Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL150W7.348ON2191869011e-124
Ecym_47257.348ON2341857203e-96
SAKL0F11330g7.348ON2081846973e-93
TDEL0C020007.348ON2131836941e-92
KLLA0D12386g7.348ON2111836905e-92
KLTH0H01298g7.348ON2141836828e-91
NCAS0A141407.348ON2241806793e-90
KNAG0C037707.348ON2231856784e-90
NDAI0A019107.348ON2141806759e-90
Kwal_56.246357.348ON2261836761e-89
Kpol_530.337.348ON1951856721e-89
KAFR0B008607.348ON2281836733e-89
TPHA0F029507.348ON2161816705e-89
ZYRO0F11660g7.348ON1981856522e-86
CAGL0I03366g7.348ON2121846514e-86
TBLA0E005207.348ON2091836383e-84
Smik_4.727.348ON1971846294e-83
YDL166C (FAP7)7.348ON1971846252e-82
Suva_4.807.348ON2061846123e-80
Skud_4.917.348ON1941846079e-80
Ecym_41075.572ON19262770.13
Kpol_1033.248.295ON491525730.77
YML065W (ORC1)4.327ON91452720.93
Smik_15.623.103ON32351711.0
Kwal_56.236388.295ON492221711.5
Kwal_14.8682.667ON282140691.6
KLTH0G12892g8.295ON492822701.8
Skud_11.2042.667ON27955682.3
AER322C5.560ON63692682.8
Smik_13.794.327ON93952683.4
SAKL0G17446g4.327ON101640683.5
Suva_13.924.327ON92352674.2
TBLA0E046904.327ON101447665.8
Smik_5.3458.239ON68743665.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL150W
         (219 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   351   e-124
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   281   3e-96
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   273   3e-93
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   271   1e-92
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   270   5e-92
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   267   8e-91
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   266   3e-90
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   265   4e-90
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   264   9e-90
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   265   1e-89
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   263   1e-89
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   263   3e-89
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   262   5e-89
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   255   2e-86
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   255   4e-86
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   250   3e-84
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   246   4e-83
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   245   2e-82
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   240   3e-80
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   238   9e-80
Ecym_4107 Chr4 complement(215380..215958) [579 bp, 192 aa] {ON} ...    34   0.13 
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    33   0.77 
YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Large...    32   0.93 
Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON...    32   1.0  
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    32   1.5  
Kwal_14.868 s14 (88176..89024) [849 bp, 282 aa] {ON} YKL024C (UR...    31   1.6  
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    32   1.8  
Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840...    31   2.3  
AER322C Chr5 complement(1229579..1231489) [1911 bp, 636 aa] {ON}...    31   2.8  
Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W...    31   3.4  
SAKL0G17446g Chr7 complement(1509131..1512181) [3051 bp, 1016 aa...    31   3.5  
Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W...    30   4.2  
TBLA0E04690 Chr5 complement(1194374..1197418) [3045 bp, 1014 aa]...    30   5.8  
Smik_5.345 Chr5 (535826..537889) [2064 bp, 687 aa] {ON} YER173W ...    30   5.9  

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  351 bits (901), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/186 (91%), Positives = 171/186 (91%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NALQQH 186
           NALQQH
Sbjct: 181 NALQQH 186

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  281 bits (720), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 152/185 (82%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M  TR RPNI+V+GTPGCGK+TTCELLQR L D +Y+NISDFA+EH+CY+GYDE RKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GGAI+DWHVND+FPERLIDLVVVLRCDN+ L+DRL KRGYH +K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEENIDAEIMGVVLQDA+DSYV +IVVELQS+   QM++NV RI AWE++WVS+HP GV+
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NALQQ 185
           N LQQ
Sbjct: 195 NELQQ 199

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  273 bits (697), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 145/184 (78%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R RPNILV+GTPGCGKSTTCELL R L DY Y+NISDFAREH CYDGYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G +IVDWHVND+FPERLIDLVVVLRCDN+IL+DRL KRGYH SK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVV+QDA +SY +EIVVELQSD  E M  NVDRI  W+  W+++HP+GV+
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NALQ 184
           N L+
Sbjct: 181 NELE 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  271 bits (694), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 148/183 (80%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R +PN+L++GTPGCGKSTTCELLQR LPDY+Y+NISDFA+EH+C+DGYDEARKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G AIVDWHVND+FPERLIDLVVVLRCDN IL+DRL+ R YH +K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           I+EN+DAEIMGVVLQDA DSY +EIVVELQSD TEQM+ NVDRI +WE  W+ +H DG +
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NAL 183
           N L
Sbjct: 181 NEL 183

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  270 bits (690), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 148/183 (80%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R +PNI+VSGTPGCGKSTTCELL R LP+Y Y+NISDFA+EH+CYDGYD+ARKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GG I+DWHVND+FPERL+DLVVVLRCDN IL+DRL KRGYH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVVLQDA DSY +EIVVELQSD TE+M +NVDRI AW+  W+ +H  GV+
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NAL 183
           N L
Sbjct: 181 NEL 183

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  267 bits (682), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 145/183 (79%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M  TR  PNILV+GTPGCGK++TCELLQR L D  Y+NISDFA++H CYDGYDEARKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GGAIVDWHVNDIFPERLIDLVVVLR DN +L+DRL+ RGYH +K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           I+ENIDAEIMGVV+QDA DSY +EIVVELQSD  +QM +NVDRIA+W A W+ ++P GV+
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NAL 183
           N L
Sbjct: 181 NEL 183

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  266 bits (679), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 120/180 (66%), Positives = 145/180 (80%)

Query: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVXXX 64
           R +PN+L++GTPGCGKSTTCELLQR LP+Y+Y+NISDFA+EH+CYDGYD+ RKSHIV   
Sbjct: 6   RYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVDED 65

Query: 65  XXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124
                       G +I+DWHVND+FPERLIDLV VLRCDN++L+DRL  R YH +KIEEN
Sbjct: 66  KLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIEEN 125

Query: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSNALQ 184
           +DAEIMGVVLQDAL+SY +EIVVELQSD TEQM  NVDRI  W+  W+ +H DGV+N L+
Sbjct: 126 MDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNELE 185

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  265 bits (678), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 142/185 (76%)

Query: 2   QQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIV 61
           +  R  PNILV+GTPG GKSTTCELL R+LPDY Y+NISDFA ++ CYDGYDEARKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  XXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKI 121
                          GG I+DWHVND+FPERLIDLV VLRCD+++L DRL KR YHSSKI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 EENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSN 181
           +EN+DAEIMGVVLQDALDSY  +IVVELQSDDTEQM  NVDR+  W   W  +HP+GV+N
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 ALQQH 186
            L  H
Sbjct: 183 ELSAH 187

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  264 bits (675), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 122/180 (67%), Positives = 146/180 (81%)

Query: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVXXX 64
           R  PN+L++GTPG GKSTTCELLQR LP+Y Y+NISDFA+E++CY+GYD+ RKSHIV   
Sbjct: 8   RYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVDED 67

Query: 65  XXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124
                       G +IVDWHVNDIFPERLIDLVVVLRCDN+IL+DRL KRGYH SKI+EN
Sbjct: 68  KLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQEN 127

Query: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSNALQ 184
           +DAEIMGVVLQDA++SY +EIVVELQSDDTEQM+ NV+RI  W   W+ +H +GV+N LQ
Sbjct: 128 LDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNELQ 187

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  265 bits (676), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 124/183 (67%), Positives = 141/183 (77%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M  TR  PNILV+GTPGCGK++TCELLQR L   +Y+NISDFA+E+ CYDGYDEARKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GGAIVDWHVND+FPERLIDLVVVLR DN+ L DRL KRGYH +K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           I+ENIDAEIMGVV+ DA DSY +EIVVELQSD TEQM +NVDRI  W   W  +HP+GV+
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NAL 183
           N L
Sbjct: 181 NEL 183

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  263 bits (672), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 122/185 (65%), Positives = 145/185 (78%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M   R +PN+L++GTPGCGKST+CELLQR L DY+Y+NISDFA+EH+CY+GYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GG+IVDWHVND+FPERLIDLVVVLRCDN+IL+DRL  R YH SK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           I+EN+DAEIMGVVLQDA +SY  EIVVELQSD TEQM+ NVDRI  W   W+ +H  GV+
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NALQQ 185
           N L++
Sbjct: 181 NELEE 185

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  263 bits (673), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 122/183 (66%), Positives = 144/183 (78%)

Query: 2   QQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIV 61
           +  R  PN+LV+GTPGCGKSTTCELL R LPDY YFNIS+FA +H CYDGYDE+RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  XXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKI 121
                          G +I+DWHVND+FPERLIDLVVVLRCDN+IL DRL  RGYH SKI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 EENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSN 181
           +EN+DAEIMGVVLQDALDSY +EIVVELQS+ TE+M  NV+RI AW+  W+++H +GV+N
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 ALQ 184
             Q
Sbjct: 187 EYQ 189

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  262 bits (670), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 121/181 (66%), Positives = 144/181 (79%)

Query: 5   RCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHIVXXX 64
           R +PN+L++GTPGCGKSTTCELLQR L DY Y+NISDFA+EHNCYDG+DE RKSHIV   
Sbjct: 4   RYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVDED 63

Query: 65  XXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSKIEEN 124
                       G  IVDWHVND+FPERLIDLVVVLRCDN++L+DRL+ RGYH SKI+EN
Sbjct: 64  KLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKIDEN 123

Query: 125 IDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVSNALQ 184
           +DAEIMGVVLQDA +SY +EIVVELQSD TEQM +NVD+I  W   W+ +H +GV+N L 
Sbjct: 124 MDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNELS 183

Query: 185 Q 185
           +
Sbjct: 184 K 184

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  255 bits (652), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 143/185 (77%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R  PN+L++GTPG GKSTT ELLQR L D+QY+NISDFA+E++C+DGYDE RKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               GG I+DWHVND+FPERLIDLVVVLRC+N+IL  RL+KRGYH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           I+ENIDAEIMGVV+QDALDSY +EIVVEL SD TEQM+ NVDRI +W   W  +H  GV+
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NALQQ 185
           N L +
Sbjct: 181 NELHE 185

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  255 bits (651), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 139/184 (75%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M   R  PNI+V+GTPGCGKSTTCELLQR L  Y+Y+NIS+FA EH CYDGYDE RKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G +I+DWHVND+FPERLIDLVVVLR +N  L+DRL+ RGYH SK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVVLQDA +SY  EIVVELQS+ TE M+ NVDRI  W  NWV EH DGVS
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NALQ 184
           + L+
Sbjct: 181 SELK 184

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  250 bits (638), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 141/183 (77%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R  PN+L+SGTPG GKS+TCELL+R L DY+Y NISDFA+E NCYDG+D+ RKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G  IVDWHVND+FPERLIDLVV+LR DN++L+DRLQ R YH +K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           ++EN+DAEIMGVVLQDA+DSY +EIV+ELQS++TE+M  NVDRI +W   W  +H DGV+
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NAL 183
           N L
Sbjct: 181 NEL 183

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  246 bits (629), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 115/184 (62%), Positives = 138/184 (75%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R  PNI+V+GTPGCGKS+ CELL+  L DY+Y+NISDFA++H+C++GYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G +IVDWHVNDIFPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVV QDA++SY   IVVELQSD  E M+ NV RI  WE  W+ +HP+GV+
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NALQ 184
           N  Q
Sbjct: 181 NEYQ 184

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 115/184 (62%), Positives = 138/184 (75%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R  PNI+V+GTPGCGKS+TCE L+  L DY+Y+NISDFA++++C++GYDE RKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G +IVDWHVND+FPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVV QDA++SY   IVVELQSD  E M  NV RI AWE  W+ +HPDGV+
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NALQ 184
           N  Q
Sbjct: 181 NEYQ 184

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  240 bits (612), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 112/184 (60%), Positives = 138/184 (75%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R  PNI+V+GTPGCGKS+TCELL+  L  Y+Y+NISDFA++++C++GYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G +I+DWHVND+FPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVV QDA+DSY   IVVELQSD  + +  NV RI AWE  W+ +HP+GV+
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NALQ 184
           N  Q
Sbjct: 181 NEYQ 184

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  238 bits (607), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 136/184 (73%)

Query: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60
           M+  R  PNI+V+GTPGCGKS+TCELL+  L  Y+Y+NISDFA++++C++ YDEARKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VXXXXXXXXXXXXXXXGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120
           V               G +I+DWHVND+FPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180
           IEEN+DAEIMGVV QDA+DSY   IVVELQ D  E M  NV RI AWE  W+ +H DGV+
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NALQ 184
           N  Q
Sbjct: 181 NEYQ 184

>Ecym_4107 Chr4 complement(215380..215958) [579 bp, 192 aa] {ON}
          similar to Ashbya gossypii AER309W
          Length = 192

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 28/62 (45%), Gaps = 3/62 (4%)

Query: 1  MQQTRCRPN-ILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSH 59
          M   R  P  I+VSG  G GKST  + L    PD   F++S   R+     G  E +  H
Sbjct: 1  MNFVRAMPRPIVVSGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRKPRV--GEVEGKDYH 58

Query: 60 IV 61
           V
Sbjct: 59 FV 60

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 32.7 bits (73), Expect = 0.77,   Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 7    RPNILVSGTPGCGKSTTCELLQRHL 31
            R  IL+ G  GCGK+T C++L  HL
Sbjct: 1359 REPILLVGETGCGKTTVCQILAEHL 1383

>YML065W Chr13 (142210..144954) [2745 bp, 914 aa] {ON}  ORC1Largest
           subunit of the origin recognition complex, which directs
           DNA replication by binding to replication origins and is
           also involved in transcriptional silencing; exhibits
           ATPase activity
          Length = 914

 Score = 32.3 bits (72), Expect = 0.93,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 11/52 (21%)

Query: 10  ILVSGTPGCGKSTTC-----ELL----QRHLPDYQYFNIS--DFAREHNCYD 50
           I V+GTPG GK+ T      ELL    QR +PD+ Y  I+     +  +CY+
Sbjct: 475 IYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYE 526

>Smik_15.62 Chr15 complement(104681..105652) [972 bp, 323 aa] {ON}
          YOL094C (REAL)
          Length = 323

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 5/51 (9%)

Query: 8  PNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYD--GYDEAR 56
          P++++SG PG GK+T+   L   L  + Y   +D   E N  D  G D  R
Sbjct: 43 PHMIISGMPGIGKTTSVHCLAHELLGHSY---ADGVLELNASDDRGIDVVR 90

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 16/21 (76%)

Query: 10   ILVSGTPGCGKSTTCELLQRH 30
            IL+ G  GCGK+T C+L+ R+
Sbjct: 1366 ILLVGETGCGKTTVCQLIARY 1386

>Kwal_14.868 s14 (88176..89024) [849 bp, 282 aa] {ON} YKL024C (URA6)
           - uridine-monophosphate kinase (uridylate kinase)
           [contig 245] FULL
          Length = 282

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 52/140 (37%), Gaps = 25/140 (17%)

Query: 10  ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDGYD-EARKSHIVXXXXX 66
           I V G PG GK T C  L R   DYQ+ ++S  D  R     +G    A   H +     
Sbjct: 96  IFVLGGPGAGKGTQCANLVR---DYQFVHLSAGDLLRAEQNREGSKYGALIKHYIKEGLI 152

Query: 67  XXXXXXXXXXGGAIVDWH-------VNDIFPERL------------IDLVVVLRCDNAIL 107
                       AI D +       + D FP ++                +   C   ++
Sbjct: 153 VPQEVTVALLQQAIQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFFDCPEKVM 212

Query: 108 HDRLQKRGYHSSKIEENIDA 127
             RL +RG  S + ++N+++
Sbjct: 213 LQRLLERGKTSGRSDDNVES 232

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 17/22 (77%)

Query: 10   ILVSGTPGCGKSTTCELLQRHL 31
            +L+ G  GCGK+T C+L+ ++L
Sbjct: 1369 VLLVGETGCGKTTVCQLIAKYL 1390

>Skud_11.204 Chr11 complement(373437..374051,374060..374284) [840
           bp, 279 aa] {ON} YKL024C (REAL)
          Length = 279

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 7/55 (12%)

Query: 10  ILVSGTPGCGKSTTCELLQRHLPDYQYFNIS--DFAREHNCYDG--YDEARKSHI 60
           + V G PG GK T CE L +   DY + ++S  D  R      G  Y E   +HI
Sbjct: 94  VFVLGGPGAGKGTQCEKLVK---DYSFVHLSAGDLLRAEQGRKGSQYGELISNHI 145

>AER322C Chr5 complement(1229579..1231489) [1911 bp, 636 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR444W
          Length = 636

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 26/92 (28%)

Query: 83  WHVNDIFPERLIDLVVV-------LRCDNAILHDRLQK---------------RGYHSSK 120
           W+   +FPER + LV+V       + CD   L DRL+K               RGYH + 
Sbjct: 190 WNEPPLFPERPVHLVIVTHGIFSNIGCDMLYLRDRLKKCAHAVEENCNQNVVVRGYHGNI 249

Query: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSD 152
            + +   E + + + D    YV + + ++ ++
Sbjct: 250 GKSHKGIEYLAMRVAD----YVLKTIAQMPNE 277

>Smik_13.79 Chr13 (139688..142507) [2820 bp, 939 aa] {ON} YML065W
           (REAL)
          Length = 939

 Score = 30.8 bits (68), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 11/52 (21%)

Query: 10  ILVSGTPGCGKSTTC-----ELL----QRHLPDYQYFNIS--DFAREHNCYD 50
           I V+GTPG GK+ T      ELL    Q+ +PD+ Y  I+     +  +CY+
Sbjct: 503 IYVAGTPGVGKTLTVREVVKELLSSSTQQEIPDFLYVEINGLKMVKPTDCYE 554

>SAKL0G17446g Chr7 complement(1509131..1512181) [3051 bp, 1016 aa]
           {ON} similar to uniprot|P54784 Saccharomyces cerevisiae
           YML065W ORC1 Largest subunit of the origin recognition
           complex which directs DNA replication by binding to
           replication origins and is also involved in
           transcriptional silencing may be phosphorylated by
           Cdc28p
          Length = 1016

 Score = 30.8 bits (68), Expect = 3.5,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 9/40 (22%)

Query: 10  ILVSGTPGCGKSTTC-----ELL----QRHLPDYQYFNIS 40
           + V+GTPG GK+ T      ELL    Q+ LP +QY  I+
Sbjct: 604 VYVAGTPGVGKTLTVREVVKELLQSAEQKELPKFQYIEIN 643

>Suva_13.92 Chr13 (144893..147664) [2772 bp, 923 aa] {ON} YML065W
           (REAL)
          Length = 923

 Score = 30.4 bits (67), Expect = 4.2,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 11/52 (21%)

Query: 10  ILVSGTPGCGKSTTC-----ELL----QRHLPDYQYFNIS--DFAREHNCYD 50
           I V+GTPG GK+ T      EL+    Q+ LPD+ Y  I+     +  +CY+
Sbjct: 485 IYVAGTPGVGKTLTVREVVKELISSSAQQELPDFLYVEINGLKMVKPTDCYE 536

>TBLA0E04690 Chr5 complement(1194374..1197418) [3045 bp, 1014 aa]
           {ON} Anc_4.327 YLR442C
          Length = 1014

 Score = 30.0 bits (66), Expect = 5.8,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 9/47 (19%)

Query: 3   QTRCRPNILVSGTPGCGKSTTCE---------LLQRHLPDYQYFNIS 40
           Q+     I ++GTPG GK+ T           ++Q  LP +QY  I+
Sbjct: 551 QSTSATTIYIAGTPGVGKTLTVREVIKELHTSMIQNELPKFQYVEIN 597

>Smik_5.345 Chr5 (535826..537889) [2064 bp, 687 aa] {ON} YER173W
           (REAL)
          Length = 687

 Score = 30.0 bits (66), Expect = 5.9,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 10  ILVSGTPGCGKSTTCELLQR-HLPDY-QYFNISDFAREHNCYD 50
           +L+SG  GC KST  + L R  +P Y Q  N++   R  N YD
Sbjct: 133 LLLSGPSGCSKSTVIKELSRVVVPKYRQKSNVTSLRRTSNNYD 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,823,199
Number of extensions: 680486
Number of successful extensions: 2873
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2903
Number of HSP's successfully gapped: 36
Length of query: 219
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 114
Effective length of database: 41,441,469
Effective search space: 4724327466
Effective search space used: 4724327466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)