Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL151C7.347ON20820810431e-146
Ecym_47267.347ON1911918591e-118
KLLA0D12408g7.347ON1841917186e-97
SAKL0F11308g7.347ON1911976728e-90
Kwal_56.246347.347ON1901966458e-86
KLTH0H01320g7.347ON1901966398e-85
ZYRO0F11638g7.347ON1911986284e-83
YDL165W (CDC36)7.347ON1912016242e-82
Suva_4.817.347ON1912016215e-82
Skud_4.927.347ON1912016207e-82
Smik_4.737.347ON1912016199e-82
TDEL0C020107.347ON1911986181e-81
KAFR0B008507.347ON1921996172e-81
NDAI0A019207.347ON1932006111e-80
TPHA0F029407.347ON1912016024e-79
Kpol_530.347.347ON1911985981e-78
NCAS0A141307.347ON1911985963e-78
CAGL0I03388g7.347ON1911985921e-77
KNAG0C037607.347ON1911985912e-77
TBLA0E005107.347ON2871425681e-72
ZYRO0C16588g3.370ON608961143e-06
SAKL0B08052g3.370ON576961082e-05
Kwal_23.39623.370ON553931055e-05
KAFR0H008603.370ON578941055e-05
CAGL0D01342g3.370ON548811056e-05
KLTH0F11880g3.370ON563931031e-04
Kpol_1006.73.370ON540961021e-04
NDAI0A050803.370ON575941012e-04
YPR072W (NOT5)3.370ON560961002e-04
TPHA0A035003.370ON54894993e-04
KNAG0A072903.370ON50781984e-04
Skud_16.3613.370ON56096985e-04
Suva_16.4013.370ON56596976e-04
Smik_16.3163.370ON56094968e-04
TBLA0H014903.370ON55293940.001
Ecym_34563.370ON508117910.003
TDEL0C051203.370ON56294900.005
ADL364C3.370ON504112870.010
KLTH0A03652g7.214ON77280820.047
KLLA0B09196g3.370ON59080810.067
NDAI0A026907.214ON84681760.28
Kpol_1070.257.214ON68683750.32
NCAS0A112103.370ON582166740.52
NCAS0A133507.214ON800111730.70
TDEL0H023307.214ON81281720.79
ZYRO0D16302g7.214ON82981701.6
TBLA0D042707.214ON84797682.5
KLLA0E04335g7.214ON75881673.2
TPHA0C012907.214ON78682656.6
Kwal_47.181147.214ON76380647.6
TDEL0C053803.401ON237174648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL151C
         (208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   406   e-146
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   335   e-118
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   281   6e-97
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   263   8e-90
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   253   8e-86
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   250   8e-85
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   246   4e-83
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   244   2e-82
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   243   5e-82
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   243   7e-82
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   243   9e-82
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   242   1e-81
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   242   2e-81
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   239   1e-80
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   236   4e-79
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   234   1e-78
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   234   3e-78
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   232   1e-77
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   232   2e-77
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   223   1e-72
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    49   3e-06
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    46   2e-05
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    45   5e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    45   5e-05
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    45   6e-05
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   1e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    44   1e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    44   2e-04
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    43   2e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    43   3e-04
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    42   4e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    42   5e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    42   6e-04
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    42   8e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    41   0.001
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    40   0.003
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    39   0.005
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    38   0.010
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    36   0.047
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    36   0.067
NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {O...    34   0.28 
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    33   0.32 
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    33   0.52 
NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON} Anc_7...    33   0.70 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    32   0.79 
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    32   1.6  
TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa] ...    31   2.5  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    30   3.2  
TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {O...    30   6.6  
Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038...    29   7.6  
TDEL0C05380 Chr3 (960131..967246) [7116 bp, 2371 aa] {ON} Anc_3....    29   8.7  

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  406 bits (1043), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 194/208 (93%)

Query: 1   MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEKQYDAFMTLGXXXXXXXXXXXXXXKDG 60
           MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEKQYDAFMTLG              KDG
Sbjct: 1   MVPMPHVAPSKAVEQLNMDKYGLKGLLPVIKHEKQYDAFMTLGVDVSSLLHSLQVSSKDG 60

Query: 61  YNTALSNGHHALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPR 120
           YNTALSNGHHALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPR
Sbjct: 61  YNTALSNGHHALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPR 120

Query: 121 ISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTS 180
           ISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTS
Sbjct: 121 ISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTS 180

Query: 181 ERGSYVFFDPQRWEKCQRDFILNYSAIM 208
           ERGSYVFFDPQRWEKCQRDFILNYSAIM
Sbjct: 181 ERGSYVFFDPQRWEKCQRDFILNYSAIM 208

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 167/191 (87%)

Query: 18  MDKYGLKGLLPVIKHEKQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHALDTFPS 77
           M KYGLK LLPVIKH+KQYD+ MTLG              +D YN+ L+NGHH LDTFPS
Sbjct: 1   MSKYGLKSLLPVIKHDKQYDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDTFPS 60

Query: 78  PWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHP 137
           PWVETSRSEVEPKFFIPESF NI GVLGQ ST FTSVARDHPRISLLQDETLFYLFYKHP
Sbjct: 61  PWVETSRSEVEPKFFIPESFKNIVGVLGQPSTYFTSVARDHPRISLLQDETLFYLFYKHP 120

Query: 138 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 197
           GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 180

Query: 198 RDFILNYSAIM 208
           RDFILNY+AIM
Sbjct: 181 RDFILNYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  281 bits (718), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 134/191 (70%), Positives = 151/191 (79%), Gaps = 7/191 (3%)

Query: 18  MDKYGLKGLLPVIKHEKQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHALDTFPS 77
           M+KYGLK L+PV++H+  YDA MTLG                   T  +  HH LD F S
Sbjct: 1   MEKYGLKDLVPVLRHDPTYDANMTLGIDLNSLLNSLDI-------TKDTKSHHCLDAFES 53

Query: 78  PWVETSRSEVEPKFFIPESFCNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHP 137
           PWVETSRSEV+P FFIPESF NI G+LG    +FTSV RD PRISLLQDETLFYLFYKHP
Sbjct: 54  PWVETSRSEVQPTFFIPESFKNIKGMLGTDQVEFTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 138 GTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQ 197
           G+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+QDS SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 198 RDFILNYSAIM 208
           RDF+L+Y+AIM
Sbjct: 174 RDFVLHYNAIM 184

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  263 bits (672), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 146/197 (74%), Gaps = 10/197 (5%)

Query: 16  LNMDKYGLKGLLPVIKHE---KQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           + ++KYGLK LLP+IK E    +YD  MT+G                 Y T        L
Sbjct: 1   MAVEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKT------RVL 54

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST-DFTSVARDHPRISLLQDETLFY 131
           DTFPSPWVETSRSEVEPKFF PESF NI  VL   S   F SV +DHP+I+L QDETLFY
Sbjct: 55  DTFPSPWVETSRSEVEPKFFTPESFVNIPNVLQSPSPPSFNSVQQDHPKIALFQDETLFY 114

Query: 132 LFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQ 191
           LFYKHPGTV+QE+TYLELRKRNWRYHKTLKVWLTKDP+MEP+VSQD  SERGSYVFFDPQ
Sbjct: 115 LFYKHPGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQ 174

Query: 192 RWEKCQRDFILNYSAIM 208
           RWEKCQRDF+L Y+AIM
Sbjct: 175 RWEKCQRDFVLFYNAIM 191

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  253 bits (645), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 144/196 (73%), Gaps = 11/196 (5%)

Query: 18  MDKYGLKGLLPVIKHEKQ---YDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHALDT 74
           M+KYGL  LLP+I+ E Q   YD+ MTLG                G  +  S  +  LDT
Sbjct: 1   MEKYGLSALLPLIRREDQSPEYDSSMTLGIDLSPVLHSL------GIASNQSTRYRVLDT 54

Query: 75  FPSPWVETSRSEVEPKFFIPESFCNIGGVL--GQASTDFTSVARDHPRISLLQDETLFYL 132
           F SPWVETSRSEVEPKFF+PESF NI  VL  G     F SV +DH +ISL QDETLFYL
Sbjct: 55  FQSPWVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYL 114

Query: 133 FYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR 192
           FYKHPG+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+    SERGSYVFFDPQR
Sbjct: 115 FYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQR 174

Query: 193 WEKCQRDFILNYSAIM 208
           WEKCQRDF+L Y+AIM
Sbjct: 175 WEKCQRDFVLFYNAIM 190

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  250 bits (639), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 127/196 (64%), Positives = 144/196 (73%), Gaps = 11/196 (5%)

Query: 18  MDKYGLKGLLPVIKHEKQ---YDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHALDT 74
           M+KYGL  LLP+I+ E Q   YD+ MTLG                G      + +  LDT
Sbjct: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSL------GIPNNQPSRNRVLDT 54

Query: 75  FPSPWVETSRSEVEPKFFIPESFCNIGGVL--GQASTDFTSVARDHPRISLLQDETLFYL 132
           F SPWVETSRSEVEPKFF+PESF NI  VL  G+    F SV +DH +ISL QDETLFYL
Sbjct: 55  FQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYL 114

Query: 133 FYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR 192
           FYKHPG+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+    SERGSYVFFDPQR
Sbjct: 115 FYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQR 174

Query: 193 WEKCQRDFILNYSAIM 208
           WEKCQRDF+L Y+AIM
Sbjct: 175 WEKCQRDFVLFYNAIM 190

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  246 bits (628), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 126/198 (63%), Positives = 140/198 (70%), Gaps = 14/198 (7%)

Query: 18  MDKYGLKGLLPVIKHEK-----QYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           MDK+GL+ L+P++K E      +YD  MTLG                      S  H  L
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRD-------SKRHKVL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130
           DTF SPW ETSRSEVEP+FFIPESF NI  VL   ST   F SV +D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLF 113

Query: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173

Query: 191 QRWEKCQRDFILNYSAIM 208
           QRWEKCQRDF+L Y+AIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  244 bits (624), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 142/201 (70%), Gaps = 20/201 (9%)

Query: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGXXXXXXXXXXXXXXKDGYNTAL---SNGH 69
           M+K+GLK L+P++K E +     YD  MTLG                 Y+  +   S  H
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSML----------YSLGIPRDSQDH 50

Query: 70  HALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDE 127
             LDTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDE
Sbjct: 51  RVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDE 110

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLF+LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVF
Sbjct: 111 TLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVF 170

Query: 188 FDPQRWEKCQRDFILNYSAIM 208
           FDPQRWEKCQRDF+L Y+AIM
Sbjct: 171 FDPQRWEKCQRDFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  243 bits (621), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 141/201 (70%), Gaps = 20/201 (9%)

Query: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGXXXXXXXXXXXXXXKDGYNTAL---SNGH 69
           MDK+GL+ L+P++K E +     YD  MTLG                 Y+  +   S  H
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSML----------YSLGIPRDSQDH 50

Query: 70  HALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDE 127
             LDTF SPW ETSRSEVEP+FF PESF NI  VL    T   F S+  D  R++L QDE
Sbjct: 51  RVLDTFQSPWAETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDE 110

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLF+LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVF
Sbjct: 111 TLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVF 170

Query: 188 FDPQRWEKCQRDFILNYSAIM 208
           FDPQRWEKCQRDF+L Y+AIM
Sbjct: 171 FDPQRWEKCQRDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  243 bits (620), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 142/201 (70%), Gaps = 20/201 (9%)

Query: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGXXXXXXXXXXXXXXKDGYNTAL---SNGH 69
           M+K+GL+ L+P++K E +     YD  MTLG                 Y+  +   S  H
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSML----------YSLGIPRDSQDH 50

Query: 70  HALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDE 127
             LDTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDE
Sbjct: 51  RVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDE 110

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLF+LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVF
Sbjct: 111 TLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVF 170

Query: 188 FDPQRWEKCQRDFILNYSAIM 208
           FDPQRWEKCQRDF+L Y+AIM
Sbjct: 171 FDPQRWEKCQRDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  243 bits (619), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 124/201 (61%), Positives = 142/201 (70%), Gaps = 20/201 (9%)

Query: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGXXXXXXXXXXXXXXKDGYNTAL---SNGH 69
           M+K+GL+ L+P++K E +     YD  MTLG                 Y+  +   S  H
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSML----------YSLGIPRDSQDH 50

Query: 70  HALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDE 127
             LDTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDE
Sbjct: 51  RVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDE 110

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLF+LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVF
Sbjct: 111 TLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVF 170

Query: 188 FDPQRWEKCQRDFILNYSAIM 208
           FDPQRWEKCQRDF+L Y+AIM
Sbjct: 171 FDPQRWEKCQRDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  242 bits (618), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 124/198 (62%), Positives = 140/198 (70%), Gaps = 14/198 (7%)

Query: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           M+K+GLK L+P+IK E++     YD  +TLG                      S  H  L
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRD-------SKRHRVL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130
           DTF SPW ETSRSEVEPKFFIP+SF NI  VL   +T   F SV  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLF 113

Query: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDP 173

Query: 191 QRWEKCQRDFILNYSAIM 208
           QRWEKCQR+F+L Y+AIM
Sbjct: 174 QRWEKCQREFLLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  242 bits (617), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 138/199 (69%), Gaps = 15/199 (7%)

Query: 18  MDKYGLKGLLPVIKHE------KQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHA 71
           MDK+GLK L+P+IK +       QYD  MTLG                 +       H  
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQH-------HRV 53

Query: 72  LDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETL 129
           LDTF SPW ETSRSEVEPKF IP+SF NI  VL    T   F S+  D  R++L QDETL
Sbjct: 54  LDTFQSPWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETL 113

Query: 130 FYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFD 189
           FYLFYKHP TV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVSQD  SE+GSYVFFD
Sbjct: 114 FYLFYKHPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFD 173

Query: 190 PQRWEKCQRDFILNYSAIM 208
           PQRWEKCQRDF+L Y+AIM
Sbjct: 174 PQRWEKCQRDFLLFYNAIM 192

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  239 bits (611), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 123/200 (61%), Positives = 140/200 (70%), Gaps = 16/200 (8%)

Query: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           MDK+GL+ L+P+IK +     K YD  MTLG                      S  H  L
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRD-------SKRHRVL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD----FTSVARDHPRISLLQDET 128
           DTF SPW ETSRSEVEP FFIP+SF +I  VL   + D    F SV +D  R++L QDET
Sbjct: 54  DTFQSPWAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDET 113

Query: 129 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFF 188
           LFYLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEP+VS D  SERGSYVFF
Sbjct: 114 LFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFF 173

Query: 189 DPQRWEKCQRDFILNYSAIM 208
           DPQRWEKCQR+F+L Y+AIM
Sbjct: 174 DPQRWEKCQREFLLFYNAIM 193

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  236 bits (602), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 120/201 (59%), Positives = 141/201 (70%), Gaps = 20/201 (9%)

Query: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNG---H 69
           MDK+GL+ LLP+IK +     K+Y+  MT+G                 ++  + N    +
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQ----------HSLGIPNNNKRY 50

Query: 70  HALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDE 127
             LDTF SPW ETSRSEVEP++F P+SF NI  VL    T   F SV  D  RISL QDE
Sbjct: 51  RVLDTFQSPWAETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDE 110

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLFYLFYKHPGTV+QELTYLELRKRNWRYHK LK WLTKDP++EPIV+ D  SERGSY+F
Sbjct: 111 TLFYLFYKHPGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIF 170

Query: 188 FDPQRWEKCQRDFILNYSAIM 208
           FDPQRWEKCQRDF+L Y+AIM
Sbjct: 171 FDPQRWEKCQRDFVLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  234 bits (598), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 118/198 (59%), Positives = 139/198 (70%), Gaps = 14/198 (7%)

Query: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           MDK+GL+ LLP+IK +     K+Y+  MT+G               +         +  L
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDN-------QRYRIL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130
           DTF SPW ETSRSEVEP+FF PESF NI  VL    T   F S+  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLF 113

Query: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP++EP+VS D  SERGSY+FFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDP 173

Query: 191 QRWEKCQRDFILNYSAIM 208
           QRWEKCQR+F+L Y+AIM
Sbjct: 174 QRWEKCQREFVLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  234 bits (596), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 134/198 (67%), Gaps = 14/198 (7%)

Query: 18  MDKYGLKGLLPVIKHE-----KQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           MDK+GLK L+P+++ +     K YD  MTLG               +         H  L
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDN-------TRHRVL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST--DFTSVARDHPRISLLQDETLF 130
           DTF SPW ETSRSEVEP FFIP+SF  I GVL    T   F S   D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLF 113

Query: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190
           YLFYKHPGTVLQELTYLELR RNWRYH TL+ WLTKDPLMEP VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDP 173

Query: 191 QRWEKCQRDFILNYSAIM 208
           QRWEKCQ+DF+L Y+AIM
Sbjct: 174 QRWEKCQKDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  232 bits (592), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 137/198 (69%), Gaps = 14/198 (7%)

Query: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           M K+GL+ L+P+I+ +++     YD  MT+G                      S  H  L
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRD-------SKHHRVL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST--DFTSVARDHPRISLLQDETLF 130
           DTF SPW ETSRSEVEPK++IPESF NI  VL   +T   F  V  D  R++L QDETLF
Sbjct: 54  DTFQSPWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLF 113

Query: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190
           YLFYKHPGTV+QELTYLELRKRNWRYHK LK WLTKDP+MEP+V+ D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDP 173

Query: 191 QRWEKCQRDFILNYSAIM 208
           QRWEKCQRDF L YSAIM
Sbjct: 174 QRWEKCQRDFPLFYSAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  232 bits (591), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 120/198 (60%), Positives = 133/198 (67%), Gaps = 14/198 (7%)

Query: 18  MDKYGLKGLLPVIKH-----EKQYDAFMTLGXXXXXXXXXXXXXXKDGYNTALSNGHHAL 72
           MDK+GLK L+P+++        +YD  M LG                      S     L
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRD-------SKRQAVL 53

Query: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130
            TF SPW ETSRSEVEP F+IP SF  I  VL   ST   F SV RD  R++L QDETLF
Sbjct: 54  ATFQSPWAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLF 113

Query: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190
           YLFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP MEP+VS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDP 173

Query: 191 QRWEKCQRDFILNYSAIM 208
           QRWEKCQRDF+L Y+AIM
Sbjct: 174 QRWEKCQRDFLLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  223 bits (568), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 103/142 (72%), Positives = 116/142 (81%), Gaps = 2/142 (1%)

Query: 69  HHALDTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQAST--DFTSVARDHPRISLLQD 126
           H  LDTF SPW ETSRSEV+P+FFIP SF NI  VL   +T   F ++  D  R++L QD
Sbjct: 146 HRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNVLQCNTTPPTFNNIELDQQRVALFQD 205

Query: 127 ETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYV 186
           ETLFYLFYKHPGTV+QELTYLELRKRNWR+HK LK WLTKDP+MEPIV+ D  SERGSYV
Sbjct: 206 ETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILKTWLTKDPMMEPIVAADGFSERGSYV 265

Query: 187 FFDPQRWEKCQRDFILNYSAIM 208
           FFDPQRWEKCQR+FIL Y+AIM
Sbjct: 266 FFDPQRWEKCQREFILFYNAIM 287

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 53/96 (55%), Gaps = 9/96 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +
Sbjct: 510 TSLARILRKFDL---DTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--V 564

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 203
           E +    + SE  S+ +FD QR W   +C  DFI N
Sbjct: 565 EKLPPGMAQSEEESWRYFDYQRSWLARRCNSDFIQN 600

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 53/96 (55%), Gaps = 9/96 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 170
           TS+A+   +  L   +TLF++FY + GT  Q L   EL + RNW+++K    W  K+   
Sbjct: 475 TSMAKITSKFDL---DTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEK 531

Query: 171 EP--IVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
            P  +VS ++  E  S+ +FD Q+ W   +C  DF+
Sbjct: 532 LPPGVVSSENKQEEISWRYFDYQKSWLARRCGSDFV 567

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (53%), Gaps = 8/93 (8%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLME 171
           TS+AR   +  L   +TLF++FY + GT  Q L   EL  R W+++K  + W  K+  +E
Sbjct: 457 TSLARIMSKFDL---DTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VE 511

Query: 172 PIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
            +      SE  S+ +FD Q+ W   +C  DF+
Sbjct: 512 KLPPGMEQSEEISWRYFDYQKSWLARRCGTDFV 544

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 9/94 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+A+   +  L   +TLF++FY + GT  Q L+  EL K RNW+++K  + W  K+  +
Sbjct: 481 TSLAKIFTKFDL---DTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--I 535

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
           E +    + SE  S+ +FD ++ W   +C  DF+
Sbjct: 536 EKLPPGMNKSEEESWRYFDYKKSWLARRCSPDFV 569

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 127 ETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSY 185
           +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+  +E +    + SE  S+
Sbjct: 463 DTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSEEESW 520

Query: 186 VFFD-PQRW--EKCQRDFILN 203
            +FD  + W   +C  DF+ N
Sbjct: 521 RYFDFKKSWLSRRCGSDFVYN 541

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLME 171
           TS+AR   +  L   +TLF++FY + GT  Q L+  EL  R W+++K  + W  K+  +E
Sbjct: 467 TSLARIMSKFDL---DTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKE--VE 521

Query: 172 PIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
            +      SE  S+ +FD Q+ W   +C  +F+
Sbjct: 522 KLPPGMEQSEEISWRYFDYQKSWLARRCGAEFV 554

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 9/96 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+A+   +  L   +TLF++FY + GT  Q L   EL K RNW+++K  + W  K+   
Sbjct: 443 TSLAKTFSKFDL---DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTK 499

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 203
            P   Q   +E  ++ +FD Q  W   +C  DF  N
Sbjct: 500 SPPGMQ--QAEEETWRYFDYQNSWLARRCNSDFKYN 533

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 7/94 (7%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+A+ + +  L   +TLF++FY + GT  Q L   EL K R+W+Y+K    W  K+   
Sbjct: 476 TSLAKIYTKFDL---DTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEK 532

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
            P  +  +  E  S+ +FD ++ W   +C  DF+
Sbjct: 533 LPPGANYNKDEEESWRYFDYKKSWLSRRCGNDFV 566

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +
Sbjct: 463 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--I 517

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 203
           E +      SE  S+ +FD ++ W   +C  DF+ N
Sbjct: 518 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYN 553

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 11/94 (11%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+A+   +  L   +TLF++FY + GT  Q L   EL K RNW+Y+K  + W  K+   
Sbjct: 451 TSLAKIFRKFDL---DTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTK 507

Query: 171 E-PIVSQDSTSERGSYVFFDPQR-W--EKCQRDF 200
             P ++Q   +E  ++ +FD Q  W   +C  DF
Sbjct: 508 SAPDMAQ---TEEETWRYFDYQNSWLARRCNHDF 538

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 6/81 (7%)

Query: 127 ETLFYLFYKHPGTVLQELTYLELR-KRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSY 185
           +TLF++FY + GT  Q L   EL   R+W+++K  + W  K+  +E +    + SE  S+
Sbjct: 422 DTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEEESW 479

Query: 186 VFFDPQR-W--EKCQRDFILN 203
            +FD ++ W   +C  DF+ N
Sbjct: 480 RYFDYKKSWLARRCNSDFVYN 500

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +
Sbjct: 463 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--I 517

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 203
           E +      SE  S+ +FD ++ W   +C  DF+ N
Sbjct: 518 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYN 553

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 9/96 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW +++  + W  K+  +
Sbjct: 468 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--I 522

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFILN 203
           E +      SE  S+ +FD ++ W   +C  DF+ N
Sbjct: 523 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFVYN 558

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + G+  Q L   EL + RNW ++K  + W  K+  +
Sbjct: 463 TSLARIFMKFDL---DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--I 517

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
           E +      SE  S+ +FD ++ W   +C  DF+
Sbjct: 518 EKLPPGMGKSEEESWRYFDYKKSWLARRCGNDFV 551

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (54%), Gaps = 9/93 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + GT  Q L+  EL K RNW ++K  + W  ++  +
Sbjct: 454 TSLARIFTKFDL---DTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--V 508

Query: 171 EPIVSQDSTSERGSYVFFDPQR-W--EKCQRDF 200
           E +      SE  S+ +FD Q+ W   +C  +F
Sbjct: 509 EKLPPGLPQSEEISWRYFDYQKSWLSRRCNSNF 541

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 9/117 (7%)

Query: 88  EPKFFIPESFCNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYL 147
           EP  F+  +  N  G +       TS+A+   +  L   +TLF++FY + GT  Q L   
Sbjct: 389 EPIRFVTTTL-NSSGTITNDIYGKTSMAQILTKFDL---DTLFFIFYHYQGTYEQFLAAR 444

Query: 148 ELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFI 201
           EL  R W +++  + W  ++  +E +       E  S+ +FD Q+ W   +C  DF+
Sbjct: 445 ELNIRGWLFNRVNRCWFYRE--VEKLPPGMEQKEEVSWRYFDYQKSWLARRCGPDFV 499

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 49/94 (52%), Gaps = 9/94 (9%)

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRK-RNWRYHKTLKVWLTKDPLM 170
           TS+AR   +  L   +TLF++FY + GT  Q L   EL K R W+++K  + W  K+  +
Sbjct: 464 TSLARIFTKFDL---DTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--V 518

Query: 171 EPIVSQDSTSERGSYVFFDPQ-RW--EKCQRDFI 201
           E +      +E  S+ +FD Q  W   +C  D +
Sbjct: 519 EKLPPGMLQAEEESWRYFDYQGSWLARRCNNDVV 552

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 100 IGGVLGQASTDFTSVARDHPRISLLQD------ETLFYLFYKHPGTVLQELTYLELRKRN 153
           I  V    + D TS    + + S++Q       +TLF++FY + GT  Q L   EL  R 
Sbjct: 387 IRFVAAGWNNDNTSTKDIYGKTSMVQIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRG 446

Query: 154 WRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR-W--EKCQRDFIL 202
           W +++  + W  K+  +E +       E  S+ +FD Q+ W   +C  DF+ 
Sbjct: 447 WIFNRVNRCWFYKE--VEKLPPGMDQKEEVSWRYFDYQKSWLARRCGPDFVF 496

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 129 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFF 188
           LFY FY     + QE+ Y  L +RNW+  KT + W ++  L  P  S +   E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 189 DPQRWEKCQR-DFILNYSAI 207
           +   W    + +F L+YS +
Sbjct: 724 NLDDWTVTDKLNFKLDYSIL 743

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 113 SVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEP 172
           SVA+   + +L   +TLF++FY + G+  Q L   EL  R W ++K  + W  K+  +E 
Sbjct: 494 SVAKIMSKFAL---DTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEK 548

Query: 173 IVSQDSTSERGSYVFFDPQR 192
           +       E  ++ +FD Q+
Sbjct: 549 LPPGIEGKEEVTWRYFDYQK 568

>NDAI0A02690 Chr1 complement(603611..606151) [2541 bp, 846 aa] {ON}
           Anc_7.214
          Length = 846

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLFY +Y     + +E+  + L +RNW+      +W  +     PI  Q+   E G Y  
Sbjct: 719 TLFYNYYFAVTPLEKEIANVILNERNWKVSFDETMWFLR---QGPIKFQNELCELGDYKI 775

Query: 188 FDPQRWEKCQR-DFILNYSAI 207
           F    W    + +F L+YS++
Sbjct: 776 FKLDEWLVVDKINFKLDYSSL 796

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 128 TLFYLFYKHPGTVLQ-ELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYV 186
           TLFY +Y  P T LQ +++ + L +R+W+  K   +W  K    EP  S +S  E G+Y 
Sbjct: 564 TLFYHYY-FPLTPLQKQISSILLIERDWKLLKNGTMWFLKQG--EPKFSNESF-EVGNYK 619

Query: 187 FFDPQRWEKCQR-DFILNYSAIM 208
            F    W   ++ +F L+++++M
Sbjct: 620 IFKADDWTVIEKFNFKLDFNSLM 642

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 76/166 (45%), Gaps = 33/166 (19%)

Query: 61  YNTALSNGHHALDTFPS-------PW--VETSRSEVEPKFFIPESFCNIGGVLGQASTDF 111
           Y   LSN H     FPS       P+  +++++  + P      S  ++  +  +     
Sbjct: 416 YQVPLSNPHPTSIFFPSEPIRFTYPYEVIKSNQGNLNPNDKTHASHQSVEDIYSR----- 470

Query: 112 TSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLEL-RKRNWRYHKTLKVWLTKD-PL 169
           TS+A+   +  L   +TLF++FY + GT  Q L   EL + R+W ++K    W  ++   
Sbjct: 471 TSLAKIFSKFDL---DTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCWYFREIEK 527

Query: 170 MEPIVS----------QDSTS-ERGSYVFFDPQR-W--EKCQRDFI 201
           + P ++          +DS S E  S+ +FD ++ W   +C  DF+
Sbjct: 528 LPPTINMSNTIPNNKREDSNSDEEESWRYFDYKKSWLARRCGPDFV 573

>NCAS0A13350 Chr1 (2627917..2630319) [2403 bp, 800 aa] {ON}
           Anc_7.214 YIL038C
          Length = 800

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 98  CNIGGVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYH 157
           C++  V+ ++ ++         R   L+  TLFY +Y     + +E++ + L +R+WR  
Sbjct: 641 CSLRDVISKSESETEIYQEIIQRFRGLEMFTLFYNYYFAVTPLEKEISNVILNERSWRIS 700

Query: 158 KTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRWEKCQR-DFILNYSAI 207
           K   +W  +      +  Q+   E G Y  F    W    + +F L+YS +
Sbjct: 701 KDETLWFLR---QGSVKLQNEFCEIGDYKIFKLDDWTVIDKINFKLDYSNL 748

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 32.3 bits (72), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 4/81 (4%)

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLFY +Y     + Q +  L L +RNW+  K+  +W  +    EP  + +   E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLRQ--GEPKFANE-VCEVADYKI 748

Query: 188 FDPQRWEKCQR-DFILNYSAI 207
           F    W    + +F L+Y+A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 4/81 (4%)

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLFY +Y     + QE+  + L +R+W+  K   +W  +          +   E   Y  
Sbjct: 712 TLFYNYYFAVTPLEQEIASIILSERDWKVSKNCAMWFLR---QSETKFANELCEVADYKI 768

Query: 188 FDPQRWEKCQR-DFILNYSAI 207
           F    W    R +F L+Y+A+
Sbjct: 769 FKLDDWTVIDRLNFKLDYAAL 789

>TBLA0D04270 Chr4 complement(1055025..1057568) [2544 bp, 847 aa]
           {ON} Anc_7.214 YIL038C
          Length = 847

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 98  CNIGGV-LGQASTDFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRY 156
           C++  V L QA++    + +   +   L+  TLFY +Y     + +E++ + L +R+WR 
Sbjct: 694 CSLRDVILSQANSKEDKLKKILEKFRSLETFTLFYNYYFSVTPLEKEVSMVVLAERDWRI 753

Query: 157 HKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQRW 193
                +W ++    E  +S D   E G Y  F  + W
Sbjct: 754 TNNETMWFSRQG--EAKLS-DELYEIGDYRIFSLEDW 787

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLFY +Y     + Q +  L L++R WR  KT   W  +   ++   S D   E   Y  
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCWFLRQGAVK--FSNDQC-EVADYKI 697

Query: 188 FDPQRWEKCQR-DFILNYSAI 207
           F    W    + +F L+YS +
Sbjct: 698 FKMDIWTVVDKLNFKLDYSLL 718

>TPHA0C01290 Chr3 complement(294072..296432) [2361 bp, 786 aa] {ON}
           Anc_7.214 YIL038C
          Length = 786

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 128 TLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVF 187
           TLFY FY    ++ +++    L +RNW       +W  +      I   +  SE   Y  
Sbjct: 668 TLFYNFYFSVTSMERDIAAKILVERNWIQLSNGVMWFLR---QGNIKFANENSEVADYKI 724

Query: 188 FDPQRWEKCQR-DFILNYSAIM 208
           F    W   ++ +F L+Y +IM
Sbjct: 725 FKADDWTVVEKLNFKLDYDSIM 746

>Kwal_47.18114 s47 (692928..695219) [2292 bp, 763 aa] {ON} YIL038C
           (NOT3) - CCR4 trascriptional complex component [contig
           198] FULL
          Length = 763

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 129 LFYLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFF 188
           LFY FY     + +E+ Y  L +R+W+  K+   W ++  +  P  S +   E   +  F
Sbjct: 674 LFYCFYYSITPLEREIAYTLLIERSWKVSKSGDSWFSRHGV--PKFSNE-LCEVADFKIF 730

Query: 189 DPQRWEKCQR-DFILNYSAI 207
           +   W   ++ +F L+YS +
Sbjct: 731 NLDDWTVSEKLNFKLDYSIL 750

>TDEL0C05380 Chr3 (960131..967246) [7116 bp, 2371 aa] {ON} Anc_3.401
            YBR136W
          Length = 2371

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 102  GVLGQASTDFTSVARDHPRISLLQDETLFYLFYKHPGTVLQELTYLELRKRNWRYHKTLK 161
            G LG    + + + RD  R+ L  +  +  L Y HP T L+    L  +  N R  K ++
Sbjct: 1687 GDLGTTFFNLSRLCRDSSRLDLASESLMHCLQYNHPQTELEFAEILLKQGENDRAVKLVR 1746

Query: 162  VWLTK---DPLMEP 172
                K   DP+++P
Sbjct: 1747 EINEKYKDDPMLKP 1760

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,638,388
Number of extensions: 822772
Number of successful extensions: 1716
Number of sequences better than 10.0: 58
Number of HSP's gapped: 1701
Number of HSP's successfully gapped: 58
Length of query: 208
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 103
Effective length of database: 41,441,469
Effective search space: 4268471307
Effective search space used: 4268471307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)