Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL156WsingletonON1511518031e-111
ZYRO0G19426g8.157ON1594130637.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL156W
         (151 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL156W Chr3 (81019..81474) [456 bp, 151 aa] {ON} NOHBY309; No h...   313   e-111
ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa...    29   7.1  

>ACL156W Chr3 (81019..81474) [456 bp, 151 aa] {ON} NOHBY309; No
           homolog in Saccharomyces cerevisiae
          Length = 151

 Score =  313 bits (803), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/151 (100%), Positives = 151/151 (100%)

Query: 1   MLAEPVYKPLFSYVIPEVPSTALHNANDSFLTTLHRPGNKRSCDLIVIFNDDHAWLWQHA 60
           MLAEPVYKPLFSYVIPEVPSTALHNANDSFLTTLHRPGNKRSCDLIVIFNDDHAWLWQHA
Sbjct: 1   MLAEPVYKPLFSYVIPEVPSTALHNANDSFLTTLHRPGNKRSCDLIVIFNDDHAWLWQHA 60

Query: 61  PQNKSRYRWSRDTYSVQGVENTKTTVLHLVLCARRFVSVMSSFLHSRVASRVWRYTALKS 120
           PQNKSRYRWSRDTYSVQGVENTKTTVLHLVLCARRFVSVMSSFLHSRVASRVWRYTALKS
Sbjct: 61  PQNKSRYRWSRDTYSVQGVENTKTTVLHLVLCARRFVSVMSSFLHSRVASRVWRYTALKS 120

Query: 121 SFVLLRAASLQPMAASEAAVARAKCSYLTGQ 151
           SFVLLRAASLQPMAASEAAVARAKCSYLTGQ
Sbjct: 121 SFVLLRAASLQPMAASEAAVARAKCSYLTGQ 151

>ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa]
            {ON} weakly similar to uniprot|P53094 Saccharomyces
            cerevisiae YGL197W MDS3 Protein with an N-terminal kelch-
            like domain putative negative regulator of early meiotic
            gene expression required with Pmd1p for growth under
            alkaline conditions
          Length = 1594

 Score = 28.9 bits (63), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 53/130 (40%), Gaps = 10/130 (7%)

Query: 1    MLAEPVYK-PLFSYVIPEVPSTALHNANDSFLTT---LHRPGNKRSCDLIVIFNDDHAWL 56
            ++   VY+ PL S +I EV  + +    DS   T   L     KR   L   FN+D +W+
Sbjct: 1019 LIMSKVYEIPLLSDLINEVIYSIIGRKEDSLFVTCNFLMEAIKKR---LRNNFNEDESWI 1075

Query: 57   WQHAPQNKSRYRWSRDTYSVQGVENTKTTVLHLVLCARRF---VSVMSSFLHSRVASRVW 113
               A +N++     +  +S++ V+N    +  L   +R      +    F H  +     
Sbjct: 1076 EAQAYRNENYMELEKLKHSLENVDNGYVDINLLKRVSRSLSMSTNESEDFAHDHIGGNDS 1135

Query: 114  RYTALKSSFV 123
              T +  S +
Sbjct: 1136 SGTPVGGSHI 1145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.130    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,069,454
Number of extensions: 573512
Number of successful extensions: 1516
Number of sequences better than 10.0: 4
Number of HSP's gapped: 1516
Number of HSP's successfully gapped: 4
Length of query: 151
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 51
Effective length of database: 42,014,799
Effective search space: 2142754749
Effective search space used: 2142754749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)