Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL154W7.344ON31929513980.0
Ecym_47297.344ON3262907392e-96
KLLA0D12474g7.344ON3122856992e-90
KLTH0H01386g7.344ON3072756611e-84
TDEL0C020307.344ON3112806411e-81
SAKL0F11242g7.344ON3092836402e-81
Smik_12.2637.344ON3182766393e-81
YLR205C (HMX1)7.344ON3172776281e-79
Skud_12.2687.344ON3182746193e-78
ZYRO0F11594g7.344ON3092796183e-78
Kwal_56.246247.344ON3072756166e-78
NCAS0E028907.344ON3152816132e-77
Suva_10.2997.344ON3202786124e-77
TPHA0F029207.344ON3202865508e-68
Kpol_530.367.344ON3112875402e-66
NDAI0E045007.344ON3272915412e-66
KAFR0L014707.344ON3002744965e-60
KNAG0B026407.344ON3022794889e-59
CAGL0A03905g7.344ON2822584563e-54
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL154W
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   543   0.0  
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   289   2e-96
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   273   2e-90
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   259   1e-84
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   251   1e-81
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   251   2e-81
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   250   3e-81
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   246   1e-79
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   243   3e-78
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   242   3e-78
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   241   6e-78
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   240   2e-77
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   240   4e-77
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   216   8e-68
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   212   2e-66
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   213   2e-66
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   195   5e-60
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   192   9e-59
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   180   3e-54

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/295 (92%), Positives = 272/295 (92%)

Query: 1   MATKSENTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIY 60
           MATKSENTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIY
Sbjct: 1   MATKSENTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIY 60

Query: 61  RQGLLAMYYIFRSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYA 120
           RQGLLAMYYIFRSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYA
Sbjct: 61  RQGLLAMYYIFRSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYA 120

Query: 121 AEYSTSAQLHQFLDSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRS 180
           AEYSTSAQLHQFLDSYELPPRL           LRQPWTILAHCHVLYLALFAGGRVMRS
Sbjct: 121 AEYSTSAQLHQFLDSYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRS 180

Query: 181 ALSRQLGLLPRAAGLSARETQLRXXXXXXXXXXXXEENKARVAYKRAYELATRTALSEAE 240
           ALSRQLGLLPRAAGLSARETQLR            EENKARVAYKRAYELATRTALSEAE
Sbjct: 181 ALSRQLGLLPRAAGLSARETQLRGTHFFTFGAGAGEENKARVAYKRAYELATRTALSEAE 240

Query: 241 KADVIDAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295
           KADVIDAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ
Sbjct: 241 KADVIDAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  289 bits (739), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 140/290 (48%), Positives = 188/290 (64%), Gaps = 1/290 (0%)

Query: 7   NTPIYTQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLA 66
           ++ I++ A  ++P PTD GALANRINF TR++H+KADAFV  K A+A+RH  IYRQG+LA
Sbjct: 11  DSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILA 70

Query: 67  MYYIFRSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTS 126
            YYIF +VEQ IDRLL  P+T +E +I  ILR FW  EF R+  L++D E +Y  EY T 
Sbjct: 71  FYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQ 130

Query: 127 AQLHQFLDSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQL 186
            +L QFL+ +ELPP+L           +  P TILA+CHVLY ALFAGG+VMRS + R +
Sbjct: 131 NELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNI 190

Query: 187 GLLPRAAGLSARETQLR-XXXXXXXXXXXXEENKARVAYKRAYELATRTALSEAEKADVI 245
           GL P+  G+SA E+                EENK R  YK+ YELATR  L E +K ++I
Sbjct: 191 GLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEII 250

Query: 246 DAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295
           D + A+F  +  ++ E+   N++EL+   S++LLTFL  EWRY  K S +
Sbjct: 251 DVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSE 300

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  273 bits (699), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 133/285 (46%), Positives = 182/285 (63%), Gaps = 1/285 (0%)

Query: 12  TQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIF 71
            + +  +P PTD GALANRINF TR++H+K +A++S K A A+RH  IYRQG++A YY+F
Sbjct: 3   VEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVF 62

Query: 72  RSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQ 131
            ++EQ IDRLL  P T  + ++  IL+ FW  EF R+  LV D +V Y  EY  S QL +
Sbjct: 63  HAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQE 122

Query: 132 FLDSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR 191
           FLD ++LP +L            ++P TILA+CHVLYLALFAGGRVM+S L R +GL P+
Sbjct: 123 FLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPK 182

Query: 192 AAGLSARETQLRXXXXXXXXXX-XXEENKARVAYKRAYELATRTALSEAEKADVIDAARA 250
              LS +E   R             +EN+ R  YK+ YELATRT L+EAEK  +I+ ++ 
Sbjct: 183 FGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQT 242

Query: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295
            F     V+AE+   NR EL+G  SY+L++FL EEW+Y  K +P+
Sbjct: 243 IFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPE 287

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  259 bits (661), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 173/275 (62%), Gaps = 1/275 (0%)

Query: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77
           +P PTD GALANRINFHTR+ H+K D  +SAKFA A++H  IYRQG+LA +Y+F+++EQ 
Sbjct: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63

Query: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137
           +DRL +   T +E +  +IL  FW  EF RAP ++QD E+ YA E+ TSA L  FL+   
Sbjct: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123

Query: 138 LPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSA 197
           L P L             +P  ILA+CHVLYLALFAGGRVMRS + R  GL P+   L+ 
Sbjct: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183

Query: 198 RETQLRXXXXXXXXXXXXE-ENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQ 256
            E   R            + EN+ R  YKR YELATR  L+E +K +++D + A F+   
Sbjct: 184 EEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNT 243

Query: 257 AVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTK 291
            V+ E+   NRQEL+G  S+RLLTF+ EEW+Y  K
Sbjct: 244 RVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDK 278

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  251 bits (641), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 169/280 (60%), Gaps = 1/280 (0%)

Query: 12  TQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIF 71
           T  +  +P PTD GALANRINFHTR+ H+K +A++S + A AL+H  IYRQG+LA Y+IF
Sbjct: 2   TSVAKTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIF 61

Query: 72  RSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQ 131
            +VEQ +DRLL  P   +E ++  +LR FW  EF R   + +D EV Y+ EYS S  L  
Sbjct: 62  DAVEQELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRN 121

Query: 132 FLDSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR 191
           F++   L P+L            +   TILA+CHVLYLALFAGG+VMRS L R  GL P+
Sbjct: 122 FVEHQPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPK 181

Query: 192 AAGLSARETQLRXXXXXXXXXXXXE-ENKARVAYKRAYELATRTALSEAEKADVIDAARA 250
              L+ +E  +R            + ENK R  YK  YELATR  LSE++K  ++  +  
Sbjct: 182 FEYLTPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQ 241

Query: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRT 290
            FD    V+ E+   NR EL+   S++LLT+L EEW+Y T
Sbjct: 242 IFDWNMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYST 281

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  251 bits (640), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 126/283 (44%), Positives = 173/283 (61%), Gaps = 1/283 (0%)

Query: 14  ASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRS 73
           ++  +P PTD GALANRINFHTR+ H+K +A +S K A A++H  IYRQG+LA YYIF +
Sbjct: 2   SATTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAA 61

Query: 74  VEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133
           VEQ ID LL+  +T  E +  +IL  FW  EF R+  + QD E+ Y+ EYST  +LH FL
Sbjct: 62  VEQEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFL 121

Query: 134 DSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAA 193
           D   LPP+              +P+TILA+CHVLYLALFAGG++M+S + R  GL P+  
Sbjct: 122 DDNVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQ 181

Query: 194 GLSARETQLRXXXXXXXXXXXXE-ENKARVAYKRAYELATRTALSEAEKADVIDAARADF 252
            L+  +   R            + E K R  YK+ YELATR  L+E +K ++I  +   F
Sbjct: 182 HLTPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIF 241

Query: 253 DHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSPQ 295
           D    V+ EL   NR EL+G  S++L++F+ EEW+Y  K S +
Sbjct: 242 DWNMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKE 284

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  250 bits (639), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 174/276 (63%), Gaps = 1/276 (0%)

Query: 15  SPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSV 74
           + ++P PTD GALANRINFHTR+ H+K + F+  K A+A+RH  IYRQG+LA YY+F ++
Sbjct: 6   NKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAI 65

Query: 75  EQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLD 134
           EQ IDRLL  P T  E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL 
Sbjct: 66  EQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLA 125

Query: 135 SYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAG 194
           ++E PP L            ++P TIL++CHVLYLALFAGG+++RS L R+LGL P    
Sbjct: 126 TFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEK 185

Query: 195 LSARETQLRXXXXXXXXXXX-XEENKARVAYKRAYELATRTALSEAEKADVIDAARADFD 253
           LS +E   +             EE + ++ YK+ YELATRT L+EA+K  +I  A   FD
Sbjct: 186 LSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFD 245

Query: 254 HIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289
               ++AE+   NR+EL+G  S++ +T++ EEW + 
Sbjct: 246 WNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFN 281

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  246 bits (628), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 116/277 (41%), Positives = 174/277 (62%), Gaps = 1/277 (0%)

Query: 14  ASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRS 73
           ++ ++P PTD GALANRINF TR+ H+K + F+  K A+A+RH  IYRQG+LA YY+F +
Sbjct: 5   SNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDA 64

Query: 74  VEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133
           +EQ IDRLL  P T +E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL
Sbjct: 65  IEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFL 124

Query: 134 DSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAA 193
            +++ PP L            ++P TIL++CHVLYLALFAGG+++RS L R+LGL P   
Sbjct: 125 ATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184

Query: 194 GLSARETQLRXXXXXXXXXXX-XEENKARVAYKRAYELATRTALSEAEKADVIDAARADF 252
            LS +E   +             EE + +  YK+ YELATRT L+EA+K  +I  A   F
Sbjct: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIF 244

Query: 253 DHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289
           D    ++AE+   NR+EL+G  S++ +T+L EEW + 
Sbjct: 245 DWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFN 281

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  243 bits (619), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 172/274 (62%), Gaps = 1/274 (0%)

Query: 14  ASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRS 73
            + ++P PTD GALANRINFHTR+ H+K + F+  + A+A+RH  IYRQG+LA YY+F +
Sbjct: 5   TNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDA 64

Query: 74  VEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133
           +EQ IDRLL  P T  E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL
Sbjct: 65  IEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFL 124

Query: 134 DSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAA 193
             +E PP L            ++P TIL++CHVLYLALFAGG+++RS L R+LGL P   
Sbjct: 125 AKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184

Query: 194 GLSARETQLRXXXXXXXXXXX-XEENKARVAYKRAYELATRTALSEAEKADVIDAARADF 252
            LS +E   +             EE + ++ YK+ YELATRT L+EA+K  +I  A   F
Sbjct: 185 RLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIF 244

Query: 253 DHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEW 286
           D    ++AE+   NR+EL+G  S++ +T++ EEW
Sbjct: 245 DWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEW 278

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  242 bits (618), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 127/279 (45%), Positives = 167/279 (59%), Gaps = 2/279 (0%)

Query: 17  VVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQ 76
            +P PTD GALANRINFHTR+ H+K +A++S + A AL+H  I+RQG+LA YYIF+++EQ
Sbjct: 3   TIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQ 62

Query: 77  HIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDS- 135
            +DR++       E ++  +L  FW  +F R   + QD  + Y+ E+ T + L QFL S 
Sbjct: 63  ELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSG 122

Query: 136 YELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGL 195
             L P L             +P TILA+CHVLYLALFAGG+VMRS L R  GL P+   L
Sbjct: 123 NHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHL 182

Query: 196 SARETQLRXXXXXXXXXXXXE-ENKARVAYKRAYELATRTALSEAEKADVIDAARADFDH 254
           S RE   R            E ENK R  YKR YELATR  L+E +K  +I  +   F  
Sbjct: 183 SPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQW 242

Query: 255 IQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNS 293
               +AE+   NRQEL+GS S+RLLT+L EEW++  K S
Sbjct: 243 NMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLS 281

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  241 bits (616), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 122/275 (44%), Positives = 170/275 (61%), Gaps = 1/275 (0%)

Query: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77
           +P PTD GALANRINF+TR+ H+K D  +S KFA A++H  IYRQGLLA +Y+F+++EQ 
Sbjct: 4   IPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQE 63

Query: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137
           IDRLL+   TA+E +  +IL  FW   F+R P + QD ++ YA E+ +  QL  FL    
Sbjct: 64  IDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQNT 123

Query: 138 LPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSA 197
           LPP               +P +ILA CHVLYLALFAGGRVMRS + R  GL P+   L+ 
Sbjct: 124 LPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDLTP 183

Query: 198 RETQLRXXXXXXXXXXXXE-ENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQ 256
            E   +            + EN+ R  YKR YELATR  L+E +K ++++ A A F+   
Sbjct: 184 EEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWNT 243

Query: 257 AVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTK 291
            V++E+   NRQEL+G  S++L++F  +EW++  K
Sbjct: 244 RVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEK 278

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  240 bits (613), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 114/281 (40%), Positives = 172/281 (61%), Gaps = 3/281 (1%)

Query: 12  TQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIF 71
           +  + ++P PTDT ALANRINF TR+ H+K +  +S K A+ALRH  IYRQG+L  YYIF
Sbjct: 3   SHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIF 62

Query: 72  RSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQ 131
           + VE+ I +L  +P T++E +IG +L   W PEF R   L++D ++ Y  EY T   L  
Sbjct: 63  KVVEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQL 122

Query: 132 FLDS--YELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLL 189
           FL++   ELPP L           L  P +I A+CHVLYLALFAGG+++RS + + LG L
Sbjct: 123 FLETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFL 182

Query: 190 PRAAGLSARET-QLRXXXXXXXXXXXXEENKARVAYKRAYELATRTALSEAEKADVIDAA 248
           P    LS++E  +              EE K ++ +K+ YEL TR +L+E EK+ +I+ +
Sbjct: 183 PNFNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETS 242

Query: 249 RADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289
           +  FD+    M EL   N+++L+   +++++T+L EEW++ 
Sbjct: 243 KKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFN 283

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  240 bits (612), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 172/278 (61%), Gaps = 1/278 (0%)

Query: 12  TQASPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIF 71
           T  S ++P PTD GALANRINFHTR+ H+K + F+  K A+A+RH  IYRQG+LA YY+F
Sbjct: 5   TSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVF 64

Query: 72  RSVEQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQ 131
            ++EQ IDRLL    +  E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++
Sbjct: 65  DAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNE 124

Query: 132 FLDSYELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR 191
           FL ++E PP L            ++P TIL++CHVLYLALFAGG+++RS L R+LGL P 
Sbjct: 125 FLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPN 184

Query: 192 AAGLSARETQLRXXXXXXXXXXX-XEENKARVAYKRAYELATRTALSEAEKADVIDAARA 250
              L+ +E   +             EE + +  YK+ YELATRT L+EA+K  +I  A  
Sbjct: 185 FEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEG 244

Query: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRY 288
            FD    ++AE+   NR+EL+   S++ +T++ EEW +
Sbjct: 245 IFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMF 282

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  216 bits (550), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 113/286 (39%), Positives = 169/286 (59%), Gaps = 10/286 (3%)

Query: 16  PVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVE 75
            ++P PTD  ALANRINF TR+ H+K  AF+S + A+ALRH  IYRQGL+A Y+IF ++E
Sbjct: 5   KIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIE 64

Query: 76  QHIDRLLRA-PATADEARI--GEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQ-LHQ 131
             ID LL    +  D  +I   +IL++F+  EF R   L+QD  V Y  E+  + Q +  
Sbjct: 65  NEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLD 124

Query: 132 FLDS----YELPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLG 187
           FL+S     E  P L             +P+TI+A+CHVLYLALFAGG++M+S + + +G
Sbjct: 125 FLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVG 184

Query: 188 LLPRAAGLSARE--TQLRXXXXXXXXXXXXEENKARVAYKRAYELATRTALSEAEKADVI 245
           L P+   +S  E   Q               ++K R  YK+ YEL+TR  L+E +K D+I
Sbjct: 185 LFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDII 244

Query: 246 DAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTK 291
           + ++  F  ++ V+AE+  +NR +L+G  + + +T+L EEW+Y  K
Sbjct: 245 EVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK 290

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  212 bits (540), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 110/287 (38%), Positives = 164/287 (57%), Gaps = 10/287 (3%)

Query: 15  SPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSV 74
           +  +P PTD GALANRINF TR+ H+K  AF+  + A+AL+H  IYR+GL+  Y+IF ++
Sbjct: 2   TSTIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTI 61

Query: 75  EQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTS-AQLHQFL 133
           E  ID +L      D++++  IL +F+  EF R   +++D E+ Y  E+     QL +F+
Sbjct: 62  ETEIDLVLN---NQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFI 118

Query: 134 DSYEL---PPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLP 190
           +S        +L              P T+LA+CHVLYLALFAGG++M+S +++ LG+ P
Sbjct: 119 NSDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFP 178

Query: 191 RAAGLSARETQLRXXXXXXXXXXXXEEN---KARVAYKRAYELATRTALSEAEKADVIDA 247
           +   LS +E   R             E    K R  YK+ YEL+TR  L E +K  VI  
Sbjct: 179 KFEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKT 238

Query: 248 ARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTKNSP 294
           ++  F  ++  +AE+  RNR EL+   SY+L TF+ EEW+Y +  SP
Sbjct: 239 SKDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISP 285

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  213 bits (541), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 17/291 (5%)

Query: 16  PVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVE 75
            ++P PTDT ALANRINFHTR+ H+K D  ++ K AVALRH  IYRQG+L  YYIF++VE
Sbjct: 7   TIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAVE 66

Query: 76  QHIDRLL--RAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFL 133
             I+ LL     AT ++ R G +L   W  EF R   L +D ++ Y+  +     L  F+
Sbjct: 67  SEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFI 126

Query: 134 D-SYEL-----PPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLG 187
           +  ++L       +L              P  ILA+CHVLYLALFAGG++++S + + LG
Sbjct: 127 NEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLG 186

Query: 188 LLPRAAGLSARE-----TQL----RXXXXXXXXXXXXEENKARVAYKRAYELATRTALSE 238
            LP    LS++E     T                    ENK ++ +KR +EL TR+ L+E
Sbjct: 187 FLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNE 246

Query: 239 AEKADVIDAARADFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289
            EK  +I+ A+  F      M EL  RN++EL+   S++L+ +L EEW++ 
Sbjct: 247 NEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN 297

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  195 bits (496), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 156/274 (56%), Gaps = 12/274 (4%)

Query: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77
           VP PTDT ALANRINFHTR+LH+  D  +S K   ALRH  IY+  LL+ YY+FR++E  
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137
           ID ++    + D + IGEILR F+  +F R   +++D +     +  +     Q+L S  
Sbjct: 65  IDFII----SNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDD---QWLSS-- 115

Query: 138 LPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLG--LLPRAAGL 195
             P L              P  +LA+CHVLYLALFAGGR+MR+++++ L    +P+   +
Sbjct: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174

Query: 196 SARETQLRXXXXXXXXXXXXEENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHI 255
           S  +  +              ENK +  YKR Y++ T+  L+E EK ++ID +R  F   
Sbjct: 175 SHTDVIMNATNFFKFDKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFN 234

Query: 256 QAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289
             ++ E+   N+ EL+ + +Y+++T++ EEW++R
Sbjct: 235 FNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFR 268

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  192 bits (488), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 150/279 (53%), Gaps = 17/279 (6%)

Query: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77
           +P PTDT ALANRINFHTR+LH++ D   S KF +ALRH  IY   L   Y +F +VEQ 
Sbjct: 5   IPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQR 64

Query: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137
           ID L+   A+     +G IL  F+ PEF RA  + +D  + +  E+ T          + 
Sbjct: 65  IDELI---ASEGGDGVGAILGEFYVPEFRRADKIKRD--LVFLGEWDTVES-----GQWT 114

Query: 138 LPPRLXXXXXXXXXXXLRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPR------ 191
            PP+L            R P T+LA CHVLYLALFAGGRV +S+L + LG LP       
Sbjct: 115 PPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNG 174

Query: 192 -AAGLSARETQLRXXXXXXXXXXXXEENKARVAYKRAYELATRTALSEAEKADVIDAARA 250
               +S                   +ENK R  YKR YELATR  L+E +K  VI A+R 
Sbjct: 175 PGEEMSDHTLVSNATNFFQFAETIEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRD 234

Query: 251 DFDHIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289
            F H  AV+ E+  +N  EL+   S++++T+  EEW++ 
Sbjct: 235 VFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFN 273

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  180 bits (456), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 149/258 (57%), Gaps = 12/258 (4%)

Query: 46  VSAKFAVALRHPSIYRQGLLAMYYIFRSVEQHIDRLLR---------APATADEARIG-E 95
           +S +FAVALRH  +YRQG+LA YY+F+++EQ ID LL          A   +D+  +  +
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 96  ILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYELPPRLXXXXXXXXXXXLR 155
           I++ FW PEF R   L +D  + Y+ EY TS +L   L  ++LPP+L            +
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 156 QPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSARETQLRXXXXXXXXXXXX 215
            P T+LA+CHV+YLALFAGG+VMRS L R  GL P+   LS++E   +            
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 216 E-ENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQAVMAELAVRNRQELLGSP 274
           + EN+ +  YK+ YELATR AL+E +K ++ID A+  F+    ++ E+   N+ E L + 
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNK-EALTNN 239

Query: 275 SYRLLTFLGEEWRYRTKN 292
              LL ++ EE ++  K+
Sbjct: 240 KLDLLQYVFEELKFYNKD 257

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,834,062
Number of extensions: 787254
Number of successful extensions: 1533
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1524
Number of HSP's successfully gapped: 19
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)