Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL149W7.349ON62862828580.0
SAKL0F11352g7.349ON58336912241e-161
Kwal_56.246387.349ON52737411841e-156
TDEL0C019907.349ON60643411821e-154
KLTH0H01276g7.349ON55741311731e-154
ZYRO0F11682g7.349ON59739911641e-152
YDL167C (NRP1)7.349ON71938411331e-146
KLLA0D12364g7.349ON63140011251e-145
Suva_4.797.349ON70838511301e-145
Smik_4.717.349ON75938711321e-145
NCAS0A141507.349ON57042611141e-145
Skud_4.907.349ON70738811101e-142
TBLA0E020607.349ON56436610231e-131
KAFR0B008707.349ON54243110151e-130
TPHA0F029607.349ON65439110031e-127
KNAG0C037807.349ON5383739761e-124
Kpol_530.327.349ON6844209341e-116
NDAI0A019007.349ON5653607873e-96
CAGL0I03344g7.349ON6033936159e-71
KLLA0B08976g3.379ON30536820.18
Kwal_56.234868.229ON587103820.29
KNAG0H017101.408ON427130800.43
SAKL0H17952g8.229ON589102790.57
CAGL0D05236g7.188ON44373770.85
ZYRO0F16478g1.91ON347127761.2
TDEL0A009402.52ON68231724.3
TBLA0B006002.52ON73431724.8
Kwal_23.45972.52ON66431715.6
KLTH0B07546g2.52ON63931706.5
TBLA0C048207.267ON399115689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL149W
         (628 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...  1105   0.0  
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   476   e-161
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   460   e-156
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   459   e-154
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   456   e-154
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   452   e-152
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   441   e-146
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   437   e-145
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   439   e-145
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   440   e-145
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   433   e-145
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   432   e-142
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   398   e-131
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   395   e-130
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   390   e-127
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   380   e-124
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   364   e-116
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   307   3e-96
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   241   9e-71
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    36   0.18 
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    36   0.29 
KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 a...    35   0.43 
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    35   0.57 
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    34   0.85 
ZYRO0F16478g Chr6 (1354598..1355641) [1044 bp, 347 aa] {ON} simi...    34   1.2  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    32   4.3  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    32   4.8  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    32   5.6  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    32   6.5  
TBLA0C04820 Chr3 (1168828..1170027) [1200 bp, 399 aa] {ON} Anc_7...    31   9.9  

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/628 (85%), Positives = 540/628 (85%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATGQL 60
           MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATGQL
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATGQL 60

Query: 61  EAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWCA 120
           EAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWCA
Sbjct: 61  EAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWCA 120

Query: 121 NHVSERACNAGAKGDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQSLVLT 180
           NHVSERACNAGAKGDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQSLVLT
Sbjct: 121 NHVSERACNAGAKGDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQSLVLT 180

Query: 181 HPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTXX 240
           HPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDT  
Sbjct: 181 HPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTSN 240

Query: 241 XXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVE 300
                     RYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVE
Sbjct: 241 VNNNWSSNNSRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVE 300

Query: 301 LKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTV 360
           LKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTV
Sbjct: 301 LKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTV 360

Query: 361 SKLYKPQQQRHYQNPHHVPSKQQVQHPQIHDQDTQQHSQHFNIXXXXXXXXXXXXAHGTV 420
           SKLYKPQQQRHYQNPHHVPSKQQVQHPQIHDQDTQQHSQHFNI            AHGTV
Sbjct: 361 SKLYKPQQQRHYQNPHHVPSKQQVQHPQIHDQDTQQHSQHFNIQQMPQQLQMQQQAHGTV 420

Query: 421 QGGSSMQQYKHRPQHGLQAYLGCYXXXXXXXXXXXXXXXXXXXMIAGDAQRRYNRYNKMV 480
           QGGSSMQQYKHRPQHGLQAYLGCY                   MIAGDAQRRYNRYNKMV
Sbjct: 421 QGGSSMQQYKHRPQHGLQAYLGCYQQQQAKSQQQYQMNQQQVQMIAGDAQRRYNRYNKMV 480

Query: 481 QXXXXXXXXXXXXXXXXXXXVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQA 540
           Q                   VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQA
Sbjct: 481 QGNGQNGNSCNGNGSLGSSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQA 540

Query: 541 SLQGLHSSSGPVGAQDSAISSVTVSIDRRSKNELXXXXXXXXXXXXXXXXXXXXXXXXXX 600
           SLQGLHSSSGPVGAQDSAISSVTVSIDRRSKNEL                          
Sbjct: 541 SLQGLHSSSGPVGAQDSAISSVTVSIDRRSKNELSNMRNGSNSSNSGNGNNDSSTNDHNG 600

Query: 601 YPQQSHHNGAGGSNTHWNAGPLGGTVNI 628
           YPQQSHHNGAGGSNTHWNAGPLGGTVNI
Sbjct: 601 YPQQSHHNGAGGSNTHWNAGPLGGTVNI 628

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  476 bits (1224), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 236/369 (63%), Positives = 270/369 (73%), Gaps = 10/369 (2%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATGQL 60
           MYYV+ E +  H E+ PKDH RVS+I YQ IH   L  ++     +EVG G ++    QL
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPGQLREQVAQL 60

Query: 61  EAALQEATASE--PFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRW 118
           +  +     S+   F L SL STWH+RVT+PRQA DEG +LP +L H KVFDLWKE DRW
Sbjct: 61  DQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDRW 120

Query: 119 CANHVS----ERACNAGAKG-DVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAE 173
           C NH       +  N G K  D+ EL RVL+   Q      + Q   +L QLH KC   E
Sbjct: 121 CVNHPETLPLRKNSNLGKKSRDLPELSRVLEAPLQTFP---LDQTIGILSQLHKKCLLPE 177

Query: 174 DQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN 233
           DQS+VLTHPYDSY D+ +F+QERS+VLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN
Sbjct: 178 DQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN 237

Query: 234 VVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPR 293
           VVE+T             YVEE DSISGFVVFQ+HE A+EAL+LNGRSILSNMANTKQPR
Sbjct: 238 VVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPR 297

Query: 294 VVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFP 353
           VVEHVVEL+PSS+RVLD A E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRR ACFRCSFP
Sbjct: 298 VVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFP 357

Query: 354 ATSAVTVSK 362
           ATSAV V+K
Sbjct: 358 ATSAVNVNK 366

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 51/84 (60%), Gaps = 11/84 (13%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKT---------ANEDE--TQASLQGLHSSS 549
           VPFRAGDWKC++C+YHNFAKN+VCLRCG PKT         AN D      S Q   +S+
Sbjct: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAST 556

Query: 550 GPVGAQDSAISSVTVSIDRRSKNE 573
             +    +  SS  VS++ RS +E
Sbjct: 557 ISLSEMHNGGSSFGVSLETRSSSE 580

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355
           R GDW C SC + NF + + C RC  P T
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKT 528

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           R GDW C +C + NF +   C RC  P T+
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  460 bits (1184), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 226/374 (60%), Positives = 277/374 (74%), Gaps = 14/374 (3%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGG-GVQMATGQ 59
           M+YV+ E D+AH+ED+PKD ++++  +YQ +   EL  ++ + + I +  G  +Q A  Q
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLENGCSLQEAVSQ 60

Query: 60  LEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWC 119
           LE  + E    + FVLCSL+STWH RVT+PRQA DE  +LP  L H +VFDLWKE DRWC
Sbjct: 61  LEKDIGEHLKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYDRWC 119

Query: 120 ANH---VSERACNAGAKG--DVAELFRVLDLDEQLVSHA-------YIQQATRVLLQLHN 167
            NH   ++ R  N+  K   DVAEL  VL+LD               ++Q   ++ QLH 
Sbjct: 120 VNHPETLALRRSNSMGKKVKDVAELRSVLELDSATQDSTPGAAEPDALEQTIAIIRQLHK 179

Query: 168 KCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVG 227
           KC TAED+SLVLTHPYDSY D+ +F+QERS+VLYMNNLPPDTTQSELESWFTQFGARPVG
Sbjct: 180 KCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVG 239

Query: 228 FWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMA 287
           FWTVKN+VE+T             YVE  DSISGFVVFQSHE A+EAL+LNGRSILSN+A
Sbjct: 240 FWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIA 299

Query: 288 NTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIAC 347
           NTKQPRV+EH+VE++PSS+RVLD AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR +C
Sbjct: 300 NTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSC 359

Query: 348 FRCSFPATSAVTVS 361
           FRCSFP+T +  ++
Sbjct: 360 FRCSFPSTGSAPMN 373

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (90%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKT 532
           VPFRAGDWKC  C+YHNFAKN+VCLRCG PK+
Sbjct: 452 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 483

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATS 356
           R GDW C +C + NF + + C RC  P ++
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 484

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P T +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPSTGS 369

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  459 bits (1182), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 231/434 (53%), Positives = 288/434 (66%), Gaps = 36/434 (8%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEV-----GGGGVQM 55
           M+YV+ E +  H+ + PKDH RV+K+ YQ I    +   YAD +   +     G    Q 
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 56  ATGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKEC 115
           +  + +  +      + FVLCSL+STWH+RVT+PRQA DEG +LP +L H +VFDLWKE 
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 116 DRWCANH----VSERACNAGAK--GDVAELFRVLDLD-EQLVSHAYIQQATRVLLQLHNK 168
           DRWCANH       ++C  G K   D  E+ +VL++  E++     +     +LLQL  +
Sbjct: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVLEMSTEEITEKPVLGYTVDILLQLCER 180

Query: 169 CTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGF 228
           CTT ED S VL+ PYDS+ D+ +F+QE+S+VLY+NNLPPDTTQSELESWFTQFGARPVGF
Sbjct: 181 CTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGF 240

Query: 229 WTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMAN 288
           WTVKN+VE+T             YVEE DSISGFVVFQ+HE A+E L LNGRSILSNMAN
Sbjct: 241 WTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMAN 300

Query: 289 TKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACF 348
           TKQPRVVEH+VE++PSS+RVLD AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR ACF
Sbjct: 301 TKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACF 360

Query: 349 RCSFPATSAVTV-----------------------SKLYKPQQQRHYQNPHHVPSKQQVQ 385
           RCSFPA SAV V                       +K+     Q HYQ    +P  Q V+
Sbjct: 361 RCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQLPQTQAVR 420

Query: 386 -HPQIHDQDTQQHS 398
            +   +DQ++ +HS
Sbjct: 421 TNANYNDQNSLKHS 434

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%)

Query: 502 PFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANED 536
           PFRAGDWKC  C+YHNFAKN+VCLRCG  K +  D
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVSISD 510

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 16/24 (66%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRC 350
           R GDW CP+C + NF + + C RC
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNP 530
           R GDW C +C + NF +   C RC  P
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFP 365

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  456 bits (1173), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/413 (56%), Positives = 279/413 (67%), Gaps = 53/413 (12%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGG-GVQMATGQ 59
           M+YV+ E ++AH+ED+PKD ++++K  YQ +    L P++ + + +E+G G  +Q A  Q
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60

Query: 60  LEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWC 119
           LE  + E  A + FVLCSL+STWH RVT+PRQA DE  +LP  L H KVFDLWKE DRWC
Sbjct: 61  LEKDISEH-AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWC 119

Query: 120 ANHVSERACNAGAKG----DVAELFRVLDLD-------------------------EQLV 150
            NH    A      G    D+AE+  VL LD                         EQLV
Sbjct: 120 MNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLV 179

Query: 151 SHA----------------------YIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYAD 188
           +                         I QA  ++ QLH KC TA+D+SLVLTHPYDSY D
Sbjct: 180 AGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSYLD 239

Query: 189 MTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXX 248
           + +F+QERS+VLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN+VE+T          
Sbjct: 240 VRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSN 299

Query: 249 XXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRV 308
              YVE  DSISGFVVFQSHE A+EAL+LNGRSILSN+ANTKQPRV+EH+VE++PSS+RV
Sbjct: 300 NSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSARV 359

Query: 309 LDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVS 361
           LD AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR +CFRCSFPA S   ++
Sbjct: 360 LDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN 412

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 45/73 (61%), Gaps = 6/73 (8%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSSSGPVGAQDSAIS 560
           VPFRAGDWKC  C+YHNFAKN+VCLRCG PK+    + +      ++    +G      +
Sbjct: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG------N 541

Query: 561 SVTVSIDRRSKNE 573
            + +S++ RS +E
Sbjct: 542 GMGISLNTRSFSE 554

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATS 356
           R GDW C +C + NF + + C RC  P ++
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 520

 Score = 37.7 bits (86), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNP 530
           R GDW C +C + NF +   C RC  P
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFP 404

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  452 bits (1164), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 230/399 (57%), Positives = 278/399 (69%), Gaps = 12/399 (3%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADARE-----IEVGGGGVQM 55
           MYYV+ E + AH  + PKD  R++KI YQ ++   L   Y + +       E     +  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 56  ATGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKEC 115
           A   L   +      EPFVLCSL+STWHLRVTL RQA D+   LP +L H K+FDLWKE 
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 116 DRWCANH--VSERACNAGAK-GDVAELFRVLDLDEQLVSHAY--IQQATRVLLQLHNKCT 170
           +RWC NH  V     N G +  DVAEL RVLD++    + +   + ++  +LL+LH +C+
Sbjct: 121 ERWCVNHPEVMPLRKNGGRRMKDVAELARVLDINGLNFNDSSFDLSRSVEILLRLHQRCS 180

Query: 171 TAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWT 230
           T ED ++VLTHPYDS+ D+ +F+QE S+VLY+NNLPPDTTQSELESWFTQFGARPVGFWT
Sbjct: 181 TPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWT 240

Query: 231 VKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTK 290
           VKN+VE+T             YVEE DSISGFVVFQ+HE A+E L LNGRSILSNMANTK
Sbjct: 241 VKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEEATEVLTLNGRSILSNMANTK 300

Query: 291 QPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRC 350
           QPRVVEH+VE++PSS+RVLD AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR ACFRC
Sbjct: 301 QPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRC 360

Query: 351 SFPATSAVTV-SKLY-KPQQQRHYQNPHHVPSKQQVQHP 387
           SFPAT+AV V +K Y       + QN    PS  Q  +P
Sbjct: 361 SFPATTAVQVNTKQYISGGPAANLQNGKITPSPSQTYYP 399

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (75%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQAS 541
           VPFRAGDWKC +C YHNFAKN+VCLRCG PK    D   A+
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDLENAA 525

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358
           R GDW CPSC + NF + + C RC  P  +AV
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGPKITAV 519

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           R GDW C +C + NF +   C RC  P T 
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATT 366

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  441 bits (1133), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 218/384 (56%), Positives = 270/384 (70%), Gaps = 28/384 (7%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR--EIEVGGG--GVQMA 56
           M+YV+ E  VAH  DTPKD  R++ I +Q+++   L+  Y       IEV G    ++ A
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116
             QL+  + +   ++ FVL SL+STWH+RVTLPRQA D+G +L  +L H KVFDLWKE D
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 117 RWCANH---------VSERACN--------AGAKGDVAELFRVLDLD---EQLVS----H 152
           RWC NH         +S   CN        A    D+ E+ R+L++    E+  S    +
Sbjct: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180

Query: 153 AYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQS 212
           + +++ T +L+QLH KCT+ ED   VLT PYDS+ D+ +F+QE+S++LYMNNLPPDTTQS
Sbjct: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240

Query: 213 ELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAAS 272
           ELESWFTQ+G RPVGFWTVKN+VEDT             YVE+ DSISGFVVFQ+HE A+
Sbjct: 241 ELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEAT 300

Query: 273 EALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWN 332
           E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGDWN
Sbjct: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360

Query: 333 CPSCGFSNFQRRIACFRCSFPATS 356
           CPSCGFSNFQRR ACFRCSFPA S
Sbjct: 361 CPSCGFSNFQRRTACFRCSFPAPS 384

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSSSGP 551
           +PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ + D ++ +     S+ GP
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGP 628

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355
           R GDW C +C + NF + + C RC  P +
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P  +N
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 385

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  437 bits (1125), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 218/400 (54%), Positives = 265/400 (66%), Gaps = 40/400 (10%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGG-GVQMATGQ 59
           M+YVLFEC+  + E+ PKDH  +S I YQ+I    L P++ +AR   +     ++     
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60

Query: 60  LEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWC 119
           +E A+ E  A E FVLCSL+STW LRVTL RQA DE  +LP FL H KVFDLW+E DRW 
Sbjct: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120

Query: 120 ANHVS--ERACNAGAKGDVAE--------------------LFRVLDLDEQLVSH----- 152
            NH    E+  + G  G+VA                     +F  +DLD +  +      
Sbjct: 121 RNHPEQYEKGTDRGG-GNVANTNTTTQRNKHKLVKSIDALLVFLNIDLDNKSTTDQRMEQ 179

Query: 153 -----------AYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLY 201
                        IQQ  +VL +LH  CT+  DQ+LVLTHP+DSY D+ +F+ E+S VLY
Sbjct: 180 VNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNFLLEKSTVLY 239

Query: 202 MNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISG 261
           MNNLPPDTTQSELESWF QFG+RPVGFWTVKNVVEDT             YV+E DSISG
Sbjct: 240 MNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLYVDEQDSISG 299

Query: 262 FVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQ 321
           FVV+Q+HE A ++L LNGRSILSNM+NTKQPRVVEHVVE++PSS+ VLD AQEIL+ FPQ
Sbjct: 300 FVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRAQEILTAFPQ 359

Query: 322 SKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVS 361
           SKNKPRPGDW CPSC FSNFQRR ACFRCSFP +SA+ +S
Sbjct: 360 SKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMS 399

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           VPFRAGDWKC NC+YHNFAKN+VCLRCG PKTAN
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTAN 538

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 318 PFPQSKNKP-RPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVS 361
           P     N P R GDW C +C + NF + + C RC  P T+ V+ +
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSAN 542

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           R GDW C +CS+ NF +   C RC  P ++
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSS 394

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  439 bits (1130), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 218/385 (56%), Positives = 264/385 (68%), Gaps = 29/385 (7%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADARE--IEVGG--GGVQMA 56
           M+YV+ E  VAH  D+PKD  R+  + YQ++    L   Y +     I+V G    ++ A
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116
            GQL+  +Q    ++ FVL SL STWH+RVTLPRQA D+G +L  +L H ++FDLWKE +
Sbjct: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120

Query: 117 RWCANHVSERACNAGA------------------KGDVAELFRVLDL-------DEQLVS 151
           RWC NH                              D+ E+ R+L++       D  L +
Sbjct: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180

Query: 152 HAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQ 211
           H+ +Q+   VLLQLH KC++AED   VLT PYDS+ D+ SF+QERS+VLYMNNLPPDTTQ
Sbjct: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240

Query: 212 SELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAA 271
           SELESWFTQ+GARPVGFWTVKN+VEDT             YVE+ DSISGFVVFQ+HE A
Sbjct: 241 SELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 272 SEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDW 331
           +E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 332 NCPSCGFSNFQRRIACFRCSFPATS 356
           NCPSCGFSNFQRR ACFRCSFPA S
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAPS 385

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 27/41 (65%), Positives = 34/41 (82%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQAS 541
           +PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ N D ++ +
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETN 600

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVSK 362
           R GDW C +C + NF + + C RC  P +    VS+
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSE 598

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P  +N
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  440 bits (1132), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 216/387 (55%), Positives = 270/387 (69%), Gaps = 29/387 (7%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR----EIEVGGGGVQMA 56
           M+YV+ E  VAH  ++PKD  R+  I YQ +    L   Y +      E++     ++ A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116
             QL+ A+Q+   ++ FVL SL+STWH+RVTLPRQA D+G +L  +L H K+FDLWKE D
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 117 RWCANH--------VSERACNAGAKG----------DVAELFRVLDLD---EQLVS---- 151
           RWC NH         +    N+G KG          D+ E+ R+L++    E+ VS    
Sbjct: 121 RWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVPEE 180

Query: 152 HAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQ 211
           ++ +++ T +L+ LH KC ++ED   VLT PYDS+ D+ +F+QERS+VLYMNNLPPDTTQ
Sbjct: 181 YSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDTTQ 240

Query: 212 SELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAA 271
           SELESWFTQ+G RPVGFWTVKN+VEDT             YVE+ DSISGFVVFQ+HE A
Sbjct: 241 SELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 272 SEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDW 331
           +E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 332 NCPSCGFSNFQRRIACFRCSFPATSAV 358
           NCPSCGFSNFQRR ACFRCSFPA S +
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAPSNI 387

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQAS 541
           +PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ + D  + +
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETN 658

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 26/56 (46%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVSKLYKPQQQRHYQNPHHVPSKQ 382
           R GDW C +C + NF + + C RC  P + +   ++     +     +  H PS +
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNHYIEASTVVSASHTPSNK 676

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P  +N
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 386

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  433 bits (1114), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 216/426 (50%), Positives = 279/426 (65%), Gaps = 27/426 (6%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVG--GGGVQMATG 58
           M+YV+ E + +H+ +TPKDH+R++K  YQ I+   L   + + + I++       +    
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDIPDMANAFKDTIS 60

Query: 59  QLEAALQ-EATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDR 117
           QLEA ++ E      FVLCSL S W +RVTLPRQAHD G +LP +L H +VF+LWKE D+
Sbjct: 61  QLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEFDK 120

Query: 118 WCANH---VSERACNAGAK-----GDVAELFRVLDLDEQLV---------SHAYIQQATR 160
           WC NH   +  R  N   K     GD++++  +L++D  L          +   IQ +T 
Sbjct: 121 WCGNHPEVIPMRKSNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSNPQTLLSIQDSTN 180

Query: 161 VLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQ 220
           +L +L  KCTT +D  LVLT PYDSYAD+ +F+QERS VLYMNNLP DTTQSELESWFTQ
Sbjct: 181 ILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDTTQSELESWFTQ 240

Query: 221 FGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGR 280
           FGARP+GFWT KN +E+T              V+E D ++GFVVFQSHE A+EAL LNGR
Sbjct: 241 FGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHEEATEALVLNGR 300

Query: 281 SILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSN 340
           SILSN+ANTKQPRVVEH+VE++PSS+RVLD  Q+ILS FPQSKNKPRPGDW+CPSCGFSN
Sbjct: 301 SILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPGDWSCPSCGFSN 360

Query: 341 FQRRIACFRCSFPATSAVTVSKLYKPQQQRHYQNPHHVPSKQQVQH----PQIHDQDTQQ 396
           FQRR ACFRCSFPA +    +K        +  + + +P   ++Q     PQ H     Q
Sbjct: 361 FQRRTACFRCSFPAPNN---NKGLNISGTSNIASTNQMPVVNRIQSTFPIPQSHQSSISQ 417

Query: 397 HSQHFN 402
             Q +N
Sbjct: 418 TFQQYN 423

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (85%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANE 535
           VPFRAGDWKC +C+YHNFAKN+VCLRC  PK + +
Sbjct: 473 VPFRAGDWKCPSCTYHNFAKNVVCLRCRIPKISQQ 507

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATS 356
           R GDW CPSC + NF + + C RC  P  S
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIPKIS 505

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 16/31 (51%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P   N
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFPAPNN 377

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  432 bits (1110), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 217/388 (55%), Positives = 263/388 (67%), Gaps = 30/388 (7%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYA--DAREIEVGG--GGVQMA 56
           M+YV+ E  VA+  D+PKD  R+  I YQ++    L+  Y      +IEV G    ++ A
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116
             QL+  + +   ++ FVL SL STWH+RVTL RQA D+G +L  +L H ++FDLWKE D
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 117 RWCANH---------VSERACNAGAKG----------DVAELFRVLDL-------DEQLV 150
           RWC NH          S    N  A G          D  E+ R+L++       D    
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180

Query: 151 SHAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTT 210
             + +++ T +LLQLH KC++ ED   VLT PYDSY D+ +F+QERS+VLYMNNLPPDTT
Sbjct: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240

Query: 211 QSELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEA 270
           QSELESWFTQ+G RPVGFWTVKN+VEDT             YVEE DSISGFVVFQ+HE 
Sbjct: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHEE 300

Query: 271 ASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGD 330
           A+E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGD
Sbjct: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360

Query: 331 WNCPSCGFSNFQRRIACFRCSFPATSAV 358
           WNCPSCGFSNFQRR ACFRCSFPA S +
Sbjct: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNI 388

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 2/52 (3%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANED--ETQASLQGLHSSSG 550
           +PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ N D  ET   ++GL    G
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPG 631

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355
           R GDW C +C + NF + + C RC  P +
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 611

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P  +N
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 387

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  398 bits (1023), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 199/366 (54%), Positives = 244/366 (66%), Gaps = 5/366 (1%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR--EIEVGGGGVQMATG 58
           MYY L E   AH  + PKDH ++  I YQ I++  L   + D +   I+     +  +  
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDCTTLPLSESIA 60

Query: 59  QLEAALQ-EATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDR 117
            L+  L+      E FVLCSL+STW LRVT+ RQA DE   LP F  + ++FDLWKE DR
Sbjct: 61  LLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEFDR 120

Query: 118 WCANHVSERACNAGAK-GDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQS 176
           WC NH          K  D+ +L  +L +   + + + I  A++VL+QLH KCTT +DQ 
Sbjct: 121 WCVNHKELVQTRDPRKLKDLKQLATLLHI-PSVETLSSISLASKVLVQLHEKCTTEDDQE 179

Query: 177 LVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVE 236
            VLT PYDS  D   FI+  S VLYMNNLPPDTTQSELE+WFTQFG RP+GFWTVKN++E
Sbjct: 180 KVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILE 239

Query: 237 DTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVE 296
           DT             YVEE DSISGF+VF +H+ A + L LNG SILSN+ANTKQPRVVE
Sbjct: 240 DTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVE 299

Query: 297 HVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATS 356
           HVVE++PSS +V++  Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQRR ACFRCSFP   
Sbjct: 300 HVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQ 359

Query: 357 AVTVSK 362
           AV  S+
Sbjct: 360 AVGSSQ 365

 Score = 70.1 bits (170), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 28/33 (84%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           VPFRAGDWKCL C YHNFAKNIVCLRC  PK+ 
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKSG 509

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 19/29 (65%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355
           R GDW C +CG+ NF + I C RCS P +
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPK 531
           R GDW C +C + NF +   C RC  P+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQ 357

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  395 bits (1015), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/431 (48%), Positives = 263/431 (61%), Gaps = 46/431 (10%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPEL--LPLYADAREIEVGGGGVQMATG 58
           M+YV+ E D  H+ +TPKDH R++K+ +QL++   L  +P   D   I+      + A  
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60

Query: 59  QLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRW 118
           +L  ++   T    F+LCSL STW +RVTL RQA D G  +P FL + K+FDL KE  RW
Sbjct: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120

Query: 119 CANHVSERACNAGAKGD--------------------VAELFRVLD-----LDEQLVSHA 153
           C NH    +     + D                    + +++   +     +D+++  + 
Sbjct: 121 CLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYNFKEENDGAIDDKMFKNE 180

Query: 154 Y-IQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQS 212
             +  +T VLLQL  +CTT++D   VLT PYDS  D+ SF+QERS VLYMNNLP DTTQS
Sbjct: 181 RDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLPSDTTQS 240

Query: 213 ELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAAS 272
           ELESWFTQFG RPVGFWT KNVV DT             YVEE DSI GFVVFQ+HE A 
Sbjct: 241 ELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQTHEEAI 300

Query: 273 EALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWN 332
           E L LNGR+ILSN+ANTKQPRVVEHVVE++PSS+ VLD A EILS FPQSKNKPRPGDW+
Sbjct: 301 EVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKPRPGDWS 360

Query: 333 CPSCGFSNFQRRIACFRCSFPATSAVTVSKLYKPQQQRHYQNPH-HVPSKQQVQHPQIHD 391
           CPSCGFSNFQRR ACFRCSFPA S                 N H ++ S+    HP+I  
Sbjct: 361 CPSCGFSNFQRRTACFRCSFPAPS-----------------NGHINIKSQNNSHHPEITS 403

Query: 392 QDTQQHSQHFN 402
           +   + SQ  N
Sbjct: 404 EHNTEGSQQNN 414

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 30/33 (90%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           +PFRAGDW C +C+YHNFAKN++CLRCG PKT+
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358
           R GDWNC SC + NF + + C RC  P TS +
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTSTI 489

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C +C + NF +   C RC  P  +N
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSN 385

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  390 bits (1003), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 196/391 (50%), Positives = 251/391 (64%), Gaps = 34/391 (8%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAR--EIEVGGGGVQMATG 58
           MYY+  E +  HK +TPKDH ++  + YQLI+      L  D +  ++ +   G  MA G
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 59  ----------QLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKV 108
                     Q    +++   +E  VLCSL+STW LRVT+PRQ++DEG +LP FL    +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 109 FDLWKECDRWCANHVSERACNAGAK-GDVAELFRVLDLD---------EQL--------V 150
           FDLWKE  RWC  H SE       K  D +EL+++L+++         E+L        +
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKTKKYKDSSELYKILEINQNSDAKTNNEKLNDRSGNINM 180

Query: 151 SHAYIQQATR----VLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLP 206
              Y +   R    V + + +KC+T ED   VLTHPY+S  D  +FIQE S+++YMNNLP
Sbjct: 181 DRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQTFIQETSKIIYMNNLP 240

Query: 207 PDTTQSELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQ 266
           PDTTQSELESWF QFG +P   WTV+N++E T             YVEEHDSISGF VFQ
Sbjct: 241 PDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNSPYVEEHDSISGFAVFQ 300

Query: 267 SHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKP 326
           +H+ A++AL LNGRSILSNMANTKQPRVVEH+VEL+PSS  +L+  QEI S FPQSKNKP
Sbjct: 301 THKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILERIQEISSQFPQSKNKP 360

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSA 357
           RPGDWNC SCGFSNFQRR +CFRCSFPA ++
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAATS 391

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSS 548
           VPFRAGDWKC  CSYHNFAKNIVCLRCG PK      TQA L  ++ S
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPK------TQAILNDMNKS 588

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358
           R GDW C +C + NF + I C RC  P T A+
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAI 581

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNP 530
           R GDW C++C + NF +   C RC  P
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFP 387

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  380 bits (976), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/373 (51%), Positives = 237/373 (63%), Gaps = 16/373 (4%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIE---VGGGGVQMAT 57
           M+YVL E       D+ KD  ++ ++ YQ+I    L     +  EI    V G  +Q   
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSNLQDTV 60

Query: 58  GQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDR 117
              E  +      E FVLCS+ STW LRV LPR+A+DE   LP  L +  V DLWKE DR
Sbjct: 61  LLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEFDR 120

Query: 118 WCANH----VSERACNAGAKGDVAELFRVLDLDEQLVSHAYIQQATR--------VLLQL 165
           WC NH     S +  N   K ++  + +VL ++++L         TR        +LLQL
Sbjct: 121 WCTNHPDALQSVKGYNRKCK-NLPMVHQVLGVEQRLNESVNANGYTRKEVGITSDILLQL 179

Query: 166 HNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARP 225
           H KC++ +D + VLT PY+S  D  +F +E+S VLY+NNLPPDTTQ ELE+WF QFG+RP
Sbjct: 180 HKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFGSRP 239

Query: 226 VGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSN 285
           V FWT KN+VEDT             YVEE DS+SGF  FQ+ E A  AL L+GRSILSN
Sbjct: 240 VSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSILSN 299

Query: 286 MANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRI 345
           +ANTKQPR+VEHVVE+ PSS+R+L  ++EILS FPQSKNKPRPGDWNCPSCGFSNFQRR 
Sbjct: 300 VANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQRRT 359

Query: 346 ACFRCSFPATSAV 358
           ACFRCSFP  SAV
Sbjct: 360 ACFRCSFPVPSAV 372

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 29/33 (87%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           +PFRAGDWKC  C+YHNFAKNI+CLRC  PKT+
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKTS 474

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATS 356
           R GDW C +C + NF + I C RCS P TS
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTS 474

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNP 530
           R GDW C +C + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  364 bits (934), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 244/420 (58%), Gaps = 57/420 (13%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATG-- 58
           MYY++ E D  H  +TPKDH R+SK+ YQ + + E L  Y    E++V     + A    
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFV-DAESLECYYGKDEVKVISIDDESAISFK 59

Query: 59  ----QLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKV------ 108
               QL+  ++     + FV CSL+S W LRVT+PRQA DE   LP +L   KV      
Sbjct: 60  DMIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKE 119

Query: 109 FDLW-------------------------------------KEC-------DRWCANHVS 124
           F+ W                                     KE        D   AN  +
Sbjct: 120 FNRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGA 179

Query: 125 ERACNAGAKGDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYD 184
           E + NA       +     D  E   +   I + T +L  +H KCTT ED +LVLT PYD
Sbjct: 180 EESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239

Query: 185 SYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTXXXXXX 244
           S +D  +F +E S++LYMNNLPPDTTQSELESWF QFG++PV FWTVKN+VE+T      
Sbjct: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNN 299

Query: 245 XXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPS 304
                  YVEE DSISGFV FQSH+ A++AL LNGRSILSNMANTKQPRVVEH+VE++PS
Sbjct: 300 WSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359

Query: 305 SSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVSKLY 364
           S  VL+  Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRR ACFRCS+PA S    S+ Y
Sbjct: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASNNLNSRKY 419

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 30/32 (93%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKT 532
           VPFRAGDWKC+ CSYHNFAKN+VCLRCG PK+
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534
           R GDW C++C + NF +   C RC  P  +N
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355
           R GDW C +C + NF + + C RC  P +
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  307 bits (787), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 161/360 (44%), Positives = 218/360 (60%), Gaps = 13/360 (3%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQL--IHEPELLPLYADAREIEVGGG--GVQMA 56
           M+YV+ E +  H+E T KD  R+  + YQ+  I +  LL        I +       Q A
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116
             QL++ ++       FV+C+L+S  +LRVTL RQA D G  LP +L + K+FDLW E  
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 117 RWCANHVSERACNAG--AKGDVAELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAED 174
           ++CANH  E   N       DVA L  +L L      +  I  +T VLL L+ KC+++ED
Sbjct: 121 KFCANH-PELDLNEEMVTSKDVAILTDILGLQSNNTENYTIDISTDVLLSLYKKCSSSED 179

Query: 175 QSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNV 234
              VLT PYD   D+ +F +E + V++++NLPPD TQ+ELE+WF    ++P+ +WT K  
Sbjct: 180 IKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTP 239

Query: 235 VEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRV 294
            E               YV    SI GF++FQ+HE A ++L LNG+SI S+  + KQ   
Sbjct: 240 DE------YSRNFHNNTYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYP 293

Query: 295 VEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPA 354
           VEH++E+ PSS++VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRR ACFRCSFPA
Sbjct: 294 VEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPA 353

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 26/33 (78%), Positives = 30/33 (90%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTA 533
           VPFRAGDWKC +C+YHNFAKNI CLRCG+PK +
Sbjct: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358
           R GDW CPSC + NF + IAC RC  P  S +
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSGI 480

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNP 530
           R GDW C +C + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  241 bits (615), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 137/393 (34%), Positives = 209/393 (53%), Gaps = 44/393 (11%)

Query: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGGGVQMATGQL 60
           M+YV+ +  +    D+      + ++ YQ+I +P  L    +   ++V G  ++    +L
Sbjct: 1   MHYVVLDVQI----DSSAVKPVLLRLGYQVI-DPVSLEARNEPYVVDVDGESIKEFIAKL 55

Query: 61  EAALQE-----------------ATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFL 103
           +  L+                  +   + FV C+L+ +W ++V L   A+D G  LP +L
Sbjct: 56  DEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVELPEYL 115

Query: 104 AHAKVFDLWKECDRWCANHV-SERACNAGAKGD--------VAELFRVLDLDEQLVSHAY 154
            +   FD+WKE   W  NH  S  +    A G+        + EL R LD+  +      
Sbjct: 116 RYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGKIEELVRTLDVSTEYDELKQ 175

Query: 155 --------IQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLP 206
                   ++ AT VL  LH KC T  D + VLT PYD   D  +FI+E+S++LY++N+P
Sbjct: 176 KNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIEEQSKILYISNIP 235

Query: 207 PDTTQSELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQ 266
            +  Q++LE WF Q G   VGFWT+KN+ +D             + +   DS+ GF +FQ
Sbjct: 236 SELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHG---KMLSIPDSMFGFAIFQ 292

Query: 267 SHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKP 326
           SH  A  ALNL+G   +  +   K  + +E +++++PSS R+L+  Q+ L   PQ+KNKP
Sbjct: 293 SHNDAEYALNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRLLEKVQDNLILLPQNKNKP 350

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAVT 359
           RPGDWNCPSCGFSNFQRR ACFRC+FP  + V+
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVS 383

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 28/32 (87%)

Query: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKT 532
           VPFRAGDWKC  C YHNFAKNIVCLRCG PKT
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKT 563

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%)

Query: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATSAVTVSK 362
           R GDW CP C + NF + I C RC  P T   T  K
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDK 570

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 504 RAGDWKCLNCSYHNFAKNIVCLRCGNP 530
           R GDW C +C + NF +   C RC  P
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFP 377

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 199 VLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNV 234
           VL + NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 26/103 (25%)

Query: 200 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTXXXXXXXXXXXXRYVEEHDSI 259
           +Y+ N+ P+T Q E E  F+Q+GA       + + V +T                     
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDNEGKLRGF------------ 263

Query: 260 SGFVVFQSHEAASEAL------NLNGRSILSNMANTKQPRVVE 296
            GFV F+ H AA++A+      + NG+ +    A  K  R+ E
Sbjct: 264 -GFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQE 305

>KNAG0H01710 Chr8 (304440..304469,304846..306099) [1284 bp, 427 aa]
           {ON} Anc_1.408 YNL004W intron location uncertain
          Length = 427

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 51/130 (39%), Gaps = 11/130 (8%)

Query: 99  LPMFLAHAKVFDLWKECDRWCANHV---SERACNAGAK---GDVAELFRVLDLDEQLVSH 152
           LP  +    + D++KEC R     V   SER  N   K    +  ++ R LD        
Sbjct: 247 LPHSINWQALKDMFKECGRVLRADVEKNSERYSNGSGKVTFSNYEDMKRSLDKYNGFRIE 306

Query: 153 AYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQS 212
             + + + V     N   TAE        P D + +      ER+  ++ +NLP  TT+ 
Sbjct: 307 GNVLEVSEVGKTSANSTPTAE-----KVEPVDKFPEGFVAGGERNNYIFCSNLPAPTTKG 361

Query: 213 ELESWFTQFG 222
           +L   F   G
Sbjct: 362 DLYDLFEIIG 371

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 23/102 (22%)

Query: 178 VLTHPYDSYADMTSFIQERSEV---LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNV 234
           V   P+ S  D  S ++E       +Y+ N+  +TTQ E E+ FTQFG           V
Sbjct: 198 VYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFGK------ITSAV 251

Query: 235 VEDTXXXXXXXXXXXXRYVEEHDSISGFVVFQSHEAASEALN 276
           +E              R  E      GF+ F+ HE+A++A++
Sbjct: 252 LE--------------RDSEGKPRGFGFINFEDHESAAKAVD 279

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 170 TTAEDQSL--VLTHPY---DSYADMTSFIQERS---EVLYMNNLPPDTTQSELESWFTQF 221
           TT E+Q L  V+  P    D+     +  +E++   + +Y   LP +TT ++L ++FT +
Sbjct: 147 TTDEEQQLANVINDPVTNADAPGTEQNISKEKAISEDTVYCAFLPKETTDNDLRNYFTDY 206

Query: 222 GARPVGFWTVKNV 234
           G+R +  +  KNV
Sbjct: 207 GSREIWIFRTKNV 219

>ZYRO0F16478g Chr6 (1354598..1355641) [1044 bp, 347 aa] {ON} similar
           to uniprot|P53844 Saccharomyces cerevisiae YNL264C PDR17
           Phosphatidylinositol transfer protein (PITP)
           downregulates Plb1p-mediated turnover of
           phosphatidylcholine found in the cytosol and microsomes
           homologous to Pdr16p deletion affects phospholipid
           composition
          Length = 347

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 47/127 (37%), Gaps = 9/127 (7%)

Query: 78  LHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWCANHVSERACNAGAKGDVA 137
           L STW     + R   +E   +P+  +  K+  L  E   W       R    G KG+V 
Sbjct: 44  LGSTWEAYKAILRHFQNENLQIPVNTSSKKLLPLVSEEKFWLTRECMLRYLK-GNKGNVQ 102

Query: 138 ELFRVLDLDEQLVSHAYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERS 197
               +  L+E LV          V L L +K     D  LV          +  F QER 
Sbjct: 103 --VSIQKLEESLVWR------REVGLTLLSKDAKPLDADLVAPENETGKEVILGFDQERR 154

Query: 198 EVLYMNN 204
            +LYM N
Sbjct: 155 PLLYMKN 161

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 199 VLYMNNLPPDTTQSELESWFT-QFGARPVGF 228
            LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 199 VLYMNNLPPDTTQSELESWF-TQFGARPVGF 228
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 609 TLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 199 VLYMNNLPPDTTQSELESWF-TQFGARPVGF 228
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 546 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 199 VLYMNNLPPDTTQSELESWF-TQFGARPVGF 228
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 522 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>TBLA0C04820 Chr3 (1168828..1170027) [1200 bp, 399 aa] {ON}
           Anc_7.267 YIL071C
          Length = 399

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 11/115 (9%)

Query: 27  YYQLIHEP-ELLPLYADAREIEVGGGGVQMATGQLEAALQEATASEPFVLCSLHSTWHLR 85
           YYQ + E  +LL L  D         G++  + +LE   Q    +E   +  LHS    +
Sbjct: 103 YYQYLEEIGKLLVLKRDFH-------GLEKLSYRLEGYHQNNKETESISIDELHSYQRCK 155

Query: 86  VTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWCANHVSERACNAGAKGDVAELF 140
           + L      EG+    F     VF LWKE      NHV +   ++  + ++  ++
Sbjct: 156 LMLTISKILEGNF---FETCYNVFQLWKENPEIILNHVGKHHASSNIQENIESIY 207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.131    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,106,974
Number of extensions: 2032485
Number of successful extensions: 11300
Number of sequences better than 10.0: 71
Number of HSP's gapped: 11313
Number of HSP's successfully gapped: 136
Length of query: 628
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 512
Effective length of database: 40,180,143
Effective search space: 20572233216
Effective search space used: 20572233216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)