+RVKA
Sbjct: 121 QIVRVKA 127

 Score =  142 bits (359), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 84/106 (79%), Gaps = 5/106 (4%)

Query: 388 PRPQSQPGPQLQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFI 447
           P P  QP P++    TGNQ +T+KYSELN LLA GTG+DTFGN G  RIPAQHT+TGTFI
Sbjct: 484 PAPVPQPMPRMN---TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFI 540

Query: 448 NSQGTGYKQVGNE--PPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491
           NSQGTG+KQV +E   P  NPF+ +QYTGLPST +VP++TGYGFGN
Sbjct: 541 NSQGTGFKQVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  155 bits (393), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 71/123 (57%), Positives = 94/123 (76%), Gaps = 1/123 (0%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLS 64
           +LRSAKN+V GYS  Q LVR+ATSN    P +DQ+ ELAE +Y+ +EFFEI+ MLDKR++
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHGQIIR 124
            K K+W+HV KSL V D+LVR G+E CV W +ENLY+ + L EF + DES G+D GQ++R
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDES-GMDQGQMVR 119

Query: 125 VKA 127
           V+A
Sbjct: 120 VRA 122

 Score =  146 bits (368), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 71/95 (74%), Positives = 82/95 (86%), Gaps = 1/95 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           L+ TRTG+QSI+DKYS LNTLLA+GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 311 LKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQV 370

Query: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFGNA 492
                 +N F+ +QYTGLPS+N+VPS TGYGFGN+
Sbjct: 371 STNGF-NNVFLNSQYTGLPSSNIVPSQTGYGFGNS 404

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  159 bits (401), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 94/127 (74%), Gaps = 1/127 (0%)

Query: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60
           MS Q +RS KN+  GYSP Q+LVR+AT+N + G S+D +++L E SY   EF +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           +R+SDKPK+WRHVAKSLTV D+LVR G+E CV WAR+N      L +FY+ D S G+D G
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSD-SAGIDQG 119

Query: 121 QIIRVKA 127
           Q+IRVKA
Sbjct: 120 QLIRVKA 126

 Score =  112 bits (280), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/84 (67%), Positives = 62/84 (73%), Gaps = 1/84 (1%)

Query: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457
           LQP  TGN  I+ KYS LN LLA GTG+DTFGN G TRIPAQHTKTGTFINSQGTGYKQV
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 458 GNEPPKHNPFIATQYTGLPSTNMV 481
            +      P + TQYTGLP+   V
Sbjct: 651 TSSSSPI-PLLPTQYTGLPAQTAV 673

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 78/127 (61%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L+R GAE  +D  R NL L + L  F+++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 79/127 (62%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLSDKPKH-WRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K  + WR + K+L + ++L+  GAE  +D AR +L L R L  F++VD S G D G
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVD-SEGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 ANVRSRA 140

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 79/127 (62%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++A+ +Y+  E +EIV M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L++ G+E  +D  R +L L + L  F+++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYID-SEGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 78/127 (61%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+N+V  Y+  +  VR AT+NE +G S   ME++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L+R GAE  +D  R NL L + L  F+++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 78/127 (61%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  ++  +  VR AT+NE +G S   ME++A+ +Y+  E  E+++ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L+R G+E  +D  R  L + R L  F+++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 VNVRNRA 140

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 77/127 (60%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME +A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + ++LV+ G+E  +D  R NL L + L  F+++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 79/127 (62%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NV+  Y+  +  VR AT+NE +G S   M+++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + KSL +TD+L++ G+E  +D  R ++ L + L  F+++D S G D G
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R KA
Sbjct: 134 INVRNKA 140

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 77/127 (60%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + KSL + D+L+R G+E  +D  R ++ L   L  F+++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 78/127 (61%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           RL++K    WR + K+L + D+L+R  +E  +D  R ++ L + L  F+++D S G D G
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (60%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME+++  +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + ++L++ G+E  +D +R NL L + L  F++ D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTD-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 134 INVRNRA 140

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 78/127 (61%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NV+  Y+  +  VR AT+NE +G S   ME++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + ++L++ G+E  +D  R +L L + L  F+++D S G D G
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYID-SQGRDQG 133

Query: 121 QIIRVKA 127
             +R KA
Sbjct: 134 INVRNKA 140

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 77/127 (60%), Gaps = 2/127 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME +A+ +Y+  E  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + ++L++ G+E  +D  R ++ L + L  F++VD S G D G
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVD-SQGRDQG 168

Query: 121 QIIRVKA 127
             +R +A
Sbjct: 169 INVRTRA 175

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   M+++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L++ G+E  +D  R ++ L R L  F+++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYID-SQGRDQG 133

Query: 121 QIIRVK 126
             +R +
Sbjct: 134 INVRTR 139

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   M+++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L++ G+E  +D  R ++ L R L  F+++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYID-SQGRDQG 133

Query: 121 QIIRVK 126
             +R +
Sbjct: 134 INVRTR 139

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 74/124 (59%), Gaps = 2/124 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NV+  Y+  +  VR AT+NE +G S   M ++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R  +K    WR + KS+ + ++LV+ G+E  +D  R NL L R L  F+++D S G D G
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYID-SQGRDQG 133

Query: 121 QIIR 124
             +R
Sbjct: 134 INVR 137

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 76/124 (61%), Gaps = 2/124 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L++ G+E  +D  R ++ + + L  F+++D + G D G
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYID-AEGRDQG 133

Query: 121 QIIR 124
             +R
Sbjct: 134 INVR 137

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 76/124 (61%), Gaps = 2/124 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   ME++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + ++L++ G+E  +D  R ++ + + L  F+++D S G D G
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYID-SQGRDQG 133

Query: 121 QIIR 124
             +R
Sbjct: 134 VNVR 137

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 77/126 (61%), Gaps = 2/126 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   M+++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L++ G+E  +D  R ++ L + L  F+++D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYID-SQGRDQG 133

Query: 121 QIIRVK 126
             +R +
Sbjct: 134 INVRTR 139

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 76/126 (60%), Gaps = 2/126 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G S   M+++++ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R ++K    WR + K+L + D+L++ G+E  +D  R ++ L + L  F++ D S G D G
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTD-SQGRDQG 133

Query: 121 QIIRVK 126
             +R +
Sbjct: 134 INVRTR 139

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 71/124 (57%), Gaps = 2/124 (1%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+NVV  Y+  +  VR AT+NE +G     M ++A+ +Y+  E  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLSDK-PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120
           R  +K    WR + KS+ + ++L+  G+E  +D  R  L L + L  F+++D S G D G
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYID-SQGRDQG 133

Query: 121 QIIR 124
             +R
Sbjct: 134 INVR 137

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 8/110 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEY-GPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           LL++ +N+  G S  ++  RNAT+++E+ G +   M EL+  +YS     EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  S-----DKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
           S        K+  H+ K+LT+  +L+  G++  V W R  LYL   L EF
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 61/110 (55%), Gaps = 8/110 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEY-GPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           LLR+ ++   G S  +I  +NAT+++EY G +   M E++  +YS+    EI  ++ KRL
Sbjct: 3   LLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRL 60

Query: 64  S-----DKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
           S        K+  H+ K+LT+T +L+  G+   V W R  +YL   L EF
Sbjct: 61  SGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 15  GYSPAQILVRNATSNEEY-GPSMDQMEELAERSYSAVEFFEIVVMLDKRLS---DKPKHW 70
           G SP    VR AT + E+ G S   + E+   +YS     ++  +L KRLS   +K  H 
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 71  R--HVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
              H+ K+LT+T++L+  G+E  V W +    L RRL +F
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDF 110

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 8/110 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEY-GPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
            +RS +N+  G S  ++ V+ AT ++EY G +   M E++  +YSA    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  S---DKPKHWR--HVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
           S    K  H    H+ K+LT+  +L+  G+   V W R+  YL   L EF
Sbjct: 61  SGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 8/110 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEY-GPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           L  S +N V   SP +  VR AT ++E  G +   M E++  +YS     EIV +L KRL
Sbjct: 3   LFDSVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRL 60

Query: 64  S-----DKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
           +     +  K+  H+ K+LT+  +L+  G+   + W R N+ LF  L  F
Sbjct: 61  TGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNF 110

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 8/115 (6%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATS-NEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           +  S +N V   + A+  V+ AT  NE  G +   M E++  +YS     EI+ +L KRL
Sbjct: 3   IFDSVRNFVQSATEAK--VKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRL 60

Query: 64  ---SDKPKH--WRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDE 113
              S K  H    H+ K++T+  +L+  G+   + WAR N+ +F  L +F  + E
Sbjct: 61  TGSSKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHE 115

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATS-NEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           +  S +N V   SP ++ VR AT  NE  G +   M E++  +YS     EIV +L KRL
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 64  S---DKPKH--WRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
           +    K  H    H+ K+LT+  +L+  G+   + W  EN  LF  +  F
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNF 110

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 15  GYSPAQILVRNATSNEEY-GPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDK-----PK 68
           G S   + V+ AT + E+ G     M E+A  +YS     EI  +L KRL         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 69  HWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
              ++ K+LT+  FLV  G+E C+ W R +L L R   +F
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDF 110

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 2   SKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDK 61
           +K+  R A+N +   +  +  VR AT+N+ +G S+  M ++   ++   +  +I+ ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLSDKP-KHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDE 113
           R  +K    WR + KS+ +  +L+  G+   V   + NL L + L  F  +D+
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDD 127

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 15  GYSPAQILVRNAT-SNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWR-- 71
           G S  Q+ V+ AT SNE YG +   M EL+  +YS     EI  ++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHGQIIRVK 126
                 V K+LT+ ++L+  G+E  V W R +L     L + YH   S   D  ++ ++K
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKD-YHC--SNDKDKSKVKQIK 127

Query: 127 A 127
           +
Sbjct: 128 S 128

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 13  VNGYSPAQILVRNATS-NEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD-----K 66
           V G S  ++ VR AT+ +E+ G +   M E++  +YS     EI  +L +RLS       
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 67  PKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRL 105
            K+  H+ K+LT+  +L+  G+E  V W R NL  F  L
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECL 107

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 62/126 (49%), Gaps = 9/126 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNAT-SNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           LL S + +V   S  ++ V+ AT  NE  G +   M E++  +YS     EIV ++ KRL
Sbjct: 3   LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRL 60

Query: 64  -----SDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVD 118
                 +  K   H+ K+LT+  +L+  G+   + W R N+ L   L EF +V +     
Sbjct: 61  MGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEF-NVQDRNDEK 119

Query: 119 HGQIIR 124
            GQ IR
Sbjct: 120 IGQQIR 125

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 51/98 (52%), Gaps = 6/98 (6%)

Query: 17  SPAQILVRNATS-NEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLS-----DKPKHW 70
           SP ++ VR AT  NE  G +   M E++  +YS     +++ ++ KRLS     +  +  
Sbjct: 13  SPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRNSHRTC 72

Query: 71  RHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEF 108
            HV K+LT+  +L+  G+   + W + + Y+   L+ F
Sbjct: 73  LHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 11/112 (9%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATS-NEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           L  + KN V   +P +  V+ AT  NE  G +   M E++  +YS     +I+ ++ KRL
Sbjct: 3   LFDTVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 64  SDKP---KHWRH-----VAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTE 107
           S      K   H     + K+LT+  +L+  G+   ++W R N YL   +T+
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITK 112

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P QI VR AT+ + +GP+   +E++  R+   V  + +   + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVM-RNRFQVPMYLVTEYILKRLIDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              KPK+               WR V K LTV ++L+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 31/150 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEE-LAERSYSAVEFFEIVVMLDKRLSD 65
           R A+N++  Y P QI +R AT+ + +GP+   +++ L +R  + V   +IV  + KRL D
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQILLDR--NKVPLRKIVDYIMKRLMD 78

Query: 66  ----KPKH---------------WRHVAKSLTVTDFLVRT-----GAETCVDWARENLYL 101
               +P++               WR V KSL V  FL+         +  V++   +   
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNHYGF 138

Query: 102 FRR-LTEFYHVDEST-GVD--HGQIIRVKA 127
           F+  + E Y V  S+ G D  H ++I++K 
Sbjct: 139 FKHDILEIYQVQNSSDGKDSKHQEVIQLKC 168

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 20/102 (19%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V  + +V    KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRYQ-VPLYLMVEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLVRTGAE 89
              +PK+               WR V K L V DFL+   +E
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSE 121

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 31/132 (23%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+N++  Y P QI +R AT+ + +GP+   ++++    Y    +     +L KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKYHVPVYLMTEYIL-KRLIDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAE-----TCVDWARENL 99
              KPK+               WR V K L + +FL   V  G E     TC+   ++++
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLLMNVSDGDELHQVLTCL---KKHI 136

Query: 100 YLFRRLTEFYHV 111
           ++  R T  Y +
Sbjct: 137 HILSRETTTYRI 148

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ VR AT+ + +GP+  QM ++  R  + V  + I     KRL D 
Sbjct: 21  RFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              +PK+               WR V K L V +FL+
Sbjct: 80  MAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   ++++    Y  V  + +V    KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRYQ-VPLYLMVEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              KPK+               WR V K LTV ++L+
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLM 116

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 52/107 (48%), Gaps = 8/107 (7%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEE-YGPSMDQMEELAERSYSAVEFFEIVVMLDKRL 63
           L  + K+ V   SP +  V+ AT+ +E  G +   M E++  +YS     EIV +L KRL
Sbjct: 3   LFETVKSFVQ--SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRL 60

Query: 64  SDKPKHWRH-----VAKSLTVTDFLVRTGAETCVDWARENLYLFRRL 105
           S   +   H     + K+LT+  +L+  G+   V W R N  L   L
Sbjct: 61  SGYSRKTSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNL 107

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 20/96 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P QI +R AT+ + +GP+   + ++    Y  V  + +   + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRYQ-VPLYLMTEYILKRIVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL 83
              +PK+               WR V K L V DFL
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFL 115

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V  + +   + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRYQ-VPMYLMTEYILKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              +PK+               WR V K LTV +FL+
Sbjct: 80  IATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 17/125 (13%)

Query: 5   LLRSAKNVVNGYSPAQILVRNATSNEEYGPSMD--QMEELAERSYSAVEFFEIVVMLDKR 62
           L  S +N VN  S  ++ V+ AT + E   S     M E++  +YS     EI  +L KR
Sbjct: 3   LFDSVRNFVN--STTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKR 60

Query: 63  ---LSDKPKHWRH-----VAKSLTVTDFLVRTGAETCVDWARENLYLFRRL-----TEFY 109
              +S  P+   H     V K+LT+  FL+  G+   V W + N+  F  L     TEF 
Sbjct: 61  FHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFS 120

Query: 110 HVDES 114
             D++
Sbjct: 121 FTDKA 125

>TPHA0A01500 Chr1 (293819..295042) [1224 bp, 407 aa] {ON} Anc_8.335
           YDR153C
          Length = 407

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R  +N++  Y P QI +R AT+ + +GP+   +E++    Y  V  F +   + KR+ D 
Sbjct: 21  RFMQNMLVQYEPYQIDIRRATNTDSWGPTTKHLEKVIRNKYQ-VPLFLMTEYILKRIIDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              KPK+               WR + K L V +FL+
Sbjct: 80  IAKKPKNLYEKARKEYVNYGAEWRVILKCLVVLEFLM 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+N++  Y P Q+ VR AT+ + +GP+   +E++    Y  V  + I     KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRYQ-VPMYLITEYTLKRLIDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              +PK+               WR V K LTV ++L+
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 20/102 (19%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+N++  Y P QI +R AT+ + +GP+   +E++    Y  V  + +     KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRYQ-VPLYLLTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLVRTGAE 89
              +PK+               WR V K L V +FL+   A+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVAD 121

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ VR AT+ + +GP+   + ++    Y  V  + I   + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRYQ-VPLYLITEYILKRLIDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              +PK+               WR V K L V ++L+
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 25/133 (18%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P QI +R AT+ + +GP+   + ++    Y    F      L KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTL-KRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLVR---TGAET--CVDWARENLYLF 102
              +PK+               WR V K L + ++L+     G ET   +   + + ++ 
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHIL 139

Query: 103 RRLTEFYHVDEST 115
            + T  Y VD S+
Sbjct: 140 TKETMQYRVDFSS 152

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 23/105 (21%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P QI +R AT+ + +GP+   + ++    Y  V  + +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRYQ-VPLYLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAE 89
              +PK+               WR V K L V +FL   V TG E
Sbjct: 80  IATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLLLNVDTGDE 124

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 48/105 (45%), Gaps = 23/105 (21%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P QI +R AT+ + +GP+   + ++    Y  V  + +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRYQ-VPLYLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAE 89
              +PK+               WR V K L V +FL   V TG E
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVDTGDE 124

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 23/105 (21%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V  + +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRYQ-VPLYLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAE 89
              +PK+               WR V K L V +FL   V TG E
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLLLNVDTGDE 124

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    ++ +   + S  +F+EIV  L+ R++D    W  V KSL V  
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  FLVRTGAETCVDWARENLYLFRRLTEFYHVDESTG 116
            ++R GA+         L  + R  EF+ ++   G
Sbjct: 65  LMIREGAKDVA------LRYYSRNLEFFDIENIRG 93

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 8/95 (8%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    ++ +   + S  +F+EIV  LD R++D    W  V K+L V  
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  FLVRTGAETCVDWARENLYLFRRLTEFYHVDESTG 116
            ++R G +         L  + R  EF+ ++   G
Sbjct: 65  LMMREGKKDVA------LRYYSRNLEFFSIENIRG 93

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V  + +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRYQ-VPLYLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              +PK+               WR V K L V +FL+
Sbjct: 80  IASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    ++ +   S    +F EI+  L  R+SD    W  V KSL VT 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  FLVRTG-AETCVDWARENLYLF 102
            L+R G  +  +D+   NL  F
Sbjct: 65  LLIREGEKDITLDYLSNNLDFF 86

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 8/95 (8%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    ++ +   + +  +F+EIV  LD R++D    W  V KSL V  
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  FLVRTGAETCVDWARENLYLFRRLTEFYHVDESTG 116
            ++R G++         L  + R  EF+ ++   G
Sbjct: 65  LMIREGSKDVA------LRYYSRNLEFFDIENIRG 93

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 49/102 (48%), Gaps = 20/102 (19%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R  +N++  Y P QI +R AT+ + +GP+   ++++    YS V  + +   + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYS-VPLYLMTEYVLKRIVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLVRTGAE 89
              +PK+               WR + K L V ++L+   +E
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSE 121

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 49/103 (47%), Gaps = 14/103 (13%)

Query: 8   SAKNVVNGYSPAQILVRNATS-NEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLS-- 64
           S +N+V  YS  ++ VR AT  NE    +   M E++  +YSA    EI+ +L K+LS  
Sbjct: 6   SVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKLSLL 63

Query: 65  ---------DKPKHWRHVAKSLTVTDFLVRTGAETCVDWAREN 98
                       K    V K+ T+  +L+  G+   ++W + N
Sbjct: 64  YGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLN 106

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDK 66
           R  +N++  Y P QI VR A++ + +GP+   ++++    YS V  + I     KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKYS-VPLYLITEYTLKRLIDH 79

Query: 67  P-------------------KHWRHVAKSLTVTDFLV 84
                                 WR V K L + DFL+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>KAFR0E02180 Chr5 complement(432775..434613) [1839 bp, 612 aa] {ON}
           Anc_5.84 YGR241C
          Length = 612

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    ++ +   S S  +F EIV  L  RLSD    W  V K++ V  
Sbjct: 7   LVKGATKIKLAPPKQKYIDPILLGSASPRDFQEIVSALSSRLSDTA--WTVVYKTIIVIH 64

Query: 82  FLVRTG-AETCVDWARENLYLFR 103
            L+R G  +  +++  E+L +F+
Sbjct: 65  LLIREGEKDRTLEYFSEDLSVFQ 87

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 23/106 (21%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V    +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAET 90
              +PK+               WR V K L V ++L   V +G+E 
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEV 125

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V    +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFLV 84
              +PK+               WR V K L V ++L+
Sbjct: 80  IASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLL 116

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 58/132 (43%), Gaps = 25/132 (18%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+N++  Y P Q+ +R AT+ + +GP+   + ++    +  V  + +   + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVMRNRFQ-VPLYLMTEYILKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAET--CVDWARENLYLF 102
              +PK+               WR V K L + + +   V  G E    V+    + ++ 
Sbjct: 80  IATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHMLLNVDVGNELDQVVNCILTHKHIL 139

Query: 103 RRLTEFYHVDES 114
            R    YHVD S
Sbjct: 140 TRDIMQYHVDFS 151

>TDEL0G01080 Chr7 (220997..222544) [1548 bp, 515 aa] {ON} Anc_5.84
           YGR241C
          Length = 515

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    +E +   +    EF EIV  LD R+SD    W  V KSL V  
Sbjct: 7   LVKGATKIKMAPPKPKYIEPILLGTTDPAEFREIVRALDTRISDTA--WTIVYKSLIVVH 64

Query: 82  FLVRTGAE-TCVDWARENLYLFR 103
            + R G     + +  ++L  F+
Sbjct: 65  LMFRDGDRNVAIRYYSDHLSFFQ 87

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 23/106 (21%)

Query: 7   RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSD- 65
           R A+NV+  Y P Q+ +R AT+ + +GP+   + ++    Y  V    +     KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVDH 79

Query: 66  ---KPKH---------------WRHVAKSLTVTDFL---VRTGAET 90
              +PK+               WR V K L V ++L   V +G+E 
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEV 125

>NCAS0D01460 Chr4 (276159..278195) [2037 bp, 678 aa] {ON} Anc_5.84
           YGR241C
          Length = 678

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    ++ +   + +  EF EIV  L  R+SD    W  V KS+ V  
Sbjct: 7   LVKGATKIKLAPPKQKYIDPILLGTANPSEFNEIVRALGTRISDTA--WTIVYKSVIVVH 64

Query: 82  FLVRTG-AETCVDWARENLYLF 102
            L+R G     +D+  ++L  F
Sbjct: 65  LLIREGDRNVALDYFADDLEFF 86

>NDAI0C03280 Chr3 complement(745118..747277) [2160 bp, 719 aa] {ON}
           Anc_5.84 YGR241C
          Length = 719

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 3/82 (3%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P +  +E +   S    +F EI+  L+ R+SD    W    KS+ +  
Sbjct: 7   LVKGATKIKLAPPKLKYIEPILLGSADPNDFREIIRALEARISDSA--WTIAYKSVIMVH 64

Query: 82  FLVRTGAE-TCVDWARENLYLF 102
            L+R G +   +D+   +L  F
Sbjct: 65  LLIREGDKNVTLDYLSNDLDFF 86

>ZYRO0F13508g Chr6 complement(1114200..1116263) [2064 bp, 687 aa]
           {ON} weakly similar to uniprot|P53309 Saccharomyces
           cerevisiae YGR241C YAP1802 Yeast Assembly Polypeptide,
           member of AP180 protein family, binds Pan1p and
           clathrin; member of clathrin assembly polypeptide AP180
           family and weakly similar to uniprot|P38856
           Saccharomyces cerevisiae YHR161C YAP1801 Yeast Assembly
           Polypeptide member of AP180 protein family binds Pan1p
           and clathrin clathrin assembly protein
          Length = 687

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 47/125 (37%), Gaps = 34/125 (27%)

Query: 22  LVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDKPKHWRHVAKSLTVTD 81
           LV+ AT  +   P    +E +   +    +F EI   LD+R+SD    W  V KSL +  
Sbjct: 7   LVKGATKIKMAPPKQKYVEPILLGTTDPHDFSEIAKALDERISDTA--WTIVYKSLMLLH 64

Query: 82  FLVRTGAE--------------------TCVDWA--------RENLYLFRRLTEFYHVDE 113
            ++R G +                     C  W+        R N YL  R  E+  +  
Sbjct: 65  LMIREGEKNVALKYYGGHTSFFDLNEISKCAKWSSADIRALERYNHYLKVRCQEYAQI-- 122

Query: 114 STGVD 118
             GVD
Sbjct: 123 --GVD 125

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 34.7 bits (78), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 7/69 (10%)

Query: 7  RSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLDKRLSDK 66
          R A+N++  Y P Q+ +R AT+ + +GP+  Q+ ++    Y  V  + I     KRL D 
Sbjct: 21 RFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRYQ-VPMYLITEYTMKRLVD- 78

Query: 67 PKHWRHVAK 75
               H+AK
Sbjct: 79 -----HMAK 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,507,958
Number of extensions: 1505899
Number of successful extensions: 4749
Number of sequences better than 10.0: 112
Number of HSP's gapped: 4745
Number of HSP's successfully gapped: 139
Length of query: 515
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 401
Effective length of database: 40,409,475
Effective search space: 16204199475
Effective search space used: 16204199475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)