Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL152W7.346ON42842821410.0
Ecym_47277.346ON42939916220.0
KLLA0D12430g7.346ON41840115740.0
CAGL0A03927g7.346ON43741415560.0
SAKL0F11286g7.346ON42340015460.0
Suva_10.2977.346ON43639915300.0
Smik_12.2617.346ON43639915190.0
Skud_12.2667.346ON43639915180.0
TDEL0C020207.346ON42539915160.0
KLTH0H01342g7.346ON42240015130.0
Kwal_56.246317.346ON42240015130.0
NCAS0E028807.346ON42939915130.0
ZYRO0F11616g7.346ON41539914950.0
YLR203C (MSS51)7.346ON43639914920.0
KNAG0B026307.346ON43840714910.0
Kpol_530.357.346ON42540214670.0
TPHA0F029307.346ON43640014610.0
NDAI0E044807.346ON44340014500.0
NCAS0A141207.346ON42739814070.0
KNAG0C037507.346ON42442814000.0
KAFR0B008407.346ON42640113860.0
TBLA0E005007.346ON43741013700.0
NDAI0A019307.346ON45041113560.0
TDEL0H019907.245ON35345731.9
KLTH0E06116gna 1ON83735732.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL152W
         (428 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   829   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   629   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   610   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   603   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   600   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   593   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   589   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   589   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   588   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   587   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   587   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   587   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   580   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   579   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   578   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   569   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   567   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   563   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   546   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   543   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   538   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   532   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   526   0.0  
TDEL0H01990 Chr8 complement(342304..343365) [1062 bp, 353 aa] {O...    33   1.9  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    33   2.1  

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/428 (93%), Positives = 400/428 (93%)

Query: 1   MLVSRLPQLAARPYXXXXXXXXXXXXXXXPIMGFVRNALGLDPPASPDEPTDENRFHVWE 60
           MLVSRLPQLAARPY               PIMGFVRNALGLDPPASPDEPTDENRFHVWE
Sbjct: 1   MLVSRLPQLAARPYAVGRGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWE 60

Query: 61  QSPSPDXXXXXXXXXXXXXCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATL 120
           QSPSPD             CPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATL
Sbjct: 61  QSPSPDLRERAARIRALARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATL 120

Query: 121 RKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKM 180
           RKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKM
Sbjct: 121 RKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKM 180

Query: 181 LSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTLYPESESARAVRSKPMRIFIL 240
           LSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTLYPESESARAVRSKPMRIFIL
Sbjct: 181 LSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTLYPESESARAVRSKPMRIFIL 240

Query: 241 GARAEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKL 300
           GARAEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKL
Sbjct: 241 GARAEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKL 300

Query: 301 VHHTDYLHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVT 360
           VHHTDYLHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVT
Sbjct: 301 VHHTDYLHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVT 360

Query: 361 GFHRDDMFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRG 420
           GFHRDDMFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRG
Sbjct: 361 GFHRDDMFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRG 420

Query: 421 KRYHAIQV 428
           KRYHAIQV
Sbjct: 421 KRYHAIQV 428

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/399 (70%), Positives = 340/399 (85%), Gaps = 1/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           IMGFVRNALGLDPP SPDEPT +NRFH W+QSPSP+             CPVTGK+I++S
Sbjct: 31  IMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIKALAKCPVTGKNIQFS 90

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C+ SGIPTHHS EAW+ D EYH SKR+  L+KVN+YEHDLRSGRPF EFDFP++Q  DRM
Sbjct: 91  CKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRPFLEFDFPEQQDYDRM 150

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM+NWDL+ YTR F+SMDT+FQLAAVTKMLSYPITIGS+LHQ+SPY+L P+GPITLEGL
Sbjct: 151 VNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYSPYSLNPKGPITLEGL 210

Query: 211 KSLAALRYTLYPE-SESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHF 269
           KSLAALRYTLYPE +   R+++ KP+R+FILGARAEAQLPGHVWKQLQYLFP S +E+HF
Sbjct: 211 KSLAALRYTLYPEQNRRVRSIQDKPLRVFILGARAEAQLPGHVWKQLQYLFPESLIELHF 270

Query: 270 IGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFCF 329
           +GPE+ YDR+++EYV SS PV KR+D T+K+ +HTDY HVFHEAQDFFPYDPYND+FFCF
Sbjct: 271 VGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEAQDFFPYDPYNDIFFCF 330

Query: 330 HPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHPT 389
           HPGF S E R +WM+ T+ ALL+TKCAIF TGF++ D+  D +A++  +  E+D+L+ PT
Sbjct: 331 HPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQAVKEKYGDELDMLVDPT 390

Query: 390 KNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           KN+FGSTKWELND+NPHEVYQFNMYIAGFRGKRYHAI++
Sbjct: 391 KNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/401 (70%), Positives = 331/401 (82%), Gaps = 2/401 (0%)

Query: 30  PIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRY 89
           PIMGFVRNALGLDPPASPD+PT ENRFH W+QSPSPD             CPVT KDI++
Sbjct: 18  PIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQF 77

Query: 90  SCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDR 149
           +C  SGIPTHHSREAWE+D EYH+SKR+  L+KVN+YEHDLRSGRPF EFDFPQ+Q  DR
Sbjct: 78  TCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYDR 137

Query: 150 MVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEG 209
           MVNM NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGS+LHQ+SPY+L P+GPITLEG
Sbjct: 138 MVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLEG 197

Query: 210 LKSLAALRYTLYPE-SESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           LKSLAALRYTLYPE S   RA +  P+RIFILG RAEAQLPGHVWKQLQYL P +++E+H
Sbjct: 198 LKSLAALRYTLYPEQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIELH 257

Query: 269 FIGPEALYDRQRKEYVHSST-PVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFF 327
           F+GPE+ YDR+++ YV SST  + KR+D  ++L +HTD+ HVFHEAQDFFPYDPYNDVFF
Sbjct: 258 FVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDVFF 317

Query: 328 CFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMH 387
           CFHPGFA+ E    WM  T+ AL++TKCA+F TGF ++D+  D   ++  + +E+D+LM 
Sbjct: 318 CFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDMLME 377

Query: 388 PTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           P  N+FGSTKWELND NPHEVYQFNMYIAGFRGKRYHAI++
Sbjct: 378 PVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/414 (68%), Positives = 327/414 (78%), Gaps = 16/414 (3%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SPDEPT++NRFH W+QSP+ D             CPVT K I+Y+
Sbjct: 24  LMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQYT 83

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWEQD+EYH SK++  L+KVN+YEHDLRSGRPF EFDFP++QG DR 
Sbjct: 84  CPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPDRT 143

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLFLYTR FYSMDT+FQLAAVTKMLSYPITIGS+LHQFSPY+L P+GPITLEGL
Sbjct: 144 VNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGL 203

Query: 211 KSLAALRYTLYPESESA--RAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP    A     ++KPMRIFILGARAEAQLPGHVWKQLQ+LFP  N EIH
Sbjct: 204 KSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFEIH 263

Query: 269 FIGPEALYDRQRKEYVHSST--------------PVSKRVDGTLKLVHHTDYLHVFHEAQ 314
           FIGPE+LYDR+R EY+ S+T              PV+KR+D T+K  +HTDY H  H AQ
Sbjct: 264 FIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHTAQ 323

Query: 315 DFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEAL 374
           DFFPYDPY DVFF FHPG AS E + +WM  TV  LL+TKCAIF TGF++ DM  D + L
Sbjct: 324 DFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQIL 383

Query: 375 RASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           + ++  EMD+LM+P KN+FGSTKWEL+D +PH VYQFNMYIAGFRGKRYH I+V
Sbjct: 384 QDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV 437

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/400 (71%), Positives = 329/400 (82%), Gaps = 2/400 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           I+GFVRNALGLDPP SPD+PT +NRFH W+QSPSPD             CPVTGK+I Y+
Sbjct: 24  IIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEINYT 83

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C +SGIPTHHSREAWEQD  YH +K++  L+KVN+YEHDLRSGRPF EFDFPQ+Q  DRM
Sbjct: 84  CPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRM 143

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM NWDLF YTRQFYSMDT+FQLAAVTKMLSYP T+GS+LH+FSPYAL P+GPITLEGL
Sbjct: 144 VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITLEGL 203

Query: 211 KSLAALRYTLYPES--ESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP+   + + A + +PMRIFILGARAEAQLPGHVWKQ Q+LFP  N E+H
Sbjct: 204 KSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINFELH 263

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           FIGPE+ YDR+++EY+ SSTP+ +RVD TL  V+HTDY HVFHEAQDFFPYDPY D+FFC
Sbjct: 264 FIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDIFFC 323

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPGFA+ E    WM KT+  LLETKCAIF TGF+  D+  D  A+R  +  EMD+LM P
Sbjct: 324 FHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDMLMEP 383

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
            +N+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYHAI+V
Sbjct: 384 VRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/399 (71%), Positives = 326/399 (81%), Gaps = 2/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SPD+PT ENRFH W+QSPS D             CPVTGKDI Y+
Sbjct: 36  LMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYT 95

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ+QG D+ 
Sbjct: 96  CPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKA 155

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLFLYTR FYSMDT+FQLAAVTKMLSYPITIGSLLH+FSPY+L P+GPITLEGL
Sbjct: 156 VNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGL 215

Query: 211 KSLAALRYTLYP-ESESARA-VRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP E+ S  A  R++ MRIFILGARAEAQLPGHVWKQLQ+LFP  N EIH
Sbjct: 216 KSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIH 275

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           FIGPE LY R ++EYV S+TPV +R+D TLK  HHTD+  VFHEAQDFFPYDPY DVFF 
Sbjct: 276 FIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFT 335

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D   +++ +  EMD+LM P
Sbjct: 336 FHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDP 395

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
            KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 396 VKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/399 (71%), Positives = 324/399 (81%), Gaps = 2/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SPD+PT ENRFH W+QSPS D             CPVTGKDI Y+
Sbjct: 36  LMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYT 95

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ QG D+ 
Sbjct: 96  CPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKA 155

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGSLLH+FSPY+L P+GPITLEGL
Sbjct: 156 VNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGL 215

Query: 211 KSLAALRYTLYP-ESES-ARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP E+ S   A +++ MRIFILGARAEAQLPGHVWKQLQ+LFP  N EIH
Sbjct: 216 KSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIH 275

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           FIGPE LY R ++EYV S+TPV +RVD TLK +H TD+  VFHEAQDFFPYDPY DVFF 
Sbjct: 276 FIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFT 335

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D   +++ +  EMD+LM P
Sbjct: 336 FHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDP 395

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
            KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 396 VKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/399 (70%), Positives = 327/399 (81%), Gaps = 2/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SPD+PT ENRFH W+QSPS D             CPVTGKDI Y+
Sbjct: 36  LMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYT 95

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ+QG D+ 
Sbjct: 96  CPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKA 155

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGS+LH+FSPY+L P+GPITLEGL
Sbjct: 156 VNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGL 215

Query: 211 KSLAALRYTLYP-ESESARA-VRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP E+ S  A  +++ MRIFILGARAEAQLPGHVWKQLQ+LFP  N EIH
Sbjct: 216 KSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIH 275

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           F+GPE LY R ++EYV S+TPV +RVD TL+ +HHTD+  VFHEAQDFFPYDPY DVFF 
Sbjct: 276 FVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFT 335

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D  A+++ +  EMD+LM P
Sbjct: 336 FHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDP 395

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
            +N+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 396 VRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/399 (69%), Positives = 329/399 (82%), Gaps = 1/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           I+GFVRNALGLDPP SPD+PT ENRFH W+QSP  D             CPVTGK+I Y+
Sbjct: 27  IIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEINYT 86

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWEQD++YH+SK++  L+KVN+YEHDLRSGRPF EFDFPQ Q  DR 
Sbjct: 87  CPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDFDRT 146

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM NWDLF YTRQFYSMDT+FQLAAVTKMLSYPI+I S+LHQFSPY+L P+GP+TLEGL
Sbjct: 147 VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTLEGL 206

Query: 211 KSLAALRYTLYP-ESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHF 269
           KSLAALRYTLYP E+++  + + +PMRIFILGARAEAQLPGHVWKQLQYLFP    E+HF
Sbjct: 207 KSLAALRYTLYPLENKTISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMFELHF 266

Query: 270 IGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFCF 329
           +GPE L ++++ +YV SSTPV KRVD T+  V+HTD+ HV HEAQDFFPYDPY DVFFCF
Sbjct: 267 VGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDVFFCF 326

Query: 330 HPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHPT 389
           HPGF + E  +SW+++T+  LLETKCAIF TGF++ D+  D +A++  +  E+DVLM P 
Sbjct: 327 HPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVLMEPV 386

Query: 390 KNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYHAI+V
Sbjct: 387 KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/400 (70%), Positives = 326/400 (81%), Gaps = 2/400 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           IMGFVRNALGLDPP SPDEPT ENRFH W+QSPSPD             CPVTG++I Y+
Sbjct: 23  IMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYT 82

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C +SGIPTH+SREAWE D EY +SKR   L+KVN+YEHDLRSGRPF EFDFP +Q  DRM
Sbjct: 83  CPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRM 142

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYP+TIGS+LHQFSPY+L P+GP+TLEGL
Sbjct: 143 VNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGL 202

Query: 211 KSLAALRYTLYPESES--ARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYPE         ++ P+RIFILGARAEAQLPGHVWKQLQ++FP +N+E+H
Sbjct: 203 KSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELH 262

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           F+GPE+ YDR ++EYVHSS+P+ +RVD TL  V+HTDY HVFHEAQDFFPYDPY D+FFC
Sbjct: 263 FVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFC 322

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPGFA+ E R +WM KT+ ALLETKCA+F TGF+  D+  D   +   H  E+D+LM P
Sbjct: 323 FHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEP 382

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
             N FGSTKWELNDMNP EVYQFNM+IAGFRGKRYHAI+V
Sbjct: 383 VHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/400 (70%), Positives = 329/400 (82%), Gaps = 2/400 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           IMGFVRNALGLDPP SPDEPT ENRFH W+QSPSPD             CPVTG++I Y+
Sbjct: 23  IMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYT 82

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C +SGIPTHHSREAWE+D +Y +SKR   L+KVN+YEHDLRSGRPF EFDFP +Q  DRM
Sbjct: 83  CPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRM 142

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLF YTR F+SMDT+FQLAAVTKMLSYPITIGS+LHQFSPY+L P+GPITLEGL
Sbjct: 143 VNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGL 202

Query: 211 KSLAALRYTLYPESES--ARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP+         ++ P+RIF+LGARAEAQLPGHVWKQLQ++FP + MEIH
Sbjct: 203 KSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQLPGHVWKQLQFMFPETQMEIH 262

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           F+GPE+ YDR ++EYVHS+ P+ +RVD TL  V+HTDY HVFHEAQDFFPYDPY D+FFC
Sbjct: 263 FVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFHVFHEAQDFFPYDPYTDIFFC 322

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPGFA+ E R +WM KT+ ALLETKCAIF TGF+  D+  D +A+ A +  E+D++M P
Sbjct: 323 FHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQRDLDAVVAEYGKELDIIMDP 382

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
            KN FGSTKWELND+NP EVYQFNM++AGFRGKRYHAI+V
Sbjct: 383 AKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIEV 422

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/399 (69%), Positives = 326/399 (81%), Gaps = 2/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SPD+PT ENRFH W+QSPSPD             CPVTGK+I Y+
Sbjct: 30  LMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERAARIRTLARCPVTGKEINYT 89

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWEQD+EYH SKR+  L+KVN+YEHDLRSGRPF EFDFP++QG+DRM
Sbjct: 90  CPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLRSGRPFPEFDFPRDQGQDRM 149

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM NWDLFLYTR FYSMDT+FQ+AAVTKMLSYPITIGS+LHQFSPY+L+P+GPI+LEGL
Sbjct: 150 VNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVLHQFSPYSLQPKGPISLEGL 209

Query: 211 KSLAALRYTLYPESES--ARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP          +++PMRIFILGARAE+QLPGHVWKQLQYLFP    EIH
Sbjct: 210 KSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLPGHVWKQLQYLFPEQTFEIH 269

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           FIGPE+ YD+ +K+Y+  +TP+++ VD TLKL++HT+Y H  HEAQDFFPYDPY DVFF 
Sbjct: 270 FIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHKLHEAQDFFPYDPYMDVFFI 329

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPGFASAE    WM  T+  LL+TKCAIF TGF ++D+  D   ++  +  E+D+LM P
Sbjct: 330 FHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLEDIAVVQDKYGKELDILMKP 389

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
           TKN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRY  I+
Sbjct: 390 TKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/399 (68%), Positives = 324/399 (81%), Gaps = 1/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           I+GFVRNALGLDPP SPD+PT ENRFH+W+QSP+ D             CPVTGK+I Y+
Sbjct: 17  IIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQCPVTGKEINYT 76

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHS+EAWEQD++YH SK+W  L+KVN+YEHDLRSGRPF EFDFPQ+   DR 
Sbjct: 77  CPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEFDFPQDLEFDRT 136

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM NWDLF YTRQFYSMDT+FQLAAVTKMLSYPITI S+L+QFSPY+L P+GPITLEGL
Sbjct: 137 VNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSLNPKGPITLEGL 196

Query: 211 KSLAALRYTLYP-ESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHF 269
           KSLAALRYTLYP E+++  A + +PMR+FILGARAEA LPGHVWKQLQ+LFP +  E+HF
Sbjct: 197 KSLAALRYTLYPFENKTVAATKDRPMRLFILGARAEALLPGHVWKQLQFLFPETAFELHF 256

Query: 270 IGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFCF 329
           IGPE L ++++ +YV S  PV KR+D TL  V+HTDY HV+H+AQDFFPYDPY D FFCF
Sbjct: 257 IGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFFPYDPYLDAFFCF 316

Query: 330 HPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHPT 389
           HPGF + E    W++KT+P LLETKCAIF TG ++  +  D  A+   H  E+D+LM PT
Sbjct: 317 HPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDKHSKEIDILMEPT 376

Query: 390 KNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           KNI+GSTKWELND+NP EVYQFNMYIAGFRGKRYHAI++
Sbjct: 377 KNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/399 (70%), Positives = 324/399 (81%), Gaps = 2/399 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SP++PT ENRFH W+QSPS D             CPVTGKDI Y+
Sbjct: 36  LMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYT 95

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ+QG D+ 
Sbjct: 96  CPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKA 155

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGSLLH+FSPY+L P+GPITLEGL
Sbjct: 156 VNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGL 215

Query: 211 KSLAALRYTLYP-ESESA-RAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KSLAALRYTLYP E+ S     +++ MRIFILGARAEAQLPGHVWKQLQ+LFP  + EIH
Sbjct: 216 KSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIH 275

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           FIGPE LY R ++EYV S+TPV +RVD TLK ++ T++  VFHEAQDFFPYDPY DVFF 
Sbjct: 276 FIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFT 335

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D   +++ +  EMDVLM P
Sbjct: 336 FHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEP 395

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
            +N+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 396 VRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/407 (68%), Positives = 323/407 (79%), Gaps = 10/407 (2%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGL+PP SP +PT ENRFH W+QSP                CPVTG ++ Y+
Sbjct: 31  LMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGLNVEYT 90

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWEQD +YH +KR+ TL+KVN+YEHDLRSGRPF EFDFPQEQG D++
Sbjct: 91  CPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQGYDKV 150

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM NWDLF YTR FYSMDT+FQLAAVTKMLSYP+TI SLL QFSPY+L P+GPITLEGL
Sbjct: 151 VNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPITLEGL 210

Query: 211 KSLAALRYTLYPES--ESARA--------VRSKPMRIFILGARAEAQLPGHVWKQLQYLF 260
           KSLAA+RYTLY +S   SARA        ++++PMR+F+LGARAEAQLPGHVWKQL YLF
Sbjct: 211 KSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQLSYLF 270

Query: 261 PGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYD 320
           P  + E+ FIGPE+ YDR R +YV S TPV ++VD TLK +H+TDY HV HE+QDFFPYD
Sbjct: 271 PEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQDFFPYD 330

Query: 321 PYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDA 380
           PY D FF FHPGFAS E R +W+  T+PALL+TKCAIF TGF RDD+  D   L     +
Sbjct: 331 PYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLNEKFGS 390

Query: 381 EMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
           EMD+LM PTKN+FGSTKWELND+NPHEVYQFNMYIAGFRGKRYH I+
Sbjct: 391 EMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/402 (67%), Positives = 318/402 (79%), Gaps = 4/402 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDPP SPD+PT ENRFH W+QSP  D             CPVT KDI Y+
Sbjct: 24  LMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDINYT 83

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHH +EAW  D++YH SKR+  L+KVN+YEHDLRSGRPF EFDFPQ+Q  DR+
Sbjct: 84  CPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDYDRL 143

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           +N+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGSLLHQFSPY+L P+GP+TLEGL
Sbjct: 144 INLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTLEGL 203

Query: 211 KSLAALRYTLYPESESARAV----RSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNME 266
           KSLAALRYTLYP    ++ V    R +PMRIFILGARAEAQLPGHVWKQ QYLFP    E
Sbjct: 204 KSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQEFE 263

Query: 267 IHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVF 326
           IHFIGPE   ++++ +Y+ SSTP+ K+VD TLKLV H DY HVFHEAQDFFPYDP+ DVF
Sbjct: 264 IHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFLDVF 323

Query: 327 FCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLM 386
           F FHPG+A  E    W+ +T+ ALL+TKCAIF TGF + D+  D + ++  +  E+D+LM
Sbjct: 324 FTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELDMLM 383

Query: 387 HPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
            P KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYHAI+V
Sbjct: 384 DPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/400 (66%), Positives = 319/400 (79%), Gaps = 3/400 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFV+NALGLDP  SPD+PT ENRFH W+QSPSPD             CPVT K+I Y+
Sbjct: 36  LMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPVTKKEINYT 95

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWE D++YH+SKR+  L+KVN+YEHDLRSGRPF EFDFP +Q  DR+
Sbjct: 96  CPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFPLDQIHDRV 155

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYP+TIGS+LHQFSPY+L P+GPITLEGL
Sbjct: 156 VNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPKGPITLEGL 215

Query: 211 KSLAALRYTLYP---ESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEI 267
           KSLAALRY+LYP   +S  +  +  +PMRIFILGARAEAQLPGHVWKQLQ+LFP    EI
Sbjct: 216 KSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQTFEI 275

Query: 268 HFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFF 327
           HFIG E L + ++ +Y+ S+ PV K++D T+KL++H+DY HV+HEAQDF PYDPY DVFF
Sbjct: 276 HFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPYDPYLDVFF 335

Query: 328 CFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMH 387
            FHPGFA+ E    WM  T+ ALLETKCAIF TGF++ D+  D E ++A +  EMD LM 
Sbjct: 336 TFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYGKEMDTLMD 395

Query: 388 PTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427
           P KN +GSTKWELNDMNP E++QFNMY+AGFRGKRYH I+
Sbjct: 396 PIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIK 435

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/400 (64%), Positives = 309/400 (77%), Gaps = 2/400 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVRNALGLDP +SPD+PT ENRFH W+QSP  D             CPVT K+I Y+
Sbjct: 44  LMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIRTLAHCPVTNKEINYT 103

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHS+ AWE DE YH +K +  L+KVN+YEHDLRSGRPF EF FPQ+Q  DRM
Sbjct: 104 CPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRPFPEFVFPQDQDFDRM 163

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           +NM NWDLFLYTR FYSMDT+FQ+AAVTKMLSYPITIGS+LHQFSPY+L+P+GPITLEGL
Sbjct: 164 INMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFSPYSLQPKGPITLEGL 223

Query: 211 KSLAALRYTLYP--ESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIH 268
           KS+AALRYTLYP          +++PMRIF+LGARAEAQLPGH+WKQLQYLFP    E+ 
Sbjct: 224 KSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIWKQLQYLFPEQKFELF 283

Query: 269 FIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFC 328
           FIGPEA YD+++K+Y+    P+ + +D TLKL   T+Y H  HE+QD FPYDPY DVFF 
Sbjct: 284 FIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHESQDLFPYDPYMDVFFI 343

Query: 329 FHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHP 388
           FHPGF++ E    WM+ T+ +LLET+CAIF TGF R+DM  D   L   +  ++D+LM P
Sbjct: 344 FHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNILDEKYKNDLDILMKP 403

Query: 389 TKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
            KN+FGSTKWELND+NP +VYQFNMYIAGFRGKRY  +++
Sbjct: 404 VKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/398 (62%), Positives = 306/398 (76%), Gaps = 2/398 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           ++GFV+NALG+DPP  P EP   NRF+ W++SPSP              CPVTGK+IR++
Sbjct: 32  LVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIRFT 91

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTH+S+EAWE D  YH++K +  LRKVN+YEHDLRSGRPF EFDFP EQ RD  
Sbjct: 92  CPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARDST 151

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VNM NWDLF YTRQFYSMDT+FQLA VTKMLSYPITIGS+L+++SPY L P+GP+TLEGL
Sbjct: 152 VNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLEGL 211

Query: 211 KSLAALRYTLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHFI 270
           KSLAALRYTL   + +    +++PMRIFILGARAE+QLP H+WKQLQ+LFP    EI+FI
Sbjct: 212 KSLAALRYTL--RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFEINFI 269

Query: 271 GPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFFCFH 330
           GPE     Q   Y+ S + + KRVD +L L ++ DY   FH+AQDFFPYDPYND+FF FH
Sbjct: 270 GPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIFFTFH 329

Query: 331 PGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMHPTK 390
           PGFAS E   +WM  T+ ALL+TKCAIF TGF +DD+  D  +++ ++  E+D+LM+P K
Sbjct: 330 PGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLMNPIK 389

Query: 391 NIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           N+FGSTKWELND+NP +VYQFNMYIAGFRGKRYH ++ 
Sbjct: 390 NVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  543 bits (1400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/428 (60%), Positives = 306/428 (71%), Gaps = 4/428 (0%)

Query: 1   MLVSRLPQLAARPYXXXXXXXXXXXXXXXPIMGFVRNALGLDPPASPDEPTDENRFHVWE 60
           ML+SR+  L                     IMG+VRNA GL+P  SPD P   NRFH WE
Sbjct: 1   MLLSRVLTLGKHAPYESFHTEIVRYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWE 60

Query: 61  QSPSPDXXXXXXXXXXXXXCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATL 120
           +SP  D             CPVTGK+I Y+C  SGIPTHHSR+AWE D +YH++K +  L
Sbjct: 61  ESPCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKL 120

Query: 121 RKVNVYEHDLRSGRPFAEFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKM 180
           +KVN+YEHDLRSGR F EFDFP EQGRDR VN+ NWDLFLYTRQFYSMDT+F LA VTKM
Sbjct: 121 KKVNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKM 180

Query: 181 LSYPITIGSLLHQFSPYALEPRGPITLEGLKSLAALRYTLYPESESARAVRSKPMRIFIL 240
           LSYPITI S+LH+FSPY L+PRGP+TLEGLKS+AALRYTLYP+        + PMRIFI+
Sbjct: 181 LSYPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSLSNNSPMRIFIV 240

Query: 241 GARAEAQLPGHVWKQLQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKL 300
           G RAE+QLPGHVWKQLQYLF     EIHFIGPE     Q KE  ++STP+ K+VD TL L
Sbjct: 241 GTRAESQLPGHVWKQLQYLFSERIFEIHFIGPEC----QLKEPKNTSTPLIKKVDDTLSL 296

Query: 301 VHHTDYLHVFHEAQDFFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVT 360
           ++H  Y H  H++ D FPY+PY DVFF FHPGFA  + R  W+D+T+P LLETKCAIF T
Sbjct: 297 IYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHT 356

Query: 361 GFHRDDMFGDFEALRASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRG 420
           GF+  D+  D   +   +  E+DVLM P KN+FGS KWELND+NP EVYQFNMYIAGFRG
Sbjct: 357 GFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRG 416

Query: 421 KRYHAIQV 428
           KRYH I++
Sbjct: 417 KRYHPIKI 424

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 306/401 (76%), Gaps = 4/401 (0%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           ++GFVRNALGL+PP +PDEP   NRF+ W+QSPSP+             CP+TGK+I Y+
Sbjct: 27  LVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAAKIKAMARCPITGKEINYT 86

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSREAWEQDE YHR+K    L+KVN+YEHDLRSGR F EFDFP +Q  DR 
Sbjct: 87  CPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRSGRSFPEFDFPSDQTFDRA 146

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           VN+ NWDL+ YTR FYSMDT+FQLA VTKMLSYPITI S+LHQ+SPY+L P GPITLEGL
Sbjct: 147 VNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLHQYSPYSLYPHGPITLEGL 206

Query: 211 KSLAALRYTLYP-ESESARAV--RSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEI 267
           KS+AALRY+LYP + +S+R+V  +++PMRIFILGARAE+QLPGHVWKQ QYLFP    EI
Sbjct: 207 KSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLPGHVWKQFQYLFPLQTFEI 266

Query: 268 HFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDVFF 327
            FIGPE    R+    V  +  + KR+D T+ LV+H    H  H+AQDFFPYDPYNDVFF
Sbjct: 267 IFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHDIHKAQDFFPYDPYNDVFF 325

Query: 328 CFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVLMH 387
            FHPGFAS E +  WM+ TV ALL+TKCA+F TGF + D+  D + L   +  ++D LM 
Sbjct: 326 VFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSNDVKLLNKMYGDKLDTLMT 385

Query: 388 PTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           P KN+FGSTKWELND+NP EVYQFNMYI+ FRGKRYH I++
Sbjct: 386 PVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/410 (60%), Positives = 308/410 (75%), Gaps = 14/410 (3%)

Query: 31  IMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYS 90
           +MGFVR+ LGLDPP SP++PT ENRFH WE SP  D             CPV+  DI Y+
Sbjct: 27  LMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAARIKTMAKCPVSNLDINYT 86

Query: 91  CERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRM 150
           C  SGIPTHHSR+ WE D  YH++     L+KVN+YEHDLRSGRPF EFDFP+EQ  D +
Sbjct: 87  CPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRSGRPFPEFDFPREQEYDTV 146

Query: 151 VNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGL 210
           +N++NWDL+ YTR F+SMDT+FQLAAVTKMLSYP+TI S+LHQFSPY+L P+GP+TLEGL
Sbjct: 147 INLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLHQFSPYSLTPKGPVTLEGL 206

Query: 211 KSLAALRYTLYPESES------------ARAVRSKPMRIFILGARAEAQLPGHVWKQLQY 258
           KSLAALRYTL   S S                +++PMRIFILGARAEAQLP HVWKQLQY
Sbjct: 207 KSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFILGARAEAQLPPHVWKQLQY 266

Query: 259 LFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFP 318
           LFP SN EIHFIGPE+L  + +  YV S+TP++KR+D ++ LV+HTDY HV+H+AQDF+P
Sbjct: 267 LFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSLVYHTDYFHVYHKAQDFYP 326

Query: 319 YDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASH 378
           YDPY D+FF FHPG A+   + +W+++T+  LL++KC IF+TGFH  D+  D   L  + 
Sbjct: 327 YDPYFDIFFMFHPGLAAT--KETWLNETMQGLLDSKCPIFMTGFHEKDITADISVLNKNF 384

Query: 379 DAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
             +MD+LM P KN+FGSTKWELND NP EVYQFNMYIAG+RGKRYHA + 
Sbjct: 385 SKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRGKRYHATET 434

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/411 (59%), Positives = 303/411 (73%), Gaps = 16/411 (3%)

Query: 32  MGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDXXXXXXXXXXXXXCPVTGKDIRYSC 91
           +GFV+NALG++PP SP+EP  ENRFH W+QSPSPD             CPVTGK+I Y+C
Sbjct: 42  VGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKEINYTC 101

Query: 92  ERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGRDRMV 151
             SGIPTHHS+EAWE D  YH++K +  L+KVNV+EHDLRSGR F EF+FPQ Q  D  V
Sbjct: 102 PISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQDHDCAV 161

Query: 152 NMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITLEGLK 211
           +M NWD+F YTRQF SMD++FQLA VTKMLSYPITI S+LH++ PYALEP GPITLEGLK
Sbjct: 162 SMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPITLEGLK 221

Query: 212 SLAALRYTLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNMEIHFIG 271
           S+AAL+Y+L          + +PMRIFILGARAE+QLP H+WKQ  YLFP  N EI+FIG
Sbjct: 222 SIAALKYSL--RHNEFETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQNFEINFIG 279

Query: 272 PEA----LYDRQRKEYVHSSTP----------VSKRVDGTLKLVHHTDYLHVFHEAQDFF 317
           PE       +    E  +++T           + KR+D  L LV+HTD+ H  H A+DFF
Sbjct: 280 PECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTLHNARDFF 339

Query: 318 PYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRAS 377
           PYD YNDVFF FHPGFAS E   SWM +T+ ALL+TKCAIF TGF++ D+  D + ++ +
Sbjct: 340 PYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKDIDIVQET 399

Query: 378 HDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428
           +  E+D+LM PTKN+FGSTKWELNDM+P EVYQ+NMYIAGFRGKRYHA++V
Sbjct: 400 YGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVKV 450

>TDEL0H01990 Chr8 complement(342304..343365) [1062 bp, 353 aa] {ON}
           Anc_7.245 YIL055C
          Length = 353

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 3/45 (6%)

Query: 218 YTLYPESESARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPG 262
           YTL  +S+  R  R     IF+   R +   PG  WKQ++YL  G
Sbjct: 19  YTLAKDSDITRCARMSDRVIFL---RIDNLPPGKTWKQVKYLIGG 60

>KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {ON}
           some similarities with uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 837

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 104 AWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAE 138
           A    E+ +R K W ++  ++++EH LR G PF +
Sbjct: 437 ATTVQEKLYRRKLWLSICSISLHEHTLRGGEPFVK 471

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,734,045
Number of extensions: 1862232
Number of successful extensions: 3388
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3432
Number of HSP's successfully gapped: 27
Length of query: 428
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 316
Effective length of database: 40,638,807
Effective search space: 12841863012
Effective search space used: 12841863012
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)