Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL155W7.343ON69769733830.0
Kwal_56.246167.343ON71570622580.0
SAKL0F10912g7.343ON69369522190.0
KLLA0D12496g7.343ON70061121940.0
KLTH0H01408g7.343ON72371521890.0
CAGL0I03410g7.343ON72470221840.0
TDEL0C020407.343ON70569621500.0
KNAG0C037407.343ON72770621210.0
NCAS0A141107.343ON75374321230.0
Kpol_2001.717.343ON72669721170.0
NDAI0A019407.343ON76560721180.0
ZYRO0F11572g7.343ON73160720860.0
YDL164C (CDC9)7.343ON75572020800.0
Smik_4.747.343ON84561020820.0
Skud_4.937.343ON75562420680.0
Suva_4.827.343ON75561020650.0
KAFR0B008307.343ON71069420520.0
TPHA0D045707.343ON73671519800.0
TBLA0E020507.343ON72069219680.0
YOR005C (DNL4)6.18ON9444112744e-24
TDEL0G045106.18ON9692352727e-24
ZYRO0C07854g6.18ON9443992728e-24
Kwal_56.224146.18ON9632602719e-24
TPHA0M002606.18ON9662322691e-23
Smik_15.1746.18ON9452372692e-23
Skud_15.1666.18ON9472352664e-23
TBLA0G010406.18ON9722352631e-22
CAGL0E02695g6.18ON9462422558e-22
KNAG0F028706.18ON9543792531e-21
Suva_15.1806.18ON9484122512e-21
KLTH0C11286g6.18ON9512402469e-21
Kpol_1032.76.18ON9652302432e-20
KLLA0D01089g6.18ON9073002432e-20
NCAS0D026506.18ON9502392397e-20
ACR008W6.18ON9812372371e-19
KAFR0A050506.18ON9483642343e-19
NDAI0I022606.18ON9672982244e-18
TBLA0F004907.460ON119564800.53
NCAS0G034101.506ON1056182752.3
Kwal_27.100121.506ON1018123709.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL155W
         (697 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...  1307   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   874   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   859   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   849   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   847   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   845   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   832   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   821   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   822   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   820   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   820   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   808   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   805   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   806   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   801   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   800   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   795   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   767   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   762   0.0  
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   110   4e-24
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   109   7e-24
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   109   8e-24
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...   108   9e-24
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   108   1e-23
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   108   2e-23
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...   107   4e-23
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   105   1e-22
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...   102   8e-22
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...   102   1e-21
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...   101   2e-21
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    99   9e-21
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    98   2e-20
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    98   2e-20
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    97   7e-20
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    96   1e-19
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    95   3e-19
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    91   4e-18
TBLA0F00490 Chr6 (128506..132093) [3588 bp, 1195 aa] {ON} Anc_7....    35   0.53 
NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1....    33   2.3  
Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa] ...    32   9.1  

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score = 1307 bits (3383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/697 (92%), Positives = 642/697 (92%)

Query: 1   MSAPKKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPEL 60
           MSAPKKQATLGRFFTALKRPQDG                CLAAPAGHEQDAEVKNSLPEL
Sbjct: 1   MSAPKKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPEL 60

Query: 61  ADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCAD 120
           ADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCAD
Sbjct: 61  ADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCAD 120

Query: 121 FMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSY 180
           FMYSVLKCDPGHLIPVTYLFINRLGPDYEP            KTISDACGKSAAQVRSSY
Sbjct: 121 FMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSY 180

Query: 181 RECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTA 240
           RECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTA
Sbjct: 181 RECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTA 240

Query: 241 CQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTF 300
           CQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTF
Sbjct: 241 CQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTF 300

Query: 301 CQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEY 360
           CQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEY
Sbjct: 301 CQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEY 360

Query: 361 KYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDN 420
           KYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDN
Sbjct: 361 KYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDN 420

Query: 421 EKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLK 480
           EKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLK
Sbjct: 421 EKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLK 480

Query: 481 VVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLK 540
           VVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLK
Sbjct: 481 VVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLK 540

Query: 541 KDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQ 600
           KDYLEGVGDSLDLAVL               FLLGCYNPDLEEFETCCKIGTGFSEEVLQ
Sbjct: 541 KDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEEVLQ 600

Query: 601 SLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGI 660
           SLHAQLKDTVIAAPRG            WFEPAMLFEVLTADLSLSPVYKAGRDVYGKGI
Sbjct: 601 SLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGI 660

Query: 661 SLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSSG 697
           SLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSSG
Sbjct: 661 SLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSSG 697

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/706 (61%), Positives = 522/706 (73%), Gaps = 13/706 (1%)

Query: 1   MSAPKKQATLGRFFTALKR-------PQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEV 53
           MS+ KKQATL +FF++ KR       PQ+                   + P   E + E 
Sbjct: 9   MSSAKKQATLAKFFSSKKRSNDEKEGPQESAKKSQLNAIDAKPESSKGSQPNVDETNHET 68

Query: 54  KNSLPEL-ADKPAPGGVLPQAASAVPRAQSSPVKPAAS----TSVMYADLCAVFEAVEAT 108
               P+L A +P     +  A  AV ++     K   S    ++VMY+++C+VF  +E T
Sbjct: 69  LQK-PQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSVFNEIEGT 127

Query: 109 SSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDA 168
           SSRL I KLC+DF+YSVL      L+P+TYL IN+LGPDY+P            KTIS++
Sbjct: 128 SSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLLMKTISES 187

Query: 169 CGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQG 228
           CGKS  QV++ YRE GDLG +AQ+AR VQPTMFKPKPLT   VF+ LQ IA+A+GKDSQ 
Sbjct: 188 CGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARAQGKDSQL 247

Query: 229 KKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQ 288
           +K++LIKKMLTAC+G+EAK+LIRSLESKLRIGLAEK+VLVALSKAILTHEH GKEPS + 
Sbjct: 248 RKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEHGGKEPSSDL 307

Query: 289 VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVL 348
           VDAAE  +RD FCQVPNYE++INAAL++GIM L +HCVLTPGIPLKPMLAKP+KSI+EVL
Sbjct: 308 VDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKPSKSISEVL 367

Query: 349 DRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRS 408
           DRFQGQRFTCEYKYDGERAQVHL+ DG++RIYSRN ENMTERYPEI    F+A+P  T +
Sbjct: 368 DRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFVAHPDETHT 427

Query: 409 LIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSL 468
           LI+DCEAVAWD +K  ILPFQVLSTRKRKGV  +DVKVRVCLFAFD+L  N E L+  SL
Sbjct: 428 LILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDILCYNDEPLINKSL 487

Query: 469 ADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYE 528
           A+RR +L  +LK VPGELQ A+E+TTM L E+Q YL+QSV   CEGLMVK+LDGEES YE
Sbjct: 488 AERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLMVKVLDGEESHYE 547

Query: 529 PSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCC 588
           PSKRSRNWLKLKKDYL+GVGDSLDL VL               FLLGCYN D  EFETCC
Sbjct: 548 PSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCC 607

Query: 589 KIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPV 648
           KIGTGFS+E+LQ+L+ +L  T I  P+             W EP+MLFEVLTADLSLSPV
Sbjct: 608 KIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLFEVLTADLSLSPV 667

Query: 649 YKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           YKAG   YGKGISLRFPRF+RIR+DKSV DATSS+Q++EFY+ Q++
Sbjct: 668 YKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSH 713

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/695 (60%), Positives = 515/695 (74%), Gaps = 21/695 (3%)

Query: 5   KKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPELADKP 64
           KKQ TL RFF++ K+  +                     P       +  N+  EL    
Sbjct: 12  KKQVTLARFFSSAKKGGNKEDKL---------------EPQAKRAKVDPANT-SELITNE 55

Query: 65  APGGVLPQAASAVPRA----QSSPV-KPAASTSVMYADLCAVFEAVEATSSRLSITKLCA 119
           A    +      VP A     S+PV  P   + + Y+D+C +F  +E+TSSRLSI K+C+
Sbjct: 56  AVARSVSPPTPVVPVAPIISTSTPVMAPVHHSKIPYSDVCNIFSEIESTSSRLSIVKICS 115

Query: 120 DFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSS 179
           +F YSVLK +P +L+P+TYLFINRLGPDYEP            KTI+++CGKS  QVR+ 
Sbjct: 116 NFFYSVLKQNPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAK 175

Query: 180 YRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLT 239
           YRE GDLG VAQ+AR VQPTMFKPKPLTV +VF+ L++IA+++GKDSQ +KI+LIK+MLT
Sbjct: 176 YREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLT 235

Query: 240 ACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDT 299
           ACQG+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L++EHDG+EPS E V+ AE  VRD 
Sbjct: 236 ACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHDGEEPSSELVENAEQRVRDA 295

Query: 300 FCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCE 359
           FCQVPNYE++IN  L++GIM + +HCVL PGIPLKPMLAKP+KSITEVLDRF G++FTCE
Sbjct: 296 FCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCE 355

Query: 360 YKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWD 419
           YKYDGERAQVHL+ DG++ IYSRN ENMTERYPE+    +LA+P+TT SLI+DCEAVAWD
Sbjct: 356 YKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTHSLILDCEAVAWD 415

Query: 420 NEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVL 479
            E+ KILPFQ+LSTRKRKGVE KDVKVRVCLFAFD+L  NG+SL+  SL +RR++L  VL
Sbjct: 416 TEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVL 475

Query: 480 KVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKL 539
           K V G+ QFANE+ +  L ++Q YLEQSV  +CEGLMVK+L+GEES YEPSKRSRNWLKL
Sbjct: 476 KPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKL 535

Query: 540 KKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVL 599
           KKDYL+GVGDSLDL VL               FLLGCYN D  EFETCCKIGTGFS+E+L
Sbjct: 536 KKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEML 595

Query: 600 QSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKG 659
            SL+ +LK + +  P+             WFEP MLFEVLTADLSLSP+YKAG   YGKG
Sbjct: 596 VSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKG 655

Query: 660 ISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           ISLRFPRF+RIR+DK V DATSS+QIVE Y+ Q N
Sbjct: 656 ISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVN 690

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/611 (66%), Positives = 479/611 (78%)

Query: 84  PVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINR 143
           P K    +++ +A+LC  F+A+E TSSRL+IT +C+ F+YSVL+ DP  L+P+TYLFI++
Sbjct: 88  PSKLKFHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHK 147

Query: 144 LGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKP 203
           LGPDYEP            KTIS+ACGKS  Q+R+ YRE GDLG +A QAR VQPTMFKP
Sbjct: 148 LGPDYEPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKP 207

Query: 204 KPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAE 263
           KPLTV +VF+ L +IA++ GKDSQ +K  LIKKMLTAC+G EAK+LIRSLESKLRIGLAE
Sbjct: 208 KPLTVGEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAE 267

Query: 264 KTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQ 323
           KTVL+++SKAILTHEH+G+EPS E V+ AE+L+RD FCQVPNYEMIIN ALQYGIMNL Q
Sbjct: 268 KTVLISVSKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 324 HCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRN 383
           H  L PGIPL+PMLAKPTKSI+EVLDRFQG +FTCEYKYDGERAQVHL  DG+++IYSRN
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387

Query: 384 SENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKD 443
            E+MTERYPEI    ++ +   T+S I+D EAVAWD E+ KILPFQVLSTRKRKGVELKD
Sbjct: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447

Query: 444 VKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTY 503
           VKVRVCL+AFD+L LN E L+  S  +RR+ L        G+  FANE+TT    ELQ Y
Sbjct: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507

Query: 504 LEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXX 563
           L+QSV  SCEGLMVKML+GEES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRG 567

Query: 564 XXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXX 623
                   FLLGCYN D EEFETCCKIGTGFS+E+LQ L+ +LKDT +  P         
Sbjct: 568 KRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627

Query: 624 XXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSD 683
                WFEP+MLFEVLTADLSLSPVYKAG + +GKGISLRFPRF+RIR+DK+VTDATSSD
Sbjct: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687

Query: 684 QIVEFYQRQAN 694
           Q++EFY+ QA+
Sbjct: 688 QVIEFYESQAH 698

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/715 (59%), Positives = 514/715 (71%), Gaps = 19/715 (2%)

Query: 1   MSAPKKQATLGRFFTALKRPQDGXXXXXXXXXXXX----------XXXXCLAAPAGHEQD 50
           MS+ KKQATL +FF++ KR  +                            LA  +     
Sbjct: 9   MSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGSSDAGS 68

Query: 51  AEVKNSLPELADKPAPGG-VLPQ----AASAVPRAQSSPVKPAAS----TSVMYADLCAV 101
            +V+ S     +    G   LP     A  AV   +  P K  AS    + ++YA++C V
Sbjct: 69  VKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKDSKILYAEMCNV 128

Query: 102 FEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXX 161
           F  +E TSSRL I KLC DF+YSVL      ++P+TYL IN+LGPDY+P           
Sbjct: 129 FNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLELGLGEGLL 188

Query: 162 XKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQA 221
            KTIS++CGKS  Q+++ YRE GDLG +AQ+AR VQPTMFKPKPLT  +VFS LQAIA++
Sbjct: 189 MKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARS 248

Query: 222 EGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDG 281
           +GKDSQ +K++LIK+MLTACQG+EAK+LIRSLESKLRIGLAEK+VLVALSKA+LT+EH+G
Sbjct: 249 QGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNG 308

Query: 282 KEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPT 341
           KEPS E VD AE  +RD FCQVPNY+++I  AL++GIM L +HCVLTPGIPLKPMLAKP+
Sbjct: 309 KEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPS 368

Query: 342 KSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLA 401
           KSI+EVLDRFQGQRFTCEYKYDGERAQVHL+ DG++RIYSRN ENMTERYPEI+   F+A
Sbjct: 369 KSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIA 428

Query: 402 NPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGE 461
           +P  T +LI+DCEAVAWD EK  ILPFQVLSTRKRKGV ++DVKVRVCLFAFD+L  N E
Sbjct: 429 DPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDE 488

Query: 462 SLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLD 521
            L+   LA+RR  L   L  VPGELQ A+E+TTM L ELQ YL+Q+V   CEGLMVK+L+
Sbjct: 489 PLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILE 548

Query: 522 GEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDL 581
           GEES YEPSKRSRNWLKLKKDYL+GVGDSLDL VL               FLLGCYN D 
Sbjct: 549 GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDS 608

Query: 582 EEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTA 641
            E+ETCCKIGTGFSEE+LQ+L  +L  T I  P+             WFEP +LFEVLTA
Sbjct: 609 GEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTA 668

Query: 642 DLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696
           DLSLSPVYKAG   YGKGISLRFPRF+R+R+DK+  +ATSS+Q+VEFY+ Q++ S
Sbjct: 669 DLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/702 (60%), Positives = 502/702 (71%), Gaps = 20/702 (2%)

Query: 5   KKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPELADKP 64
           K+QATL RFF+++K+  DG                       HE DA   N  P    K 
Sbjct: 28  KRQATLARFFSSVKKDADGDKKGEQADVKTAAVDL-----NSHEVDA---NKSPLKKMKL 79

Query: 65  APGGVLPQAASAVPRAQSSPVKPAAST----------SVMYADLCAVFEAVEATSSRLSI 114
              G L    +     +     P AST           V Y+DLC +FE +E TSSRL+I
Sbjct: 80  ESTGSLTATKNGNQGKEEHEGTPIASTPRQVDSKFFCKVPYSDLCNLFEEIEGTSSRLAI 139

Query: 115 TKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAA 174
            KLC+DF   ++K DP +LIPVTYLFIN+LGPDYEP            KTIS++CGKS  
Sbjct: 140 IKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQ 199

Query: 175 QVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLI 234
           Q+++ YRE GDLG +A +AR VQPTMFKPKPL V +VF  L+ IA+++GKDSQ KK++LI
Sbjct: 200 QIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLI 259

Query: 235 KKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHE--HDGKEPSPEQVDAA 292
           K+MLTACQG EAK+LIRSLESKLRIGLAEKTVL+ALSKA+L H+  +  KEPS + V+ A
Sbjct: 260 KRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEPSMDVVEQA 319

Query: 293 EALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQ 352
           E  +RD FCQVPNYE++INA L YGIM L +HC + PGIPLKPMLAKPTK+I EVLDRFQ
Sbjct: 320 EQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQ 379

Query: 353 GQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIID 412
           GQ FT EYKYDGERAQVHL++DGT+RIYSRN ENMTERYPEIQ   FLA+P +T SLI+D
Sbjct: 380 GQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTTSLILD 439

Query: 413 CEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRR 472
           CEAVAWD E+ KILPFQVL+TRKRK V + +VKVRVCLFAFD+L  N   L+   L+ RR
Sbjct: 440 CEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLINEPLSKRR 499

Query: 473 KHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKR 532
           + L+ V K V GE Q+A ++TT  L ELQ +L++SV  SCEGLMVKM+DG ES YEPSKR
Sbjct: 500 EVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKR 559

Query: 533 SRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGT 592
           SRNWLKLKKDYLEGVGDSLDL VL               FLLGCYN D E+FETCCKIGT
Sbjct: 560 SRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFETCCKIGT 619

Query: 593 GFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAG 652
           GFSEE+LQ+L+ +L  TVI  P+G            WFEP MLFEVLTADLSLSP+YKAG
Sbjct: 620 GFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAG 679

Query: 653 RDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
             VY KGISLRFPRFLRIR+DKSV DATSS+QI+E YQ Q++
Sbjct: 680 SSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSH 721

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/696 (60%), Positives = 499/696 (71%), Gaps = 12/696 (1%)

Query: 1   MSAPKKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPEL 60
           MS+ KKQATL RFF+A+++                         +   QD  V       
Sbjct: 18  MSSGKKQATLARFFSAVQKDD----------TKEKVNGDVKIIESRDNQDEPVTKKFKSS 67

Query: 61  ADKPAPGGVLPQAASAVPRAQSSPVKPAASTS-VMYADLCAVFEAVEATSSRLSITKLCA 119
           +        L    SA   +   PV P    S V Y+D+C VF+ +E TSSRLSI K+C+
Sbjct: 68  SPVKLQTSSLSPVKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICS 127

Query: 120 DFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSS 179
           +F   ++K +P +LIP TYLFINRLGPDYEP            KTIS+ACGKS  QV++ 
Sbjct: 128 EFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGKSLVQVKNR 187

Query: 180 YRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLT 239
           YRE GDLG +A +AR VQPTMFKPKPLTV +VF  L+AIA ++GKDSQ +KI+LIK+MLT
Sbjct: 188 YREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLT 247

Query: 240 ACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD-GKEPSPEQVDAAEALVRD 298
           AC+G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+LT+E + GKEPS E V+ AEA +RD
Sbjct: 248 ACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVEQAEAKIRD 307

Query: 299 TFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTC 358
            FCQVPNYE++INA L YGIM L +HC L PGIPLKPMLAKPTKSITEVLDRFQGQ FT 
Sbjct: 308 AFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTS 367

Query: 359 EYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAW 418
           EYKYDGERAQVHL+EDGT+RIYSRN ENMTERYPEI    F+A+ + T++LI+DCEAVAW
Sbjct: 368 EYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAW 427

Query: 419 DNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSV 478
           D  +QKILPFQVLSTRKRK VE KDVKVRVCLFAFD++  NGE  +  SL +RR+ L  V
Sbjct: 428 DKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQV 487

Query: 479 LKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLK 538
            K V GE Q+A E+TT  + ELQ +L+QSV  SCEGLMVKMLDG ES YEPSKRSRNWLK
Sbjct: 488 TKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLK 547

Query: 539 LKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEV 598
           LKKDYL+GVGDSLDL VL               FLLGCYN D  EFETCCKIGTGFS+E+
Sbjct: 548 LKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFETCCKIGTGFSDEM 607

Query: 599 LQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGK 658
           LQ L+ +   T +  P+             WFEP  LFEVLTADLSLSPVYKAG   Y K
Sbjct: 608 LQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDK 667

Query: 659 GISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           G+SLRFPRF+R+R+DKSV DATSS QIVE YQ Q++
Sbjct: 668 GVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSH 703

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/706 (58%), Positives = 503/706 (71%), Gaps = 19/706 (2%)

Query: 5   KKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKN-------SL 57
           K+Q TL  FFT++K+                     + A    E+  E  +       S 
Sbjct: 22  KRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPATKTAEEKHENMDVDTDPVISS 81

Query: 58  PELADK-------PAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSS 110
            E++ K       P+P  V+ +      + +++  K   ST V YADLC +F+ +E  SS
Sbjct: 82  SEVSAKRNSPLTSPSPTPVVSKKIKI--QDENNDTKEFYST-VPYADLCNLFQEIEGISS 138

Query: 111 RLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACG 170
           RL+I KLC+ F+ SV+K DP +LIP+TYLFIN+LGPDY P            KTI+++CG
Sbjct: 139 RLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCG 198

Query: 171 KSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKK 230
           +S  Q+++ Y E GDLG +A +AR VQPTMFKPKPLTV +VF  L++IA ++GKDSQ KK
Sbjct: 199 RSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKK 258

Query: 231 IRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH--DGKEPSPEQ 288
           I+LIK+MLT+CQG+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L +E+    K+   E 
Sbjct: 259 IKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGESDKDIDMET 318

Query: 289 VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVL 348
           V+ AE  +RD FCQVPNYE++I++ L++GIMNL QHC L P IPLKPMLAKPTKSI+E+ 
Sbjct: 319 VENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIF 378

Query: 349 DRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRS 408
           DRFQ Q+FTCEYKYDGERAQVHL+EDGT+RIYSRN ENMTERYPEI    F+ +   T+S
Sbjct: 379 DRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDFVTDLSHTKS 438

Query: 409 LIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSL 468
           LI+DCEAVAWD E+ KILPFQVLSTRKRK V++ ++KVRVCLFAFD+L  N E L+  SL
Sbjct: 439 LILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKSL 498

Query: 469 ADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYE 528
            +RR  L+S+ K V GE QFA E+TT  L ELQ++L+QSV  SCEGLMVKML+GEES YE
Sbjct: 499 QERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYE 558

Query: 529 PSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCC 588
           PSKRSRNWLKLKKDYL GVGDSLDL VL               FLLGCYN D  EFET C
Sbjct: 559 PSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETAC 618

Query: 589 KIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPV 648
           KIGTGFS+EVLQ LH +LK TVI  P+             WFEP +LFEVLTADLSLSPV
Sbjct: 619 KIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSPV 678

Query: 649 YKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           YKAG   Y KG+SLRFPRFLR+REDK V DATSS+QIVE Y+ QAN
Sbjct: 679 YKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQAN 724

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/743 (56%), Positives = 508/743 (68%), Gaps = 57/743 (7%)

Query: 1   MSAP------KKQATLGRFFTALK--RPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAE 52
           MS+P      +KQATL +FF+++K  +P D                     P+     A 
Sbjct: 19  MSSPAGFPKKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTT-------EKPSLSPYTAN 71

Query: 53  VKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAAST--------------------- 91
            K +  E+ ++PA    L  ++  V    S+P  P  ST                     
Sbjct: 72  SKKTFEEILNRPASN--LASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPS 129

Query: 92  ------------------SVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHL 133
                             S+ Y ++C +F+ +E+TSSRL+I KLC+DF   ++K +P +L
Sbjct: 130 KEPTIENVTQDSTKPYFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNL 189

Query: 134 IPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQA 193
           IPVTYLFIN+LGPDYEP            KTIS++CGKS AQVR+ YRE GDLG +A  A
Sbjct: 190 IPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDA 249

Query: 194 RVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSL 253
           R VQPTMFKPKPLTV +VF  L+ IA++EGKDSQ +KI+LIK+MLTAC+G EAK+LIRSL
Sbjct: 250 RNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSL 309

Query: 254 ESKLRIGLAEKTVLVALSKAILTHE-HDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINA 312
           ESKLRIGLAEKTVL++LSKA+L HE  D K+   E ++ AE  +RD FCQVPNYE++IN+
Sbjct: 310 ESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINS 369

Query: 313 ALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLM 372
            L+YGIM L  HC L PGIPLKPMLAKPTK+I E+LDRFQG+ FT EYKYDGERAQVHL+
Sbjct: 370 CLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLL 429

Query: 373 EDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLS 432
            DGT+RIYSRN ENMTERYPEI    F+A+P  T +LI+DCEAVAWDNE+ KILPFQVLS
Sbjct: 430 SDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLS 489

Query: 433 TRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEI 492
           TRKRK V+LKDVKV+VCLFAFD+L  N E L+  SL +RR+ L  V K V GE Q+A E+
Sbjct: 490 TRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEM 549

Query: 493 TTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLD 552
           T+  L ELQ +L+QSV  SCEGLMVKMLDG ES YEPSKRSRNWLKLKKDYLEG+GDSLD
Sbjct: 550 TSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLD 609

Query: 553 LAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIA 612
           L V+               FLLGCYN D  EFETCCKIGTGFS+E+LQ L+ +L  TV+ 
Sbjct: 610 LCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLD 669

Query: 613 APRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIRE 672
            P+             WFEP +LFEVLTADLSLSP+YKAG   Y KGISLRFPRF+R RE
Sbjct: 670 GPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTRE 729

Query: 673 DKSVTDATSSDQIVEFYQRQANS 695
           DK V DATSS+QI+E Y+ QA++
Sbjct: 730 DKGVEDATSSEQIIELYENQAHT 752

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/697 (58%), Positives = 495/697 (71%), Gaps = 7/697 (1%)

Query: 5   KKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPELADKP 64
           KKQATL RFF+++ + +                    +       D     S   +  K 
Sbjct: 27  KKQATLARFFSSMPKRKIDDDSSTDSTTINKDDDSDTSKKIKLNSDETPTTSAGSVTSKD 86

Query: 65  APG-GVLPQAASAVPRAQSSPVKPAAS-TSVMYADLCAVFEAVEATSSRLSITKLCADFM 122
            P     PQ     P    S  KP    ++V YADLC VF+ VE+TSSRLSI K+C+DF+
Sbjct: 87  EPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDFL 146

Query: 123 YSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYRE 182
             V+K DP +L+P+TYLFIN+LGPDYEP            KTIS++CGKS  Q+++ YRE
Sbjct: 147 IKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSMQQLKNQYRE 206

Query: 183 CGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ 242
            GDLG +AQ AR VQPTMFKPKPLTV +VF  L+ IAQ++GKDSQ +K+RLIK+MLTAC+
Sbjct: 207 IGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK 266

Query: 243 GMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD-GKEPSPEQVDAAEALVRDTFC 301
           G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L +E++  K+PS E ++ AE  +RD FC
Sbjct: 267 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRDAFC 326

Query: 302 QVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYK 361
           QVPNYE+II + L  GIM L  +C L PGIPLKPMLAKPTK+I EVLD FQG+ FTCEYK
Sbjct: 327 QVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYK 386

Query: 362 YDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFL----ANPQTTRSLIIDCEAVA 417
           YDGER QVHL+ +G +RIYSRN ENMTERYPE+    FL    +N     SLI+DCE VA
Sbjct: 387 YDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVA 446

Query: 418 WDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYS 477
           WDNE+ KILPFQVLSTRKRKGVELKDVKVRVCLFAFD+LY NGE L+  +L +RRK L+ 
Sbjct: 447 WDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHE 506

Query: 478 VLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWL 537
           V K VPGE Q+A  + T EL E+Q +L+Q++  SCEGLMVK+LDGEES+YEPSKRSRNWL
Sbjct: 507 VTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWL 566

Query: 538 KLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEE 597
           KLKKDYL GVGDSLDL V+               FLLGCYN D  E+ETCCKIGTGFS+E
Sbjct: 567 KLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSDE 626

Query: 598 VLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYG 657
           +L  L+   ++  I  P+             WFEP +LFEVLTADLSLSP+YKAG   Y 
Sbjct: 627 MLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYD 686

Query: 658 KGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           KGISLRFPRFLRIR+DKSV DATSSDQI+E Y+ Q++
Sbjct: 687 KGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSH 723

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/607 (64%), Positives = 471/607 (77%), Gaps = 2/607 (0%)

Query: 92  SVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPX 151
           ++ Y ++C +F+ +E TSSRLSI KLC+DF+  ++K DP +LIPVTYLFIN+LGPDYEP 
Sbjct: 158 AIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPG 217

Query: 152 XXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDV 211
                      KTIS++CGKS  Q+R+ YRE GDLG +A +AR VQPTMFKPKPLTV +V
Sbjct: 218 LELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEV 277

Query: 212 FSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ-GMEAKYLIRSLESKLRIGLAEKTVLVAL 270
           F+ L+ IA+A GKDSQ KKI+LIK+MLTAC+ G+EAK+LIRSLESKLRIGLAEKTVL++L
Sbjct: 278 FNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISL 337

Query: 271 SKAILTHEHD-GKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTP 329
           SKA+L  E D  K+   E ++ AE  +RD FCQVPNYE++IN+ LQYGIMNL +HC L P
Sbjct: 338 SKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCSLRP 397

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTE 389
           GIPLKPMLAKPTK+I E+LDRFQG+ FT EYKYDGERAQVHL+EDGT+RIYSRN ENMTE
Sbjct: 398 GIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 457

Query: 390 RYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVC 449
           RYPEI    F+ +   T++LI+DCEAVAWD E+QKILPFQVLSTRKRK V  KDVKVRVC
Sbjct: 458 RYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKVRVC 517

Query: 450 LFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVS 509
           LFAFD+L  N   L+  SL +RR+ L+ V    PGE Q+A E+TT  L ELQ +L+QSV+
Sbjct: 518 LFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQSVN 577

Query: 510 ASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXX 569
            SCEGLMVKML+GEES YEPSKRSRNWLKLKKDYLEG+GDSLDL VL             
Sbjct: 578 DSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRTGTY 637

Query: 570 XXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXW 629
             FLLGCYN +  EFETCCKIGTGFS+E+LQ LH +LK TVI  P+             W
Sbjct: 638 GGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEPDVW 697

Query: 630 FEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFY 689
           FEP++LFEVLTADLSLSP+YKAG   Y KG+SLRFPRF+RIREDK V DATSS+QI+E Y
Sbjct: 698 FEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQIIELY 757

Query: 690 QRQANSS 696
           + Q++ S
Sbjct: 758 ENQSHRS 764

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/607 (65%), Positives = 466/607 (76%), Gaps = 2/607 (0%)

Query: 91  TSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEP 150
           ++V YAD+C +F+ +E+TSSRLSI K+C+DF   ++K D  +L+P TYLFIN+LGPDYEP
Sbjct: 126 STVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEP 185

Query: 151 XXXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRD 210
                       KTIS++CGKS AQV++ YRE GDLG +A +AR VQPTMFKPKPLTV +
Sbjct: 186 GMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGE 245

Query: 211 VFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVAL 270
           VF  L+ IA A+GKDSQ KKI+LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++L
Sbjct: 246 VFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 305

Query: 271 SKAILTHEHD-GKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTP 329
           S A+L HE     EPS E VD AE  +RD FCQVPNYE++IN  L++GI  L +HC LTP
Sbjct: 306 SNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTP 365

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTE 389
           GIPLKPMLAKPTK+ITEVLDRFQGQ F  EYKYDGERAQ+HL+ DGT+RIYSRN ENMTE
Sbjct: 366 GIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTE 425

Query: 390 RYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVC 449
           RYPEI    FL++P +T SLI+DCEAVAWD E+ KILPFQVLSTRKRK V+ KDVKVRVC
Sbjct: 426 RYPEIDIRDFLSDP-STESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVC 484

Query: 450 LFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVS 509
           LFAFDLL  NGE L+  SL +R+  L  V K V GE ++AN++ T  + ELQ +L+QSV 
Sbjct: 485 LFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVK 544

Query: 510 ASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXX 569
            SCEGLMVKMLDG ES YEPSKRSRNWLKLKKDYL GVGDSLDL VL             
Sbjct: 545 DSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTY 604

Query: 570 XXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXW 629
             FLLGCYN D  E+ETCCKIGTGFSEE+LQ L+ +LK T + AP              W
Sbjct: 605 GGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVW 664

Query: 630 FEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFY 689
           FEP +LFEVL ADLSLSPVYKAG   Y KGISLRFPRFLRIR+DKSV +ATSS+Q+V+ Y
Sbjct: 665 FEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLY 724

Query: 690 QRQANSS 696
           + QA+ S
Sbjct: 725 EAQAHLS 731

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/720 (56%), Positives = 500/720 (69%), Gaps = 35/720 (4%)

Query: 6   KQATLGRFFTALK-RPQDGX---------------------XXXXXXXXXXXXXXXCLAA 43
           KQATL RFFT++K +P +G                                      +AA
Sbjct: 37  KQATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAA 96

Query: 44  PAGHEQD---AEVKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCA 100
           P+    +            +AD P     L      V  A SS      S+++ Y+++C 
Sbjct: 97  PSSMGSNFSSIPSSAPSSGVADSPQQSQRL---VGEVEDALSSNNNDHYSSNIPYSEVCE 153

Query: 101 VFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXX 160
           VF  +EA SSRL I ++C+DF   ++K    +LIP TYLFINRLGPDYE           
Sbjct: 154 VFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENL 213

Query: 161 XXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQ 220
             KTIS+ CGKS +Q++  Y++ GDLG +A  AR VQPTMFKPKPLTV +VF  L+AIA+
Sbjct: 214 LMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAK 273

Query: 221 AEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD 280
            +GKDSQ KK++LIK+MLTAC+G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L H+ +
Sbjct: 274 TQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 333

Query: 281 GKEPSPEQ------VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLK 334
            +E SP++      +++A+  +RD FCQVPNYE++IN+ L++GIMNL ++C L PGIPLK
Sbjct: 334 -REDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLK 392

Query: 335 PMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEI 394
           PMLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL+ DGT+RIYSRN ENMTERYPEI
Sbjct: 393 PMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEI 452

Query: 395 QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFD 454
               F+ +  TT++LI+DCEAVAWD ++ KILPFQVLSTRKRK VEL DVKV+VCLFAFD
Sbjct: 453 NITDFIQDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFD 512

Query: 455 LLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEG 514
           +L  N E L+  SL +RR++L  V KVVPGE Q+A +ITT  L ELQ +L++SV+ SCEG
Sbjct: 513 ILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEG 572

Query: 515 LMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLL 574
           LMVKML+G ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL               FLL
Sbjct: 573 LMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLL 632

Query: 575 GCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAM 634
           GCYN D  EFETCCKIGTGFS+E+LQ LH +L  T+I  P+             WFEP  
Sbjct: 633 GCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTT 692

Query: 635 LFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           LFEVLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSSDQIVE Y+ Q++
Sbjct: 693 LFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 752

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/610 (63%), Positives = 466/610 (76%), Gaps = 5/610 (0%)

Query: 90  STSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYE 149
           S+++ Y+D+C VF  +EA SSRL I ++C+DF   V+K    +LIP TYLFINRLGPDYE
Sbjct: 233 SSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYE 292

Query: 150 PXXXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVR 209
                        KTIS++CGKS +Q++  Y+E GDLG +A  AR VQPTMFKPKPLTV 
Sbjct: 293 AGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVG 352

Query: 210 DVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVA 269
           +VF  L+ IA+ +GKDSQ +KI+LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++
Sbjct: 353 EVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLIS 412

Query: 270 LSKAILTHEHDGKEPSPEQV-----DAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQH 324
           LSKA+L H+ + +  + + +     ++A+  +RD FCQVPNYE++IN+ L++GIMNL ++
Sbjct: 413 LSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKY 472

Query: 325 CVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNS 384
           C L PGIPLKPMLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL+ DGT+RIYSRN 
Sbjct: 473 CTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNG 532

Query: 385 ENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
           ENMTERYPEI+   F+ +   T++LI+DCEAVAWD ++ KILPFQVLSTRKRK VEL DV
Sbjct: 533 ENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592

Query: 445 KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYL 504
           KVRVCLFAFD+L  N E L+  SL +RR++L  V KVVPGE Q+A +I T  L ELQ +L
Sbjct: 593 KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFL 652

Query: 505 EQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXX 564
           ++SV+ SCEGLMVKMLDG ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL        
Sbjct: 653 DESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGK 712

Query: 565 XXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXX 624
                  FLLGCYN D  EFETCCKIGTGFS+E+LQ LHA+L  T+I  P+         
Sbjct: 713 RTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSA 772

Query: 625 XXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQ 684
               WFEP  LFEVLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSSDQ
Sbjct: 773 EPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQ 832

Query: 685 IVEFYQRQAN 694
           IVE Y+ Q++
Sbjct: 833 IVELYENQSH 842

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/624 (61%), Positives = 471/624 (75%), Gaps = 7/624 (1%)

Query: 77  VPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPV 136
           V +  SS      S+++ Y+++C VF  +EA SSRL I ++C+DF   ++     +LIP 
Sbjct: 130 VEKEPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPT 189

Query: 137 TYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVV 196
           TYLFINRLGPDYE             KTIS++CGKS +Q++  Y+E GDLG +A  AR V
Sbjct: 190 TYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNV 249

Query: 197 QPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESK 256
           QPTMFKPK LTV +VF  L+ IA+ +GKDSQ +K++LIK+MLTACQG+EAK+LIRSLESK
Sbjct: 250 QPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESK 309

Query: 257 LRIGLAEKTVLVALSKAILTHEHDGKEPSPEQ------VDAAEALVRDTFCQVPNYEMII 310
           LRIGLAEKTVL++LSKA+L H+ + KE SP++      +++A+  +RD FCQVPNYE++I
Sbjct: 310 LRIGLAEKTVLISLSKALLLHDEN-KENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVI 368

Query: 311 NAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVH 370
           N+ L +GIMNL ++C L PGIPLKPMLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVH
Sbjct: 369 NSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVH 428

Query: 371 LMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQV 430
           L+ DGT+RIYSRN ENMTERYPEI+   F+ +  +T++LI+DCEAVAWD E++KILPFQ+
Sbjct: 429 LLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQI 488

Query: 431 LSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFAN 490
           LSTRKRK VEL DVKV+VCLFAFD+L  N E L+  SL +RR+HL  V KVVPGE Q+A 
Sbjct: 489 LSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYAT 548

Query: 491 EITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDS 550
           +I T  L ELQ +L++SV+ SCEGLMVKMLDG ES YEPSKRSRNWLKLKKDYLEGVGDS
Sbjct: 549 QIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDS 608

Query: 551 LDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTV 610
           LDL VL               FLLGCYN D  EFETCCKIGTGFS+E+LQ LH +L  T+
Sbjct: 609 LDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTI 668

Query: 611 IAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRI 670
           I  P+             WFEP  LFEVLTADLSLSP+YKAG   + KG+SLRFPRFLRI
Sbjct: 669 IDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRI 728

Query: 671 REDKSVTDATSSDQIVEFYQRQAN 694
           REDK V DATSSDQI+E Y+ Q++
Sbjct: 729 REDKGVEDATSSDQIIELYENQSH 752

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/610 (62%), Positives = 463/610 (75%), Gaps = 5/610 (0%)

Query: 90  STSVMYADLCAVFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYE 149
           S+++ Y+++C VF  +EA SSRL I ++C+DF   ++K    +LIP TYLFINRLGPDYE
Sbjct: 143 SSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYE 202

Query: 150 PXXXXXXXXXXXXKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVR 209
           P            KTIS++CGKS  Q++  Y+E GDLG +A  AR VQPTMFKPKPLTV 
Sbjct: 203 PGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVG 262

Query: 210 DVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVA 269
           +VF  L++IA+ +GKDSQ +K++LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++
Sbjct: 263 EVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLIS 322

Query: 270 LSKAILTHEHDGKEPSPEQV-----DAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQH 324
           LSKA+L H  +G+      +     ++A+  +RD FCQVPNYE++IN+ L++GIMNL + 
Sbjct: 323 LSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKF 382

Query: 325 CVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNS 384
           C L PGIPLKPMLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL++DGT+RIYSRN 
Sbjct: 383 CTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNG 442

Query: 385 ENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
           ENMTERYPEI+   F+ +   T++LI+DCEAVAWD E+ KILPFQVLSTRKRK VEL DV
Sbjct: 443 ENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDV 502

Query: 445 KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYL 504
           KVRVCLFAFD+L  NGE L+  SL +RR+ L  V KVVPGE Q+A +I T  L ELQ +L
Sbjct: 503 KVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFL 562

Query: 505 EQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXX 564
           ++SV+ SCEGLMVKML+G ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL        
Sbjct: 563 DESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGK 622

Query: 565 XXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXX 624
                  FLLGCYN D  EFETCCKIGTGFS+E LQ LH +L  T+I  P+         
Sbjct: 623 RTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSA 682

Query: 625 XXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQ 684
               WFEP  LFEVLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSS+Q
Sbjct: 683 EPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQ 742

Query: 685 IVEFYQRQAN 694
           IVE Y+ Q++
Sbjct: 743 IVELYENQSH 752

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/694 (57%), Positives = 489/694 (70%), Gaps = 15/694 (2%)

Query: 2   SAPKKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPELA 61
           S  K+QATL RFFT++K   D                    + +     +   +S     
Sbjct: 28  SNSKRQATLARFFTSIKPSADDQNSK--------------TSSSPVPPPSSSSSSTTANG 73

Query: 62  DKPAPGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADF 121
             P     L    S+   +  + VK      + YAD+C +F+ +E  SSRL I KLC++F
Sbjct: 74  SSPLKKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEF 133

Query: 122 MYSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYR 181
               +K +  +LIP+TYLFIN+LGPDYE             KTIS++CGKS  QV+  Y+
Sbjct: 134 FTKAMKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYK 193

Query: 182 ECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTAC 241
           + GDLGT+A  AR VQPTMFKPKPLTV  VF  L+ IA++ GKDSQ KKIRLIKK+LTAC
Sbjct: 194 DIGDLGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTAC 253

Query: 242 QGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGK-EPSPEQVDAAEALVRDTF 300
           +G+EAKYLIRSLESKLRIGLAEK+VL++LSKA+L +E++   +P  E ++ AE  +RD F
Sbjct: 254 KGIEAKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAF 313

Query: 301 CQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEY 360
           CQ+PNYE++IN+ L+YGIMNL +HC L PGIPLKPMLAKPTK+I EV DRFQ   FT EY
Sbjct: 314 CQIPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEY 373

Query: 361 KYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDN 420
           KYDGERAQVHLM DG++RIYSRN ENMTERYPEI    F+ +   T+SLIIDCEAVAWD 
Sbjct: 374 KYDGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDR 433

Query: 421 EKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLK 480
           E++KILPFQVLSTRKRK V++KD+KVR+CLFAFD+L  N E L+  SL +RR+ L+SV +
Sbjct: 434 EEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTR 493

Query: 481 VVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLK 540
            V GE  +A E++T  L ELQ +L+QSV  SCEGLMVK+LDGE+S YEPSKRSRNWLKLK
Sbjct: 494 EVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLK 553

Query: 541 KDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQ 600
           KDYL+GVGDSLDL VL               FLLGCYN D  EFET CKIGTGFS+EVLQ
Sbjct: 554 KDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQ 613

Query: 601 SLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGI 660
           SL+ +LK T I  P+             WFEP +LFEVLTADLS+SP+YKAG   Y KGI
Sbjct: 614 SLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGI 673

Query: 661 SLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           SLRFPRF+R+REDKSV +ATSS+QI+E Y+ Q++
Sbjct: 674 SLRFPRFIRLREDKSVEEATSSEQIIELYENQSH 707

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/715 (55%), Positives = 491/715 (68%), Gaps = 51/715 (7%)

Query: 5   KKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPE-LADK 63
           KKQATL RFFT++ +                        PA    +   K   PE   DK
Sbjct: 45  KKQATLARFFTSMGKK---------------------TPPA---VEVATKQESPENHVDK 80

Query: 64  PAPGGVLP-QAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFM 122
                V P Q+  A  +A+S P      ++V+Y+++C +F+ +E TSSRL+I KLC++F 
Sbjct: 81  KRKVEVHPSQSVGASEKAESPP--DQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFF 138

Query: 123 YSVLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYRE 182
             V+K +P  +I V YLFINRLGPDYEP            KTIS+A GKS  Q++   +E
Sbjct: 139 IRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKE 198

Query: 183 CGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ 242
            GDLGT+A+ AR +QPTMFKPKPLT+ DVF+ L+ IA A GKDSQ +KI+LIK+ML+A +
Sbjct: 199 TGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK 258

Query: 243 GMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEH---DGKEPSPEQ-------VDAA 292
           G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L HEH    G+    E+       ++ A
Sbjct: 259 GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQA 318

Query: 293 EALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQ 352
           EA +R+  CQVPNYE++IN  LQ GI+N+ + C L PGIPLKPMLAKPTK+ITEVL+ FQ
Sbjct: 319 EAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQ 378

Query: 353 GQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFL------ANPQT- 405
           G+ F  EYKYDGERAQVHL+E G +RIYSRN ENMTERYPE+    FL       N Q  
Sbjct: 379 GKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEG 438

Query: 406 ------TRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLN 459
                  + +I+DCE VAWD E++KILPFQVL+TRKRK V+LKDVKVRVCLFAFDLLYLN
Sbjct: 439 ENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLN 498

Query: 460 GESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKM 519
            E ++  SL +R++ L  V  +VPGE Q+A  + T ++ ELQT+L+Q+V  SCEGLMVKM
Sbjct: 499 NEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKM 558

Query: 520 LDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNP 579
           LDGEES YEPSKRSRNWLKLKKDYL+GVGDSLDL V+               FLLGCYN 
Sbjct: 559 LDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNE 618

Query: 580 DLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVL 639
           D +EFETCCKIGTGFS+E+L +LH  L+ T I  P              WF+  +LFEVL
Sbjct: 619 DTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVL 678

Query: 640 TADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           TADLSLSPVYKAG   Y KGISLRFPRFLRIREDK VTD T+S+ I+EFY+ Q++
Sbjct: 679 TADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSH 733

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/692 (55%), Positives = 474/692 (68%), Gaps = 15/692 (2%)

Query: 5   KKQATLGRFFTALKRPQDGXXXXXXXXXXXXXXXXCLAAPAGHEQDAEVKNSLPELADKP 64
           KKQ TL RFF A + P+D                          Q  E K  +       
Sbjct: 39  KKQVTLARFF-AKREPKDEEKQSSSPVKEQVQIQGQPQQEQVKIQPQEQKQIV------- 90

Query: 65  APGGVLPQAASAVPRAQSSPVKPAASTSVMYADLCAVFEAVEATSSRLSITKLCADFMYS 124
            P  V     +  P  +S P    A++S+ YADLC +FE +E+ SSRL+IT LC  F   
Sbjct: 91  VPQEVTTSTQTPRPTKKSKP----ATSSLPYADLCQLFETIESESSRLTITNLCTAFFSR 146

Query: 125 VLKCDPGHLIPVTYLFINRLGPDYEPXXXXXXXXXXXXKTISDACGKSAAQVRSSYRECG 184
            L+ DP  L+PVTYL IN+LGPDY              K I  ACG S  Q++  YR+ G
Sbjct: 147 TLQLDPSLLVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLG 205

Query: 185 DLGTVAQQARVVQPT--MFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ 242
           DLG +A   RV+QPT  MFK +PLT+  VF TL  IA ++GKDSQ +KI +IK++LT+CQ
Sbjct: 206 DLGQLAMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQ 265

Query: 243 GMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQ 302
           G+EAK+LIRSLESKLRIGLAEKTVL +L++A++ HE        +    AE +++D+FCQ
Sbjct: 266 GVEAKFLIRSLESKLRIGLAEKTVLTSLARALVIHEKGNDNIQDDDYSNAEQIIKDSFCQ 325

Query: 303 VPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKY 362
           +PNYE+II  +LQYG+  L  H  LTPGIPLKPMLAKPTKSI+EVLD FQ  +FT EYKY
Sbjct: 326 IPNYEIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKY 385

Query: 363 DGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRSLIIDCEAVAWDNEK 422
           DGERAQVHL+ DG++RIYSRN E+MT+RYPE+    +L +  TT  LI+DCEAVAWD E 
Sbjct: 386 DGERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVEL 445

Query: 423 QKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVV 482
           QKILPFQVLSTRKRK V+LKD+KVRVCLFAFD+L  N +SL+  +L +RR  L+S+ K  
Sbjct: 446 QKILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPC 505

Query: 483 PGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKD 542
           PG+ QFA E+TT  L ELQT+L++++  SCEGLMVK LDG +S YEPSKRSRNWLKLKKD
Sbjct: 506 PGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKD 565

Query: 543 YLEGVGDSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEEFETCCKIGTGFSEEVLQSL 602
           YL+G+GDSLDL VL               FLL CYN D EEFETCCKIGTGFS+E+LQ+L
Sbjct: 566 YLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTL 625

Query: 603 HAQLKDTVIAAPRGXXXXXXXXXXXXWFEPAMLFEVLTADLSLSPVYKAGRDVYGKGISL 662
           +  LK+T I +PR             WF P M+FEVLTADLSLSP+YKAG  VYGKGISL
Sbjct: 626 YNGLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISL 685

Query: 663 RFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694
           RFPRF+RIR DKSV DATSS+Q+++FY+ Q++
Sbjct: 686 RFPRFIRIRTDKSVNDATSSEQVIDFYENQSH 717

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 167/411 (40%), Gaps = 56/411 (13%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388
           G    P LAK      E + R     F  E K DGER QVH M  G +I+ +SR   + T
Sbjct: 251 GFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYT 310

Query: 389 ERY----PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE---L 441
             Y          Q L    + +  ++D E V +D +++ ILPF ++    ++ +    +
Sbjct: 311 YLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSI 370

Query: 442 KDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501
            +V        FDLLYLNG SL    L  R+++L S+L  +   ++         +  ++
Sbjct: 371 NNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIK 430

Query: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXX 561
             LE ++S   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL V+     
Sbjct: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI----- 482

Query: 562 XXXXXXXXXXFLLGCYNPDLEEFE------------------------------TCCKIG 591
                     F+LG    D EE++                              + C I 
Sbjct: 483 -GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIA 541

Query: 592 TGFSEEVLQSL----HAQLKDTVIAAPRGXXXXXXXXXXXXWFEP--AMLFEVLTADLSL 645
            G S+E  + +        K T   AP              W +P  +++ E+ +  L  
Sbjct: 542 NGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDN 601

Query: 646 SPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696
           +   +     Y    +L      RIR DK  TD  + + + E    ++N S
Sbjct: 602 T---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTLNDLYESRTVKSNPS 649

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  109 bits (272), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 118/235 (50%), Gaps = 11/235 (4%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYSRNSENMT 388
           G    P LAK      E +       F  E K DGER QVH M+ G  IR  SR   + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 389 ERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
           + Y E         +L      R  ++D E + +D ++  +LPF ++ +  R+ +  + +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 445 ---KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501
                R  L   DL+YLNG SL+K  L  R++ L  VLK  P  ++    +   E + ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
             LE+S+S   EG+++K     +++YE   R+  W+K+K +YLE  G++LDL ++
Sbjct: 448 KSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVII 499

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 104/399 (26%), Positives = 175/399 (43%), Gaps = 47/399 (11%)

Query: 330 GIPLKPMLAKPTK-SITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENM 387
           G+P  P LAK    S  +V  R +   F  E K DGER Q+H M+ G  ++ +SR   + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSD-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 388 TERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKD 443
           T  Y E        ++L      R  ++D E +++D E+  +LPF ++ +  R  +  + 
Sbjct: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371

Query: 444 V---KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSEL 500
           +     R      D LYLNG SL+   L  R+++L ++L   P  ++    +   + + +
Sbjct: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431

Query: 501 QTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXX 560
           ++ LE+++    EG+++K     +S+YE   R+ NW+K+K +YLE  G++LDL V+    
Sbjct: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488

Query: 561 XXXXXXXXXXXFLLG-----------CYNPDLEE----------FETCCKIGTGFSEEVL 599
                       L G             N D EE          F + C I  G S+E  
Sbjct: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548

Query: 600 QSLH----AQLKDTVIAAPRGXXXXXXXXXXXXWFEP--AMLFEVLTADLSLSPVYKAGR 653
           + +      + K+T    P              W  P  +++ EV     SL     +GR
Sbjct: 549 KQIERKTAGKWKNTEDHKP-PKILEFGSKLPEEWIYPEDSVVLEVKAR--SLDNTESSGR 605

Query: 654 DVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQ 692
             +  G +L      RIREDK+ T+  +   + E +Q +
Sbjct: 606 K-FKVGCTLHGGYCRRIREDKNWTECYT---LYELWQER 640

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score =  108 bits (271), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 127/260 (48%), Gaps = 17/260 (6%)

Query: 307 EMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGER 366
           E + N  ++ G   L     +  G    P LAK      E +     Q F  E K DGER
Sbjct: 257 ETLWNPTMRLGKNELS----INIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGER 312

Query: 367 AQVHLMEDGT-IRIYSRNSENMTERYPEIQFH----QFLANPQTTRSLIIDCEAVAWDNE 421
            Q+H +E G  IR  SR   + T  Y +   H    Q L      +  ++D E V++D E
Sbjct: 313 IQLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKE 372

Query: 422 KQKILPFQVLSTRKRKGVELKDVKV-----RVCLFAFDLLYLNGESLLKCSLADRRKHLY 476
           K  +LPF ++ +   + +   D KV     R     FDL+YLNG SL +  L  R+ +L 
Sbjct: 373 KNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLR 432

Query: 477 SVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNW 536
           S+L  V   ++  +++   E + ++  LE+++    EG+++K      S YE   R+ +W
Sbjct: 433 SILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQF---SSPYEIGARNDSW 489

Query: 537 LKLKKDYLEGVGDSLDLAVL 556
           +K+K +Y E +G+++DL V+
Sbjct: 490 IKIKPEYFEELGETMDLVVI 509

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 120/232 (51%), Gaps = 11/232 (4%)

Query: 333 LKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMTERY 391
            +P LAK      EVL R    +FT E K DGER Q+H M+ G  I+ +SR   + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 392 PEIQ----FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVR 447
            + +      ++L   +  +  I+D E V++D  +  ILPF ++ +     +++  ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 448 VC---LFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYL 504
           +C      FD+L+LNG  L    L  R+++L ++L      ++        +   +++ L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 505 EQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
           + ++S   EG+++K  D   S Y    R+ +W+K+K +YLE  G++LDL V+
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVI 492

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 113/237 (47%), Gaps = 15/237 (6%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388
           G    P LAK      E + R     F  E K DGER QVH M  G ++R YSR   + T
Sbjct: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310

Query: 389 ERYP------EIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE-- 440
             Y        I  H  L      R  ++D E V +D  ++ ILPF ++    +  +   
Sbjct: 311 YLYGASLSSGTISHH--LDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFN 368

Query: 441 -LKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSE 499
            + +V        FDLLYLNG SL    L  R+++L S+L  V   ++         +  
Sbjct: 369 SINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVES 428

Query: 500 LQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
           ++  LE ++S   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 429 IKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 114/235 (48%), Gaps = 11/235 (4%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388
           G    P LAK      E + R     F  E K DGER QVH M  G +I+ +SR   + T
Sbjct: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310

Query: 389 ERY----PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
             Y          Q+L    T +  ++D E V +D+ ++ ILPF ++    +  +   D+
Sbjct: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370

Query: 445 K---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501
                R     FDLLYLN  SL    L  R+K+L S+L      ++        ++  ++
Sbjct: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430

Query: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
             LE ++S   EG+++K  +   S Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 118/235 (50%), Gaps = 11/235 (4%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388
           G    P LAK      + +       F  E K DGER Q+H M  G T++ +SR+  + T
Sbjct: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYT 331

Query: 389 ERYPEIQ----FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
             Y   +      +FL   +  +  ++D E V +D+  +K+LPF ++ +     +  KD+
Sbjct: 332 YLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKDI 391

Query: 445 ---KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501
                      FD+LYLNG SL+   L  R++ L +VL      ++  + I   +  +++
Sbjct: 392 DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQIK 451

Query: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
             L+ ++S   EG+++K      S+Y P+ R  NW+K+K +YLE  G+++DL V+
Sbjct: 452 KGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 119/242 (49%), Gaps = 11/242 (4%)

Query: 323 QHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYS 381
           Q   +  G+   P LA       + +    G  F  E K DGER Q+H    G+ I+ YS
Sbjct: 259 QDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYS 318

Query: 382 RNSENMTERYPEIQFHQFLAN----PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRK 437
           R + + T  Y        LAN     +  +  ++DCE V +D+  + +LPF ++ +  + 
Sbjct: 319 RRATDYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKN 378

Query: 438 GVELKDVKVRV---CLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITT 494
            +    +  +     L  FD+LYLNG +L+      RR++L  +L      ++    I  
Sbjct: 379 MLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRA 438

Query: 495 MELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLA 554
            +   ++  LE+++S   EG+++K  D   S+Y  + RS +W+K+K +YLE  G+++DL 
Sbjct: 439 NDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLV 495

Query: 555 VL 556
           ++
Sbjct: 496 LM 497

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score =  102 bits (253), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 99/379 (26%), Positives = 163/379 (43%), Gaps = 41/379 (10%)

Query: 192 QARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLI------KKMLTACQGME 245
           + R   P   K + +T+  + S L  +A   GK S+G+  R +      K  L     +E
Sbjct: 132 RKRKSGPDPSKRQAITLDKLNSILDDLAN--GKSSRGQGSRTLADSSHFKFCLENMSFIE 189

Query: 246 AKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPN 305
            KY    L  K+RI              I  HEH       + ++A      D F  V +
Sbjct: 190 LKYFFDIL-LKVRI--------------IGGHEH-------KLLNAWHPDAVDYFSVVSD 227

Query: 306 YEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGE 365
              +     +  +    +   L  G    P LAK      E + +  G  F+ E K DGE
Sbjct: 228 LSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFSIEEKMDGE 287

Query: 366 RAQVHLMEDGT-IRIYSRNSENMTERY----PEIQFHQFLANPQTTRSLIIDCEAVAWDN 420
           R Q+H M+ G  I+  SR   + T  Y           +L   +  +  I+D E V +D 
Sbjct: 288 RIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILDGEMVTYDQ 347

Query: 421 EKQKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYS 477
           EKQ ILPF ++ +  +  +  + +          AFDL+YLNG SL+   L  R+ +L  
Sbjct: 348 EKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLYQRKDYLSK 407

Query: 478 VLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWL 537
           +L    G +   +      L  +   L  ++S   EG+++K L+   S+Y  + R+ +W+
Sbjct: 408 ILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMVASRNDSWI 464

Query: 538 KLKKDYLEGVGDSLDLAVL 556
           K+K  YL+  G+++DL ++
Sbjct: 465 KIKPQYLKQFGENMDLIII 483

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 99/412 (24%), Positives = 163/412 (39%), Gaps = 57/412 (13%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388
           G    P LAK      E +       F  E K DGER QVH M  G +I+ +SR   + T
Sbjct: 251 GFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310

Query: 389 ERYP----EIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
             Y          Q+L    + +  ++D E V +D  ++ ILPF ++    ++ +   D+
Sbjct: 311 YLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDI 370

Query: 445 K---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQ 501
                      FDLLYLNG SL    L  R+++L S+L      ++        +   ++
Sbjct: 371 NNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVK 430

Query: 502 TYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLXXXXX 561
             LE ++S   EG+++K      S Y  + R+ NW+K+K +YLE  G++LDL ++     
Sbjct: 431 KSLEVAISLGSEGVVLKHY---SSSYNVASRNNNWIKVKPEYLEEFGENLDLIII----- 482

Query: 562 XXXXXXXXXXFLLGCYNPDLEE-------------------------------FETCCKI 590
                     F+LG    D +E                                 + C I
Sbjct: 483 -GRDSGKKDSFMLGLLVVDEQETGKTDQEGPSEILNDSSTERRATNPKKRVRKVLSFCSI 541

Query: 591 GTGFSEEVLQSL----HAQLKDTVIAAPRGXXXXXXXXXXXXWFEP--AMLFEVLTADLS 644
             G S+E  + +        K T   +P              W EP  +++ E+ +  L 
Sbjct: 542 ANGISQEEFKEIDRKTRGHWKKTSGLSPPPSILEFGSKLPAEWIEPSESIVLEIKSRSLD 601

Query: 645 LSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696
            +   +     Y    +L      RIR DK  T+  + D++ E  + ++N S
Sbjct: 602 NT---ETNMQKYATNCTLYGGYCRRIRYDKDWTECYTLDELYENRRTKSNPS 650

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 99.4 bits (246), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 118/240 (49%), Gaps = 13/240 (5%)

Query: 327 LTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTI-RIYSRNSE 385
           +  G    P LAK      E +       F  E K DGER Q+H +  G++ +  SR   
Sbjct: 259 INIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGI 318

Query: 386 NMTERY-PEIQ---FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRK-----R 436
           + +  Y  E+      Q+L      R  ++D E V++D +++ ILPF ++ +        
Sbjct: 319 DFSHLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELIN 378

Query: 437 KGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTME 496
             V  ++   R     FDL+YLNG SL K  L  R+++L  +L  VP  ++    I   +
Sbjct: 379 SEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACD 438

Query: 497 LSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
              ++ ++++++    EG++VK      S YE   R+ +W+K+K +Y E +G+++DL V+
Sbjct: 439 AKAIKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI 495

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 119/230 (51%), Gaps = 11/230 (4%)

Query: 335 PMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYSRNSENMTERYPE 393
           P  AK      + + R     F  E K DGER Q+H M  G  ++  SR   + +  Y +
Sbjct: 278 PETAKRLTYSYDTIARRLKNDFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGD 337

Query: 394 IQFH----QFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVK---V 446
            + +    ++L   +  +  I+D E V +D+ K  ILPF ++ +   + + + D++    
Sbjct: 338 NRNNGAIGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGY 397

Query: 447 RVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQ 506
                AFDL+YLNG SL    L  R+ +L  +L   P  ++    +   + S +++ LE+
Sbjct: 398 HPLYMAFDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEK 457

Query: 507 SVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
           ++    EG+++K  D   SQY  +KRS +W+K+K +YLE  G+++DL V+
Sbjct: 458 AIELGSEGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 133/300 (44%), Gaps = 40/300 (13%)

Query: 327 LTPGIPLKPMLAKPTK-SITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNS 384
           +T     +P LAK T  S   V  + Q   F  E K DGER Q+H +  G  I+  SR  
Sbjct: 241 ITISHAFEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299

Query: 385 ENMTERY----------PEIQFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTR 434
            + +  Y          P ++ H         +  I+D E + +D EK  +LPF ++ + 
Sbjct: 300 VDFSYLYGENSSSGPISPSLKLHF------NVKDCILDGEMITYDTEKDIVLPFGLVKSS 353

Query: 435 KRKGV--ELKDV----KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQF 488
               +  EL  +      +    AFDL+YLNG+SL   +L  R+ +L  +L  V   ++ 
Sbjct: 354 AMNQIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEI 413

Query: 489 ANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVG 548
              +  +    ++  LEQ++S   EG+++K L    S+Y    R+ +W+K+K +YLE  G
Sbjct: 414 IQYMKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFG 470

Query: 549 DSLDLAVLXXXXXXXXXXXXXXXFLLGCYNPDLEE------FETCCKIGTGFSEEVLQSL 602
           +++DL ++               F  G    D  E      F + C I  G S E  + +
Sbjct: 471 ENMDLLII------GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDI 524

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 114/239 (47%), Gaps = 11/239 (4%)

Query: 326 VLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNS 384
           V+ PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR  
Sbjct: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 385 ENMTERYPEIQFHQFLAN----PQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVE 440
            + T  Y E     F+       +  +  I+D E + +D  +  ILPF ++ +  R  + 
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 441 ---LKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMEL 497
              + +   +     FDL+++NG SL    L  R+++L  +    P  ++  +       
Sbjct: 375 KDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFNE 434

Query: 498 SELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
             ++  LE ++S   EG+++K  D   S+Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 435 DSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 111/237 (46%), Gaps = 13/237 (5%)

Query: 330 GIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDG-TIRIYSRNSENMT 388
           G    P +A+  K   E +    G  F  E K DG+R QVH M+ G +I  +SRN  N T
Sbjct: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350

Query: 389 ERYPEIQFHQFLANP----QTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDV 444
             Y E      ++N     +  +  I+D E V++D E Q ILPF +  +     V  +  
Sbjct: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410

Query: 445 -----KVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSE 499
                  R     FDLLYLNG+ L    +  R+++L  +L      +   +     +   
Sbjct: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 500 LQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
           +   L  +V+   EG+++K      S+Y   KR  +W+K+K +YLE  G+++DL V+
Sbjct: 471 ITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI 524

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/364 (23%), Positives = 155/364 (42%), Gaps = 37/364 (10%)

Query: 205 PLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTAC----QGMEAKYLIRSLESKLRIG 260
           P+T+ ++ + L  ++Q      +G K      + T C      ME +Y            
Sbjct: 144 PITLDELNTLLDFLSQDRNIKGRGYKNLSESSIFTYCIEKMSFMELRYFFD--------- 194

Query: 261 LAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMN 320
                 ++  ++ I  HEH       + ++A      D    V + + +        I  
Sbjct: 195 ------IILKARVIGPHEH-------KLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRL 241

Query: 321 LPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRI 379
                 +  G    P LAK      + + +     F  E K DGER Q+H M+ G  I+ 
Sbjct: 242 RHDELSINIGYAFAPHLAKKLSISYDKICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKF 301

Query: 380 YSRNSENMTERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRK 435
            SR   + T  Y E         +L   +  +  ++D E V +D ++  +LPF ++ +  
Sbjct: 302 LSRRGVDYTYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAA 361

Query: 436 RKGV---ELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEI 492
              +   E+        L  FDL++LNG SL++  L  R+ +L SVL+     +Q  N  
Sbjct: 362 MNALTKEEISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFT 421

Query: 493 TTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLD 552
                + ++  LE ++S   EG+++K  +   S+Y    R+ +W+K+K +YLE  G+++D
Sbjct: 422 RCSNENIIRKSLEHAISVGSEGIVLKNYN---SRYMIGSRNDSWIKIKPEYLEQFGENMD 478

Query: 553 LAVL 556
           L V+
Sbjct: 479 LIVI 482

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/298 (24%), Positives = 131/298 (43%), Gaps = 18/298 (6%)

Query: 267 LVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCV 326
           ++  S+ I  HEH       + ++      +D    V + + + N      +        
Sbjct: 211 IILKSRVIGGHEH-------KFLNVWHPDAQDYLSVVSDLKTVANKLWDPAVHLKNDDLT 263

Query: 327 LTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGT-IRIYSRNSE 385
           +  G P  P  AK      E +       F  E K DGER Q+H  + G  +   SR   
Sbjct: 264 INVGSPFAPQSAKKLSISYEKICAKLKHDFFIEEKMDGERIQLHYQDYGNKLSFLSRRGT 323

Query: 386 NMTERYPEI----QFHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVEL 441
           + T  Y E        ++L      ++ ++D E V +D E+  +LPF ++ +  R  +  
Sbjct: 324 DYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIITQ 383

Query: 442 KDVK---VRVCLFAFDLLYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELS 498
           + V     R  L  FDL+YLNG SL+   L  R+ +L  +       ++        +  
Sbjct: 384 EGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDER 443

Query: 499 ELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVL 556
            ++  LE ++S   EG+++K  +   S+Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 444 SIKNALEHAISIGSEGVVLKHYN---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>TBLA0F00490 Chr6 (128506..132093) [3588 bp, 1195 aa] {ON} Anc_7.460
           YJR089W
          Length = 1195

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 258 RIGLAEKTVLVALSKAILTHEHDGKEPSPEQVDAAEALVRDTFCQVPNYEMIINAALQYG 317
           R G  +   L  + +  L+HE D     PE V   E++ RD +C+  +YEM  N A+  G
Sbjct: 468 RAGQTQDIELKHIQEHALSHEIDN----PEIVTTRESIKRDNYCKNNDYEM-ENYAIMSG 522

Query: 318 IMNL 321
           + N+
Sbjct: 523 VCNI 526

>NCAS0G03410 Chr7 (624153..627323) [3171 bp, 1056 aa] {ON} Anc_1.506
           YKL197C
          Length = 1056

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 68/182 (37%), Gaps = 37/182 (20%)

Query: 165 ISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGK 224
           I+  CG +   V+        +G   Q  R +       KP  +   F    +IA   G 
Sbjct: 753 IAQQCGLNFLSVKGPEILNKYIGASEQNVRELFEKAQSVKPCIL--FFDEFDSIAPKRGH 810

Query: 225 DSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEP 284
           DS G   R++ ++LT   G E              GL    VL A S+            
Sbjct: 811 DSSGVTDRVVNQLLTQMDGAE--------------GLDGVYVLAATSR------------ 844

Query: 285 SPEQVDAA----EALVRDTFCQVPNYEM---IINAALQYGIMNLPQHCVLTPGIPLKPML 337
            P+ +D+A      L +   C +PN +    II A   +G  +      L PG+ L+P++
Sbjct: 845 -PDLIDSALLRPGRLDKSILCNIPNEDERHDIICAITGHGRTS-KSKLKLAPGVILQPII 902

Query: 338 AK 339
            K
Sbjct: 903 KK 904

>Kwal_27.10012 s27 complement(158559..161615) [3057 bp, 1018 aa]
           {ON} YKL197C (PEX1) - member of the AAA-protein family
           [contig 43] FULL
          Length = 1018

 Score = 31.6 bits (70), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 48/123 (39%), Gaps = 34/123 (27%)

Query: 212 FSTLQAIAQAEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALS 271
           F    +IA   G DS G   R++ +MLT   G E              GL    VL A S
Sbjct: 777 FDEFDSIAPKRGHDSIGVTDRVVNQMLTQMDGAE--------------GLDGVYVLAATS 822

Query: 272 KAILTHEHDGKEPSPEQVDAA----EALVRDTFCQVPNYE---MIINAALQYGIMNLPQH 324
           +             P+ +D+A      L +   C +PN +    I+ A +  G M+L  +
Sbjct: 823 R-------------PDLIDSALLRPGRLDKSILCGLPNEDERLEILQAVVASGGMHLEPN 869

Query: 325 CVL 327
           C L
Sbjct: 870 CQL 872

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,276,247
Number of extensions: 2292590
Number of successful extensions: 6227
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6301
Number of HSP's successfully gapped: 43
Length of query: 697
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 580
Effective length of database: 40,065,477
Effective search space: 23237976660
Effective search space used: 23237976660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)