Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL148C7.350ON38138118480.0
SAKL0F11374g7.350ON38338115810.0
Ecym_47237.350ON38138115800.0
CAGL0L01111g7.350ON38137815370.0
NCAS0A141607.350ON45138115420.0
Kpol_530.317.350ON38037815280.0
Skud_4.897.350ON38538115260.0
Kwal_56.246427.350ON38137815220.0
TBLA0E00390singletonON38338115170.0
Suva_4.787.350ON38538015100.0
TDEL0C019807.350ON38537815090.0
KLTH0H01254g7.350ON38137815080.0
YDL168W (SFA1)7.350ON38637815070.0
KLLA0D12342g7.350ON38438015010.0
ZYRO0F11704g7.350ON38237714980.0
Smik_4.707.350ON38638014970.0
TPHA0F029707.350ON38137414500.0
KAFR0B008807.350ON38138114350.0
KNAG0C037907.350ON38238213160.0
NDAI0A018907.350ON42238112731e-175
SAKL0A00880gsingletonON38838010491e-141
KLLA0B00451gsingletonON3863902002e-16
CAGL0J01441g2.480ON3723311852e-14
KLLA0D19929gsingletonON3863471824e-14
KLTH0G18986g8.16ON3542031781e-13
Kwal_55.19574singletonON3562001711e-12
YBR145W (ADH5)3.118ON3513031692e-12
TBLA0I011402.480ON3772641683e-12
SAKL0B00814g8.16ON3542021665e-12
Kwal_26.6684singletonON3563651648e-12
KNAG0K01040singletonON3913031631e-11
TDEL0C003908.16ON3533801612e-11
KNAG0K020003.118ON3503561593e-11
Smik_2.2843.118ON3513031593e-11
KLLA0F13530g2.480ON3752571594e-11
TPHA0G032102.480ON3773621594e-11
Suva_4.3943.118ON3513661585e-11
Ecym_73912.480ON3752701585e-11
Ecym_53313.118ON3483631567e-11
Suva_10.1548.16ON3562001532e-10
YLR070C (XYL2)8.16ON3561881532e-10
KLTH0D05588g2.480ON3892641523e-10
KLTH0G15686g3.118ON3513651514e-10
NCAS0I023503.118ON3513501504e-10
YOL086C (ADH1)3.118ON3483581496e-10
Kwal_26.77992.480ON3872641488e-10
YJR159W (SOR1)na 1ON3572011489e-10
KAFR0A007902.480ON3773331489e-10
YDL246C (SOR2)singletonON3572011489e-10
Smik_48.1singletonON3572021471e-09
NDAI0H021602.480ON3812641471e-09
NCAS0A077802.480ON3732641471e-09
Skud_2.2723.118ON3513031471e-09
AER032W3.118ON3512971461e-09
TBLA0E034403.118ON3512641443e-09
CAGL0D00198g7.3ON3833501443e-09
ZYRO0G03388g2.480ON3703061434e-09
Skud_13.477na 2ON3483561424e-09
SAKL0E02838g2.480ON3772641434e-09
NCAS0I01720singletonON3513621424e-09
TBLA0E03430singletonON3513651424e-09
Suva_12.260singletonON3572031415e-09
Suva_15.813.118ON3483551415e-09
ZYRO0B05940g3.118ON3793511417e-09
NDAI0H020507.3ON3851041417e-09
Skud_20.2singletonON3572031408e-09
Skud_4.2singletonON3572031408e-09
Kpol_1058.118.16ON3531061408e-09
YMR083W (ADH3)2.480ON3752711408e-09
SAKL0C10164g3.118ON3512841399e-09
KAFR0G014203.118ON3512771399e-09
YMR303C (ADH2)na 2ON3483631391e-08
Smik_15.713.118ON3483581391e-08
TDEL0A025602.480ON3733621391e-08
Smik_13.520na 2ON3483551381e-08
KLLA0B09064gna 3ON3743171381e-08
Smik_13.2662.480ON3752711372e-08
SAKL0B08184gna 3ON3733281372e-08
TPHA0M007303.118ON3503581372e-08
KLLA0F21010g3.118ON3502571362e-08
KLTH0E05588gna 4ON3482641363e-08
YAL060W (BDH1)7.3ON3823061353e-08
Suva_13.494na 2ON3482951344e-08
SAKL0D14872g7.3ON3831041354e-08
ZYRO0C12562gna 4ON3483521344e-08
Skud_15.683.118ON3483581345e-08
Kpol_1049.187.2ON3862191345e-08
SAKL0F06270gna 4ON3513721327e-08
KLLA0F00506g7.3ON3853061329e-08
Kpol_1036.193.118ON3533551319e-08
KLTH0D00616g7.3ON3821861321e-07
Skud_13.2402.480ON3752711311e-07
KAFR0I001707.3ON3811741311e-07
NCAS0J003008.16ON3571291311e-07
AAR084WsingletonON3852851311e-07
NDAI0A069303.118ON3512971301e-07
KLLA0F18260gsingletonON3482571301e-07
TDEL0H044607.3ON3822781302e-07
CAGL0I07843g3.118ON3522711282e-07
KAFR0I001607.2ON3851891282e-07
NCAS0A076707.2ON4391011274e-07
Suva_13.2612.480ON3752711264e-07
Smik_1.67.3ON3823061256e-07
KAFR0L02010singletonON3512541247e-07
TDEL0F03190na 4ON3513571247e-07
Suva_1.77.3ON3822211231e-06
KNAG0E025902.480ON3742711231e-06
NCAS0A076607.3ON3861051231e-06
KNAG0I00120singletonON3811061231e-06
TBLA0A042907.3ON3952151231e-06
ZYRO0G03410gsingletonON3733521231e-06
Kpol_431.82.480ON3802491221e-06
TDEL0D050503.118ON3512491202e-06
Kwal_56.231983.118ON3513661202e-06
Skud_1.37.3ON3822191202e-06
ABL033C2.480ON3732981184e-06
ZYRO0F02552g8.16ON3511161175e-06
ABR229C8.16ON3531821175e-06
KAFR0L02000singletonON3612521176e-06
Kwal_26.67397.3ON3822111176e-06
SAKL0D14894g7.2ON3852151159e-06
KLLA0D05511g8.16ON3541961151e-05
Suva_1.67.2ON417911132e-05
YAL061W (BDH2)7.2ON4171031113e-05
Kwal_55.20564singletonON2162251084e-05
Skud_1.27.2ON4171011114e-05
Smik_1.57.2ON4171011071e-04
Kwal_47.17532na 5ON3732241024e-04
KLTH0A00418gsingletonON356247999e-04
SAKL0D14938gsingletonON378175990.001
KLLA0A10549g3.253ON35389980.001
TPHA0J00170singletonON361356940.004
KLLA0F00528g7.2ON381316940.004
KNAG0D00110singletonON362308930.005
ABL090W3.253ON33487930.005
SAKL0H22088gna 5ON376318920.008
KLTH0E07964gna 5ON374152910.010
NDAI0H020607.2ON399101870.029
KNAG0E042007.2ON385186850.054
KLLA0F00638gna 6ON382141840.076
NCAS0C03020singletonON362360830.081
Suva_6.13singletonON6859700.41
TPHA0H03100singletonON392105780.42
NDAI0H02950singletonON363340770.44
KAFR0A08730singletonON360295760.64
Ecym_53113.191ON28792731.4
Skud_86.1singletonON8959662.2
TDEL0A00140singletonON405175703.4
CAGL0H06853gsingletonON360132703.8
KAFR0B00110singletonON414120694.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL148C
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   716   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   613   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   613   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   596   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   598   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   593   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   592   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   590   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      588   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   586   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   585   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   585   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   585   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   582   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   581   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   581   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   563   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   557   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   511   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    494   e-175
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   408   e-141
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    82   2e-16
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    76   2e-14
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    75   4e-14
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    73   1e-13
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    70   1e-12
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    70   2e-12
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    69   3e-12
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    69   5e-12
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    68   8e-12
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    67   1e-11
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    67   2e-11
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    66   3e-11
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    66   3e-11
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    66   4e-11
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    66   4e-11
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    65   5e-11
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    65   5e-11
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    65   7e-11
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    64   2e-10
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    64   2e-10
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    63   3e-10
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    63   4e-10
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     62   4e-10
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    62   6e-10
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    62   8e-10
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    62   9e-10
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    62   9e-10
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    62   9e-10
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    61   1e-09
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     61   1e-09
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    61   1e-09
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    61   1e-09
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    61   1e-09
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    60   3e-09
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    60   3e-09
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    60   4e-09
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    59   4e-09
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    60   4e-09
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               59   4e-09
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               59   4e-09
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    59   5e-09
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    59   5e-09
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    59   7e-09
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    59   7e-09
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     59   8e-09
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    59   8e-09
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    59   8e-09
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    59   8e-09
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    58   9e-09
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    58   9e-09
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    58   1e-08
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    58   1e-08
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    58   1e-08
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    58   1e-08
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    58   1e-08
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    57   2e-08
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    57   2e-08
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    57   2e-08
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    57   2e-08
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    57   3e-08
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    57   3e-08
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    56   4e-08
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    57   4e-08
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    56   4e-08
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    56   5e-08
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    56   5e-08
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    55   7e-08
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    55   9e-08
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    55   9e-08
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    55   1e-07
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    55   1e-07
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    55   1e-07
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       55   1e-07
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    55   1e-07
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    55   1e-07
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    55   1e-07
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    55   2e-07
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    54   2e-07
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    54   2e-07
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    54   4e-07
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    53   4e-07
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     53   6e-07
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              52   7e-07
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    52   7e-07
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     52   1e-06
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    52   1e-06
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    52   1e-06
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  52   1e-06
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    52   1e-06
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    52   1e-06
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    52   1e-06
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    51   2e-06
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    51   2e-06
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     51   2e-06
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    50   4e-06
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    50   5e-06
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    50   5e-06
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              50   6e-06
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    50   6e-06
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    49   9e-06
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    49   1e-05
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     48   2e-05
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    47   3e-05
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    46   4e-05
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      47   4e-05
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     46   1e-04
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    44   4e-04
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    43   9e-04
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    43   0.001
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    42   0.001
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                41   0.004
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    41   0.004
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   40   0.005
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    40   0.005
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    40   0.008
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    40   0.010
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    38   0.029
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    37   0.054
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    37   0.076
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    37   0.081
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    32   0.41 
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    35   0.42 
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    34   0.44 
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    34   0.64 
Ecym_5311 Chr5 complement(631236..632099) [864 bp, 287 aa] {ON} ...    33   1.4  
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    30   2.2  
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 32   3.4  
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    32   3.8  
KAFR0B00110 Chr2 (8533..9777) [1245 bp, 414 aa] {ON}                   31   4.7  

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/381 (92%), Positives = 352/381 (92%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP
Sbjct: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EGLFPCIL               TNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT
Sbjct: 61  EGLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYT              PLETVCLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGV 180

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG
Sbjct: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EINSGFEDLHHGDCLRTVLSL
Sbjct: 361 EINSGFEDLHHGDCLRTVLSL 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/381 (76%), Positives = 322/381 (84%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MSET GKPI C AAVAY AG+PL +E++ V+PPKAHEVRI+I  +A+CHTDAYTLSG DP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EG FP IL               TNVKPGDHVV LYTAECQ+CKFC SGKTNLCG+VRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKGVMPDGTSRFR   GE++ HFMGCSTFS+YT              PL+ +CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAKAR ASRIIVVDIND K++WAS FG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP  DLKEGETIV++LIE+TDGGLD TFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLV DY++G LKV EF+TH+RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN+ F+DLHHGDCLRTVL L
Sbjct: 361 EINAAFDDLHHGDCLRTVLDL 381

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/381 (76%), Positives = 319/381 (83%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MS T GK IQC AA+AY AG PL+IE +TVDPPKAHEVRIKI ++A+CHTDAYTLSG DP
Sbjct: 1   MSITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDP 60

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EG+FP IL               TNVK GDHV+PLYTAECQ+CKFC+SGKTNLCG+VRAT
Sbjct: 61  EGIFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRAT 120

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKG+MPDGTSRF+N KGE +YHFMGCSTFSEYT              PL+ VCLLGCGV
Sbjct: 121 QGKGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGV 180

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAAVKTADVQ+GDTVAVFGAGTVGLSVVQGA++R AS+IIVVDIND K++W+  FG
Sbjct: 181 TTGYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFG 240

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINP  DL +GETIV++LI+MTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG
Sbjct: 241 ATDFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMG L+ DY  G LKV EFVTH RPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFS 360

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN G  DLHHGDCLRTVL+ 
Sbjct: 361 EINDGLTDLHHGDCLRTVLNF 381

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/378 (74%), Positives = 314/378 (83%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           T+GKPI+C AAVAY AG+P  +E++ VDPPKAHEVRIKIVN+A+CHTDAYTLSG+DPEGL
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 64  FPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           FPC+L               TNVKPGDHV+ LYTAECQ+CKFC+SGKTNLCGAVRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           GVMPDGTSRF N KGE+LYHFMGCSTFSEYT              PLE+VCLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           YGAAVKTA+VQ+GDTVAVFG GTVGLSV+QGA  R ASRII +D ND K+++ ++FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINP  DLKE ETIVA+LIEMTDGGLDHTFDCTGN  VMR ALEACHKGWGQS+IIGVAA
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           AGQEISTRPFQLVTGRVWKGSAFGG+KGRSEM GL+  Y  G LKV EF+TH+R F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 364 SGFEDLHHGDCLRTVLSL 381
             F+DLH+G CLRTVLS 
Sbjct: 362 EAFDDLHNGLCLRTVLSF 379

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/381 (75%), Positives = 318/381 (83%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MS TQGKPI CTAAVAYAAG+PL +E++ VDPPKAHEVRIKI  +A+CHTDAYTLSG DP
Sbjct: 69  MSSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDP 128

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EG FP IL               TNVK GDHV+ LYTAEC +CKFC SGKTNLCG+VRAT
Sbjct: 129 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRAT 188

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKGVMPDGTSRF N KGE L HFMGCSTFS+YT              PL+++ LLGCGV
Sbjct: 189 QGKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGV 248

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAK+R AS+IIVVDIN+ K++W+  FG
Sbjct: 249 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFG 308

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NPK DLKEGETIV +LIEMTDGGL++TFDCTGN KVMRDALEACHKGWG+SIIIG
Sbjct: 309 ATDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIG 368

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VA AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY NG LKV EF+TH+RPF 
Sbjct: 369 VAGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFT 428

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN  FEDLHHGDCLRTVL L
Sbjct: 429 EINDAFEDLHHGDCLRTVLDL 449

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/378 (74%), Positives = 320/378 (84%), Gaps = 1/378 (0%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           T GKPI C AAVAY A +PL +E++ VDPPKAHEVRIKI+N+A+CHTDAYTLSG DPEGL
Sbjct: 3   TVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGL 62

Query: 64  FPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           FPC+L               T VKPGDHVV LYTAEC +CKFC+SGKTNLCG+VRATQGK
Sbjct: 63  FPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGK 122

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           GVMPDGT RF N KGE LYHFMGCSTFSEYT              PL++VCLLGCGVTTG
Sbjct: 123 GVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTG 182

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           YGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAK+R AS+IIVVDIN+ K+EW+++FGATD
Sbjct: 183 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATD 242

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP ++L EG+ IV++L+EMTDGGLD TFDCTGN  VMRDALEACHKGWGQSIIIGVAA
Sbjct: 243 FVNP-SELPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY NG+LKV EF+T++RPF EIN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEIN 361

Query: 364 SGFEDLHHGDCLRTVLSL 381
             FE+LHHG+CLRTVLS 
Sbjct: 362 DAFEELHHGNCLRTVLSF 379

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/381 (73%), Positives = 315/381 (82%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           ++ T GKPIQC AAVAY A + L +E++TVDPPKAHEVRIKI  +A+CHTDAYTLSGSDP
Sbjct: 2   LAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDP 61

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EGLFPCIL                 VKPGDHV+ LYTAEC +CKFC SGKTNLC AVRAT
Sbjct: 62  EGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRAT 121

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKGVMPDGT+RF N KGE +YHFMGCSTFSEYT              PL+  CLLGCGV
Sbjct: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAA+KTA+VQEGDTVAVFG GTVGLSV+QGAK+R AS+II VDIN+ KR+++S FG
Sbjct: 182 TTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFG 241

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINPK DL E +TIV +LI+MTDGGLD TFDCTGNT +MRDALEACHKGWGQSIIIG
Sbjct: 242 ATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIG 301

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY +G LKV+EF+TH+RPF+
Sbjct: 302 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFK 361

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN  FEDLH+GDCLRTVL  
Sbjct: 362 EINQAFEDLHNGDCLRTVLRF 382

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/378 (74%), Positives = 315/378 (83%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           ++GKPI C AAVAY AG+PL IE++ VDPPKAHEVR+KI  +A+CHTDAYTLSG DPEG 
Sbjct: 2   SEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGA 61

Query: 64  FPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           FP IL               TNVKPGDHV+ LYTAEC++CKFC SGKTNLCG+VRATQGK
Sbjct: 62  FPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           GVMPDGT+RF N KGE + HFMGCSTFS+YT              PL+  CLLGCGVTTG
Sbjct: 122 GVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           YGAAVKTA+VQ+GDTVAVFGAGTVGLSVVQGAK R ASRIIVVDIND K++WA++FGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATD 241

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP  DLK+G+TIV  L+EMTDGGLD+TFDCTGNT VMR ALEACHKGWG+SIIIGVAA
Sbjct: 242 FVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY++G LKV EF+TH+R F +IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDIN 361

Query: 364 SGFEDLHHGDCLRTVLSL 381
           S FEDLHHGDCLRTVL L
Sbjct: 362 SAFEDLHHGDCLRTVLDL 379

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/381 (72%), Positives = 316/381 (82%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MSETQGKPI+C AAVAY A EPL +E++ V+PP+AHEVRIKI ++A+CHTDAYTLSG DP
Sbjct: 1   MSETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDP 60

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EG FPC+L               ++VK GDHV+ LYTAEC  CKFC SGKTNLCG+VR T
Sbjct: 61  EGAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRET 120

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKGVMPDGTSRF+N KGE+L HFMGCSTFS+YT              PL++VCLLGCGV
Sbjct: 121 QGKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGV 180

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAA+KTA+VQ+ DTVAVFGAGTVGLSVVQGA+AR AS+II+VD+N  K  ++ +FG
Sbjct: 181 TTGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFG 240

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINP TDLK GETIV++L+EMTDGGLDHTFDCTGN KVMRDALE CHKGWGQSIIIG
Sbjct: 241 ATDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAGQEISTRPFQLVTGRVWKGSAFGG+KGRSEMGGL+  Y  G LKV +F+T+KRPF 
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFT 360

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN+ FEDLHHGDCLRTVL L
Sbjct: 361 EINAAFEDLHHGDCLRTVLDL 381

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/380 (73%), Positives = 313/380 (82%)

Query: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61
           + T GKPIQC AA+AY A +PL +E++TVDPPKAHEVRIKI  +A+CHTDAYTLSGSDPE
Sbjct: 3   ASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
           GLFPCIL               T VKPGDHV+ LYTAEC +CKFC SGKTNLC AVRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
           G+G+MPD T+RF NGKGE +YHFMGCSTFSEYT              PL+   LLGCGVT
Sbjct: 123 GRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVT 182

Query: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241
           TGYGAAVKTA+VQ+GDTVAVFG GTVGLSV+QGAKAR AS+II +DIN+ K+++   FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGA 242

Query: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           TDFINPK DL +G+TIV +LIE TDGGLD TFDCTGNTK+MRDALEACHKGWGQSIIIGV
Sbjct: 243 TDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361
           AAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY NG LKV+EF+TH+RPF+E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKE 362

Query: 362 INSGFEDLHHGDCLRTVLSL 381
           IN  FEDLH GDCLRTVL  
Sbjct: 363 INQAFEDLHQGDCLRTVLKF 382

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/378 (74%), Positives = 315/378 (83%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           T+GK I C AAVAY AG+PL +E++TV+ P+AHEVRIKI  +A+CHTDAYTLSG DPEG 
Sbjct: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65

Query: 64  FPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           FP IL               TNVKPGDHV+ LYTAECQ+CKFC SGKTNLC +VRATQGK
Sbjct: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           GVMPDGTSRF+N KGE L HFMGCSTFS+YT              PLE++CLLGCGVTTG
Sbjct: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTG 185

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           YGAA KTA+VQ+GDTVAVFGAGTVGLSV+QGAK R ASRII+VDIND KR++ ++FGATD
Sbjct: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINPK+DLK+G+TIV +LIEMTDGGLD+TFDCTGNTKVMRDALEACHKGWG S+IIGVAA
Sbjct: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  GTLKV EF+T++RPF EIN
Sbjct: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365

Query: 364 SGFEDLHHGDCLRTVLSL 381
             FEDLH GDCLRTVL L
Sbjct: 366 KAFEDLHAGDCLRTVLDL 383

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/378 (73%), Positives = 311/378 (82%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           ++GKPI CTAAVAY AG+PL +E++ VDPPKAHEVRIK+  +A+CHTDAYTLSG DPEG 
Sbjct: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61

Query: 64  FPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           FP IL               TNVK GDHV+ LYTAEC++CKFC SGKTNLCG+VRATQGK
Sbjct: 62  FPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           GVMPDGTSRF N KGE L HFMGCSTFS+YT              PL+  CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           YGAAVKTADVQ+GDTVA+FGAGTVGLSVVQGA  R AS+IIVVDIND K++W+  FGATD
Sbjct: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           F+NP   LK+G+TIV +L+EMTDGGLD TFDCTGNT VMR ALEACHKGWGQSIIIGVAA
Sbjct: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLV DY++G LKV EF+TH+R F +IN
Sbjct: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361

Query: 364 SGFEDLHHGDCLRTVLSL 381
           S FEDLHHGDCLRTVL L
Sbjct: 362 SAFEDLHHGDCLRTVLDL 379

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/378 (72%), Positives = 314/378 (83%)

Query: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61
           + T GKPI+C AAVAY A +PL +E++TVD PKAHEVRIKI  +A+CHTDAYTLSGSDPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
           GLFPC+L                 VKPGDHV+ LYTAEC +CKFC SGKTNLCGAVRATQ
Sbjct: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
           GKGVMPDGT+RF N KGE +YHFMGCSTFSEYT              PL+  CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182

Query: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241
           TG+GAA+KTA+VQ+GDTVAVFG GTVGLSV+QGAK R AS+II +DIN+ K+++ S+FGA
Sbjct: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGA 242

Query: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           TDF+NPK DL + +TIV +LIEMTDGGLD TFDCTGNTK+MRDALEACHKGWGQSIIIGV
Sbjct: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361
           AAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY  G LKV+EF+TH+RPF+E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362

Query: 362 INSGFEDLHHGDCLRTVL 379
           IN  FEDLH+GDCLRTVL
Sbjct: 363 INQAFEDLHNGDCLRTVL 380

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/380 (73%), Positives = 311/380 (81%)

Query: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61
           S T GKPI+C AAVAY AG+PL +EK+ VD PKAHEVR+++ ++A+CHTDAYTLSG DPE
Sbjct: 3   SATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPE 62

Query: 62  GLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
           G FP IL               TNVK GDHVV LYTAEC +CKFC S KTNLCG+VRATQ
Sbjct: 63  GAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQ 122

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
           GKGVMPDGT+RF N KGE L HFMGCSTFS+YT              PL +VCLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVT 182

Query: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241
           TGYGAAVKTA+VQEGDTVAVFGAGTVGLSVVQGAK+R AS+IIVVD+ND K++W+  FGA
Sbjct: 183 TGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGA 242

Query: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           T F+NP  DLKEGETIV++LI+MTDGGLD TFDCTGN KVMRDALEACHKGWGQSIIIGV
Sbjct: 243 TGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361
           AAAG+EISTRPFQL+TGRVWKGSAFGGIKGRSEMG LV  Y  G LKV +F+THKRPF E
Sbjct: 303 AAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTE 362

Query: 362 INSGFEDLHHGDCLRTVLSL 381
           IN+ FEDLHHGDCLRTVL L
Sbjct: 363 INNAFEDLHHGDCLRTVLDL 382

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/377 (73%), Positives = 315/377 (83%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           T+GKP+   AAVAY AG+PL +E++TVDPPKAHEVRI++  +A+CHTDAYTLSG+DPEG 
Sbjct: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62

Query: 64  FPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           FP IL               T+VKPGDHVV LYTAEC +CKFC SGKTNLCG+VRATQGK
Sbjct: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           GVMPDGTSRF+N KGETL HFMGCSTFSEYT              PLE+ CLLGCGVTTG
Sbjct: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTTG 182

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           YGAAVKTA+VQ+GDTVA+FGAGTVGLSV QGAKAR AS+II+VDINDAK+++  +FGATD
Sbjct: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
           FINP TDL+ G+TIV +LIEMTDGGLD TFDCTGN KVMRDALEACHKGWG S++IGVAA
Sbjct: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVAA 302

Query: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           +GQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY  G LKV EF+T++RPF++IN
Sbjct: 303 SGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362

Query: 364 SGFEDLHHGDCLRTVLS 380
             FEDLH GD LRTVL+
Sbjct: 363 EAFEDLHAGDSLRTVLN 379

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/380 (72%), Positives = 313/380 (82%)

Query: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61
           + T GKPI+C AAVAY A +P  +E++TVD PKAHEVRIKI  +A+CHTDAYTLSGSDPE
Sbjct: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62

Query: 62  GLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
           GLFPCIL                 VKPGDHV+ LYTAEC +CKFC SGKTNLC AVRATQ
Sbjct: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
           GKGVMPDGT+RF N KG+ +YHFMGCSTFSEYT              PL+  CLLGCGVT
Sbjct: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182

Query: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241
           TGYGAAVKTA+VQ+GDTVAVFG GTVGLSV+QGAK R AS+II VDIN+ K+++ S+FGA
Sbjct: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242

Query: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           TDFINPK DL + +TIV +L+EMTDGGLD TFDCTGNTK+MRDALEACHKGWGQSIIIGV
Sbjct: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGV 302

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361
           AAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY +G LKV+EF+TH+RPF+E
Sbjct: 303 AAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362

Query: 362 INSGFEDLHHGDCLRTVLSL 381
           IN  FEDLH+GDCLRTVL  
Sbjct: 363 INHAFEDLHNGDCLRTVLKF 382

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/374 (70%), Positives = 310/374 (82%), Gaps = 1/374 (0%)

Query: 6   GKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGLFP 65
           GKPI CTAA+AY A +PL + ++ VDPPKAHEVRIKIV +A+CHTDAY+LSG DPEGLFP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 66  CILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           C+L               TNVK GDHV+ LYTAEC +CKFC+SGKTNLCG+VRATQGKGV
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
           MPDGT+RF +  G+ +YHFMGCSTFS+YT                E   LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 186 AAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFI 245
           AA+KTA++Q+GDTVAVFGAGTVGLSVVQGAK+R AS+IIVVD+N+ K++W+ +FGATDF+
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 246 NPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305
           NPK +LK+ E IV++LIEMTDGGLD TFDCTGN  VMR+ALEACHKGWGQSIIIGVAAAG
Sbjct: 245 NPK-ELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 306 QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           QEI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGL++DY +GTLKV EF+T +RPF EIN+ 
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 366 FEDLHHGDCLRTVL 379
           FEDLH+G CLRTVL
Sbjct: 364 FEDLHNGSCLRTVL 377

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/381 (70%), Positives = 304/381 (79%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MS TQGK IQC AAVAY A +PL ++ V VD PKAHEVRIKI+N+AICHTDAYTLSG DP
Sbjct: 1   MSSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDP 60

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EGLFPCIL               T+VK GDHV+PLYTAECQ+CKFC SGKTNLCGAVR T
Sbjct: 61  EGLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRET 120

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           QGKGVMPDGTSRF   +G+ ++HFMGCSTFSEYT               LE   LLGCGV
Sbjct: 121 QGKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGV 180

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTG+GAAVK A+VQ+GDTVAVFGAGTVGLSVVQGA+ R  S++IVVDIND K++++  FG
Sbjct: 181 TTGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFG 240

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDF+NP TDLK+GETIV +LI MTDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIG
Sbjct: 241 ATDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIG 300

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAGQEISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+ EF+TH+R F+
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFD 360

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN GFEDLH G CLRTVL  
Sbjct: 361 EINDGFEDLHMGTCLRTVLKF 381

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/382 (67%), Positives = 299/382 (78%), Gaps = 3/382 (0%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPK-AHEVRIKIVNSAICHTDAYTL-SGS 58
           M+ T+G+ I CTAAVAYAAG+PL +E++TV+ P  A        +  + H   +++  GS
Sbjct: 1   MANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGS 60

Query: 59  DPEGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVR 118
           +   +  C                 T+VK GDHV+ LYTAEC++CK C SGKTNLC AVR
Sbjct: 61  EVRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVR 119

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
           ATQGKGVMPDGTSRFRN KGE L HFMGCSTF+EYT              PLE VCLLGC
Sbjct: 120 ATQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGC 179

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASK 238
           GVTTGYGAA+KTA+VQ+GDTVAVFGAGT+GLSVVQGAKAR AS+IIVVDIND K+++A  
Sbjct: 180 GVTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFD 239

Query: 239 FGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSII 298
           FGATDF+NPKTDLK+G+TIV +L+EMTDGGLD TFD TGN +VMRDALEACHKGWGQSII
Sbjct: 240 FGATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSII 299

Query: 299 IGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRP 358
           IGVAAAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMG L+ DY  G LK+ EF+T+KRP
Sbjct: 300 IGVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRP 359

Query: 359 FEEINSGFEDLHHGDCLRTVLS 380
           F+EIN GFEDLHHGDCLRTVL+
Sbjct: 360 FKEINEGFEDLHHGDCLRTVLN 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  494 bits (1273), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 248/381 (65%), Positives = 281/381 (73%), Gaps = 46/381 (12%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MS TQGKPI CTAAVAY AG+PL +E + VDPPKAHEVRIKI  +A+CHTDAYTLSG DP
Sbjct: 86  MSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDP 145

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EG FP IL               TNVK GDHV+ LYTAE              CG  +  
Sbjct: 146 EGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAE--------------CGECKFC 191

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           +         +  +N                                 P++++CLLGCGV
Sbjct: 192 KSGXXXXXXXAVDKNA--------------------------------PMDSICLLGCGV 219

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTGYGAA+KTA+VQ+GDTVAVFGAGTVGLSVVQGAKAR AS+IIVVD+ND K++W+  FG
Sbjct: 220 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFG 279

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
           ATDFINPKTDLKEGETIV++LIEMTDGGL++TFDCTGNTKVMRDALEACHKGWG+SIIIG
Sbjct: 280 ATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIG 339

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY NG LKV EF+TH+RPF 
Sbjct: 340 VAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFT 399

Query: 361 EINSGFEDLHHGDCLRTVLSL 381
           EIN+ FEDLHHGDCLRTVL L
Sbjct: 400 EINNAFEDLHHGDCLRTVLDL 420

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 260/380 (68%), Gaps = 3/380 (0%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           M   +G+PI+CTAAVAY+  +PL +E++ VDPP+ HEVR+K+ N+A+C TD +TL G +P
Sbjct: 1   MFYKEGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNP 60

Query: 61  EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRAT 120
           EG FPC+L                 VK GDHV+ LY  EC  C  C S K+NLC  ++AT
Sbjct: 61  EGKFPCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKAT 120

Query: 121 QGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGV 180
           Q +GVMP G+SR  N + +TL+HFMGCS+FS+Y               PL+ +CLLGCGV
Sbjct: 121 QAQGVMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGV 180

Query: 181 TTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           TTG+GA +    V+ GD VAVFG+GTVGLSVVQ        ++IVVD+ D KREWA  FG
Sbjct: 181 TTGFGAPIAKG-VKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFG 239

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDG-GLDHTFDCTGNTKVMRDALEACHKGWGQSIII 299
           ATDFINP+  + + ++++  LI+ + G G D TFDCTG+T VMR ALE+C KGWG S+II
Sbjct: 240 ATDFINPQ-KIPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVII 298

Query: 300 GVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
           G+A AG+EIST P+ L+ GR W+G AFGG+KGRSE+  LV  Y+N  +K+ E++T+KRP 
Sbjct: 299 GLAGAGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPL 358

Query: 360 EEINSGFEDLHHGDCLRTVL 379
           +EIN   ++L  G  L+TVL
Sbjct: 359 KEINEALKELEDGLVLKTVL 378

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 99/390 (25%), Positives = 155/390 (39%), Gaps = 56/390 (14%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVR---IKIVNSAICHTDAYTLSG 57
           M     +P    A V Y A + LR E   +  PK  + R   IK+ N++IC TD     G
Sbjct: 21  MIRKANQPGMMKAMVYYGAND-LRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKG 77

Query: 58  SDPE---------GLFPC-ILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCV 107
             PE         G F   +L                N+K GD V+      C  C+ C 
Sbjct: 78  KSPEIEEIAVKNEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCA 137

Query: 108 SGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETL-YHFMGCSTFSEYTXXXXXXXXXXXX 166
            G    C           M DG        G  L Y   G  T +EY             
Sbjct: 138 RGMYAHC-----------MNDG--------GWALGYSIDG--TQAEYVRTPFADTSLYAL 176

Query: 167 XXPL--ETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRII 224
              L  E   LL   + T +   V+  +V+ GD+VA+ GAG VG+  V  ++  + S +I
Sbjct: 177 PEGLSDENAVLLSDALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLI 236

Query: 225 VVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDG-GLDHTFDCTGNTKVMR 283
           VVD++D + E A + GAT  IN        E  VA+++E+T+G G+D   +  G     +
Sbjct: 237 VVDMDDNRLEMAKEMGATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG----AQ 287

Query: 284 DALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLVRD 341
              + C     Q I  G   A   +  +P      ++W    +   G+   +    L+++
Sbjct: 288 PTWDICQ----QIIKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKN 343

Query: 342 YLNGTLKVQEFVTHKRPFEEINSGFEDLHH 371
             +G L+  + V+H   F+++ + +    H
Sbjct: 344 CCSGKLQSDKLVSHHCNFKDMANNYNIFKH 373

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 130/331 (39%), Gaps = 34/331 (10%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y  G  L  + + V  PK +E+ I +  S +CHTD +   G  P
Sbjct: 21  LQSTLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWP 80

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
            G   P +                TN + GD+  +      C  C+FC  G  + C    
Sbjct: 81  LGAKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKAD 140

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
            +   G   DG                   +F +Y                L  V  + C
Sbjct: 141 LS---GYTHDG-------------------SFQQYATADAIQAAQIPKGTDLAQVAPILC 178

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K +DV+ G  VA+ G AG +G   VQ AKA    R++ +D  D KR+   
Sbjct: 179 AGVTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFE 236

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   F+    D  + + +V+ + E+T+GG     + + + K +  ++E   +  G  +
Sbjct: 237 SLGGNHFV----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVV 291

Query: 298 IIGVAAAGQEISTRPFQLVTGRV-WKGSAFG 327
           ++G+  AG  + +  F  V   +  KGS  G
Sbjct: 292 LVGL-PAGATVKSDVFNHVIKSINIKGSYVG 321

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 136/347 (39%), Gaps = 48/347 (13%)

Query: 40  IKIVNSAICHTDAYTLSGSDPE---------GLFPC-ILXXXXXXXXXXXXXXXTNVKPG 89
           IK+ +++IC TD     G +PE         G F   IL                N K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 90  DHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCST 149
           D V+    + C  C+ C     + C                    NG G  L  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-------------------TNGGGWIL-GYMIDGT 159

Query: 150 FSEYTXXXXXXXXXXXXXXPL--ETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTV 207
            +EY                L  E   +L   + T +   V+  +V+ GDTVA+ GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 208 GLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDG 267
           G+  V  ++  + S +IVVDI+D +   A + G+T  IN        E  V++++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG 274

Query: 268 -GLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVW--KGS 324
            G+D   +  G  +   D  +   K  G    +GV         +P      ++W    +
Sbjct: 275 RGVDCVMEAVG-AQATWDICQRVIKEGGHLANVGVHG-------KPVNFEIDKLWIKNLT 326

Query: 325 AFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHH 371
              G+   +  G L++   +G LK +  VTH   F E++  +    H
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYNIFKH 373

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 102/203 (50%), Gaps = 21/203 (10%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A K A V     VAVFGAG VGL     A+A  AS ++ +D+ + K   +S FG T F+N
Sbjct: 161 ANKLAGVAFNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN 220

Query: 247 PKTDLKEGETIVARLIEMTDGGL--DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
              ++K+ + +V + IE   GG   D  FDCTG    +R  ++ C+ G G  + +G+   
Sbjct: 221 -SANIKDEDDLV-KEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM--- 274

Query: 305 GQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
           G +    P   +  +  K       AFG  +   ++        +G + V+  VTH+  F
Sbjct: 275 GHDDVNFPIGAIGAKELKVLGCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKF 328

Query: 360 EEINSGFE-DLHHG-DCLRTVLS 380
           E+  + +E ++ HG + ++T++S
Sbjct: 329 EDAEAAYEFNIKHGSEVIKTIIS 351

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 96/200 (48%), Gaps = 17/200 (8%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPK 248
           K A V+ G TV VFGAG VGL     AKA  AS ++ VD+ D K E A  FGAT  IN  
Sbjct: 163 KLAKVRFGQTVVVFGAGPVGLLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINST 222

Query: 249 TDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
              K     +A  +E   GG   D  F+C+G    +   ++A   G G  + IG+   G+
Sbjct: 223 KLPKNDPQALADEVEKLLGGALADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GK 278

Query: 307 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLN----GTLKVQEFVTHKRPFEEI 362
                P   V+G+  + +  G  +      G  +D +N    G + V++ +TH+  FE+ 
Sbjct: 279 NYVNFPIAEVSGK--EMTLVGCFRYSY---GDYKDAVNLVSTGRVDVKKLITHRFSFEDA 333

Query: 363 NSG--FEDLHHGDCLRTVLS 380
                F   H G+ ++T+++
Sbjct: 334 AKAYDFNIAHGGEVVKTIIA 353

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 117/303 (38%), Gaps = 32/303 (10%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           +Q  P +  A V Y     L  + VTV  PK +E+ + +  S +CH+D +   G  P  L
Sbjct: 3   SQVIPEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 64  -FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
            FP I                   K GD   +      C  C++C  G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL---- 118

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
                 DGT    +G            TF EY                L  V  + C   
Sbjct: 119 ------DGTGFTHDG------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGI 160

Query: 182 TGYGAAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           T Y  A+K A+V  G  V + GA G +G   +Q A A    R+I +D  +AKR+   + G
Sbjct: 161 TVY-KALKRANVIPGQWVTISGACGGLGSLAIQYALAM-GYRVIGIDGGNAKRKLFEQLG 218

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
              FI    D  E + IV  +I+ T+GG     + + +   +  +   C    G  +++G
Sbjct: 219 GEIFI----DFTEEKDIVGAIIKATNGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 301 VAA 303
           + A
Sbjct: 274 MPA 276

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 101/264 (38%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P    A V Y  G PL+   + V  PK +E+ I +  S +CHTD +   G  P  +  P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                 N + GD+  +      C  C+ C  G  + C         G 
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNC---EQADLSGY 149

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+KTADV+ G  VA+ GA G +G   VQ AKA    R++ +D  D K++     G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           +    D  +  +IV  + ++T+GG
Sbjct: 249 V----DFTKTHSIVKDIQDVTNGG 268

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 100/202 (49%), Gaps = 21/202 (10%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A K ADV+ G  V VFGAG VGL     ++A  A+ ++ VD+ D K E  ++FGAT  +N
Sbjct: 161 ANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVN 220

Query: 247 PKTDLKEGETIVARLIEMTDGGLDH-TFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305
             +  K  + +V  +  +  G      F+C+G    +R  ++AC  G G+ + +G+    
Sbjct: 221 -SSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAG-GRYVQVGMGKDN 278

Query: 306 -----QEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
                 E+ ++  Q++ T R   G     +K  SE          G + V+  +TH+  F
Sbjct: 279 VNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITHRFKF 328

Query: 360 EEINSGFE-DLHHG-DCLRTVL 379
           ++    +E ++ HG D ++T++
Sbjct: 329 QDAIKAYEFNIEHGEDVVKTII 350

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 154/365 (42%), Gaps = 55/365 (15%)

Query: 33  PKAHEVRIKIVNSAICHTDA-YTLSGSDPEGLF--PCILXXXXXXXXXXXXXXXTNVKPG 89
           P  H V++ I  + IC +D  Y  SGS  + +   P +L                ++K G
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIKVG 86

Query: 90  DHV-----VP-LYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGT-SRFRNGKGETLY 142
           D V     VP  Y+ E +Q      G+ NLC  +       +  DGT  ++     + L 
Sbjct: 87  DRVAIEPGVPDRYSDETKQ------GRYNLCPDMAFAATPPI--DGTLVKYYVSPADFLV 138

Query: 143 HFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCL--LGCGVTTGYGAAVKTADVQEGDTVA 200
                 +F E                     C+  L  GV      A K A V  G  V 
Sbjct: 139 KLPDHVSFEE-------------------GACIEPLSVGVH-----ANKLAKVHFGSVVV 174

Query: 201 VFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK-EGETIVA 259
           VFGAG VGL     AKA  AS +I VD+ D K E A  FGAT  IN K+  + EG+ + A
Sbjct: 175 VFGAGPVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSA 234

Query: 260 RLIEMTDGGL-DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTG 318
            +     G L D  F+C+G    +   + +   G G  + IG+   G+     P   V+G
Sbjct: 235 AVSNYLGGALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSG 290

Query: 319 RVWKGSAFGGIK-GRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFED--LHHGDCL 375
           +  + S  G  +    +    VR    G ++V++ +T++  FE+  + ++    + G+ +
Sbjct: 291 K--EMSVIGCFRYSFGDYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNIANGGEVV 348

Query: 376 RTVLS 380
           +T+++
Sbjct: 349 KTIIA 353

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 113/303 (37%), Gaps = 49/303 (16%)

Query: 84  TNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDG 129
           T  K GDHV    T  C              ++C  C  G  N+C  +    G GV   G
Sbjct: 87  TQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GLIGNGVQSGG 145

Query: 130 TSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVK 189
                               F+E                P+E V L+     + +  AV+
Sbjct: 146 --------------------FAERVVINESHCYKLPNHIPMEVVALVQPIAVSWH--AVR 183

Query: 190 TADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKT 249
            +  + G +V + G G +GLS +        + I+V +    +R+ A K GA  + +P  
Sbjct: 184 VSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMGAVVY-DPMQ 242

Query: 250 DLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEIS 309
              E      R +     G D+ FDC+G    +R ++E C    G ++ + + A G+ I 
Sbjct: 243 HSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE-CLTFRGTAVNVAMWATGKPID 301

Query: 310 TRPFQLVTG-RVWKGSAFGGIKGRSEMGGLVRDYLNGTL---KVQEFVTHKRPFEEINSG 365
             P  +    + + GS         +  G++     GT+   K Q  +T K P E    G
Sbjct: 302 FFPMDITQQEKSYTGSM---CYTHHDFEGVIDALEKGTIDPEKAQHMITAKVPLER---G 355

Query: 366 FED 368
           FED
Sbjct: 356 FED 358

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 97/380 (25%), Positives = 151/380 (39%), Gaps = 48/380 (12%)

Query: 14  AVAYAAGEPLRIEKVTVDPPK-AHEVRIKIVNSAICHTDA-YTLSGSDPEGLF--PCILX 69
           AV     E ++IE   +   K  H+V+I+I  + IC +D  Y   GS  + +   P +L 
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFTQGSIGDFVVKSPLVLG 65

Query: 70  XXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCG--AVRATQGKGVMP 127
                         ++VK GD V        +  K  +SG  NLC   A  AT       
Sbjct: 66  HESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY---- 121

Query: 128 DGT-SRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGA 186
           DGT  ++     + +Y      +F E                PL           T +G 
Sbjct: 122 DGTLVKYYLSPEDFVYKLADHISFEE-----------GAVVEPLSVAVHANRLANTAFGQ 170

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AV            V GAG VGL     AKA  A+ ++ VDI ++K E A +FGAT  + 
Sbjct: 171 AV-----------LVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVL 219

Query: 247 PKTDLKEGETIVARLIEMTDGGL--DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
            K D  E + +   L+  + GGL  D  F+C+G  K +R A+++  +G G  + +G+   
Sbjct: 220 FKPDSDENDLV--SLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG-GTFVQVGMGKD 276

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKGRSE--MGGLVRDYLNGTLKVQEFVTHKRPFEEI 362
                   F        K + F G     E      V+    G + V+  +T   PFE+ 
Sbjct: 277 NINFPINEFS------QKEATFKGCFRYYEGDFDDAVKLLSTGKVNVKPLITKVFPFEQA 330

Query: 363 NSGFED--LHHGDCLRTVLS 380
              ++    H  D  +T+++
Sbjct: 331 VEAYKHNVEHAKDVTKTIIT 350

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 136/356 (38%), Gaps = 38/356 (10%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXXXXXXX 78
           G PL  +++ V  PKA+E+ I +  S +CHTD +   G  P  +  P +           
Sbjct: 18  GGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVA 77

Query: 79  XXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGK 137
                 N   GD+  +      C  C+ C     + C     +   G   DG        
Sbjct: 78  MGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQADLS---GYTHDG-------- 126

Query: 138 GETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGD 197
                      +F +Y                L  V  + C   T Y  A+K+A+++ GD
Sbjct: 127 -----------SFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGD 174

Query: 198 TVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGET 256
            VA+ GA G +G   +Q A A    R++ +D  + K E   K G   FI    D  + + 
Sbjct: 175 WVAISGACGGLGSLAIQYATAM-GYRVLGIDGGEEKAELFKKLGGEYFI----DFTKCKD 229

Query: 257 IVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
           ++A ++E+TDGG     + + +   +  +   C    G  +++G+ A     S    Q+V
Sbjct: 230 VIAEILEVTDGGAHGVINVSVSEAAIEASTRYCRAN-GTVVLVGLPANAYCKSEVFSQVV 288

Query: 317 TGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHHG 372
                 GS  G    R++    +  +  G +K      H  P  ++   F+ +  G
Sbjct: 289 KSISIVGSYVG---NRADTRQALDFFARGLVKSP---IHIAPLSDLPEIFDKMAKG 338

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 114/303 (37%), Gaps = 32/303 (10%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           +Q  P    A V Y     L  + VTV  PK +E+ + +  S +CH+D +   G  P  L
Sbjct: 3   SQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 64  -FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
            FP I                   K GD   +      C  C++C  G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
                 DGT    +G            TF EY                L  V  + C   
Sbjct: 119 ------DGTGFTHDG------------TFQEYATADAVQAAHIPQNVNLAEVAPILCAGI 160

Query: 182 TGYGAAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           T Y  A+K A++  G  V + GA G +G   +Q A A    R+I +D  +AKR+   K G
Sbjct: 161 TVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAM-GFRVIGIDGGEAKRKLFEKLG 218

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
              FI    D  +   +   +I+ T+GG     + + +   +  +   C    G  +++G
Sbjct: 219 GEIFI----DFTKERDVAGAVIKATNGGSHGIINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 301 VAA 303
           + A
Sbjct: 274 MPA 276

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 102/257 (39%), Gaps = 31/257 (12%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXX 73
           + Y  G  L  + + V  PKA+E+ I +  S +CHTD +   G  P  +  P +      
Sbjct: 38  IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 97

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                      N + GD+  +      C  C+ C  G  + C          +  D +  
Sbjct: 98  GIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC----------LQADLSGY 147

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
             +G            +F +Y                L  +  + C   T Y  A+KTAD
Sbjct: 148 THDG------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALKTAD 194

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ G  VA+ G AG +G   VQ AKA    R++ +D  D K E   + G   FI    D 
Sbjct: 195 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI----DF 249

Query: 252 KEGETIVARLIEMTDGG 268
           ++ + +VA + E T+GG
Sbjct: 250 RKSKDMVADIQEATNGG 266

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 85/362 (23%), Positives = 135/362 (37%), Gaps = 33/362 (9%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P      + Y    PL  + + V  PK++E+ I +  S +CHTD +   G  P  +  P 
Sbjct: 33  PKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPL 92

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                 N K GD   +      C  C+ C +G    C     +   G 
Sbjct: 93  VGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHADLS---GY 149

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 150 THDG-------------------SFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY- 189

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+KTAD++ GD VA+ G AG +G   VQ A A    R+I +D  + K++   K G   F
Sbjct: 190 KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVF 248

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           I    D  + + IV  + E T GG     + + + K +  +++      G  +++G+ A 
Sbjct: 249 I----DFTKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPAN 303

Query: 305 GQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
               S    Q+V     KGS  G     R  +    R  +   +KV       + +E + 
Sbjct: 304 AVVKSDVFNQVVKSIQIKGSYVGNRADTREALDFFTRGLVKSPIKVVGLSELPKVYELME 363

Query: 364 SG 365
           +G
Sbjct: 364 TG 365

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 134/366 (36%), Gaps = 33/366 (9%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           +Q  P    A V Y     L  + + V  PKA+E+ + +  S +CH+D +   G  P  L
Sbjct: 3   SQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQL 62

Query: 64  -FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
            FP I                   K GD   +      C  C++C  G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
                 DGT    +G            TF EY                L  V  + C   
Sbjct: 119 ------DGTGFTHDG------------TFQEYATADAVQAAHLPENVDLAEVAPILCAGV 160

Query: 182 TGYGAAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           T Y  A+K A++  G  V + GA G +G   +Q A A    R+I +D  + K++     G
Sbjct: 161 TVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAM-GYRVIGIDEGETKKQLFEGLG 218

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
              FI    D  + + IV  +I+ TDGG     + + +   +  +   C    G  +++G
Sbjct: 219 GEVFI----DFTKEKDIVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
           + A     S    Q+V      GS  G     R  +    R  +   +++         F
Sbjct: 274 MPAHAYCKSDVFNQVVKSISIVGSCVGNRADTREALDFFARHLVKSPIRLAGLSDVPEIF 333

Query: 360 EEINSG 365
           E++ +G
Sbjct: 334 EKMENG 339

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 105/270 (38%), Gaps = 31/270 (11%)

Query: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61
           S + G P+   A + Y  G+ L  + + V  PK +E+ + +  S +CHTD +   G  P 
Sbjct: 25  STSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPL 84

Query: 62  GL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRA 119
               P +                TN + GD+  V      C  C++C +G  + C     
Sbjct: 85  ATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEA-- 142

Query: 120 TQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCG 179
                   D +   R+G            +F +Y                L  V  + C 
Sbjct: 143 --------DLSGYTRDG------------SFQQYATADAVQAAKIPQGTDLAQVAPILCA 182

Query: 180 VTTGYGAAVKTADVQEGDTVAV-FGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASK 238
             T Y  A+KTA++  G  VA+    G +G   VQ AKA    R++ +D   AK     K
Sbjct: 183 GVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKK 240

Query: 239 FGATDFINPKTDLKEGETIVARLIEMTDGG 268
            G   FI    D  + + IVA + E T+GG
Sbjct: 241 LGGEVFI----DFTKSKDIVADIQEATNGG 266

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 83/363 (22%), Positives = 134/363 (36%), Gaps = 33/363 (9%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y  G  L+   + V  PK  E+ I +  S +CHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C++C     + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
            PD            L  +    +F +Y                L  V  + C   T Y 
Sbjct: 113 -PDA----------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A +Q G+ VA+ GA G +G   VQ AKA    RI+ +D  + K++   + G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAM-GYRILGIDSGEEKKKLFKELGGEYF 219

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           I    D  E + +VA +I++T+GG     + + +   +  + E C    G  +++G+ A 
Sbjct: 220 I----DFAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGLPAG 274

Query: 305 GQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
            Q  S     +V      GS  G     R  +    R  ++  +KV         +E++ 
Sbjct: 275 AQMRSEVFSHVVKSISVVGSYVGNRADSREAIDFFTRGLVSAPIKVVGLSQLAEVYEKME 334

Query: 364 SGF 366
            G 
Sbjct: 335 KGM 337

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 17/200 (8%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A + A ++ G    VFGAG VGL   + A    A+ ++ VD+++ K E A +FGAT  +N
Sbjct: 163 ANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN 222

Query: 247 PKTDLKEG---ETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303
              DL +G   ET++ + I     G D  F+C+G    +R  +E C  G G  + +G+  
Sbjct: 223 -SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-GTYVQVGM-- 276

Query: 304 AGQEISTRPFQLVTGR--VWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361
            GQE    P   +  +   ++GS F   +G  +    +    +G L ++  +T +  F+E
Sbjct: 277 -GQEEIQFPISKIPAKEITFQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKE 332

Query: 362 INSGFEDL--HHGDCLRTVL 379
               F++   H  D ++T++
Sbjct: 333 AIEAFDENRDHPLDNVKTII 352

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 90/188 (47%), Gaps = 11/188 (5%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A K A ++ G    VFGAG +GL   + A    A+ ++ VD+ + K E A +FGAT  +N
Sbjct: 163 ANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN 222

Query: 247 PKTDLKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
              DL  G T V  +I+   G  G D  F+C+G    +R  +E C  G G  + +G+   
Sbjct: 223 -SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVGM--- 276

Query: 305 GQEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
           GQE    P  ++ T  +     F   +G  +    +    +  L ++ F+TH+  F++  
Sbjct: 277 GQEEIQFPISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDAV 334

Query: 364 SGFEDLHH 371
             FE+  H
Sbjct: 335 EAFEETSH 342

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 98/264 (37%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P      + Y  G  L  + + V  PK +E+ I +  S +CHTD +   G  P  +  P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                TN + GD+  +      C  C+ C  G    C     +   G 
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHADLS---GY 161

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  +  + C   T Y 
Sbjct: 162 THDG-------------------SFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY- 201

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+KTADV+ G  VA+ G AG +G   VQ AKA    R++ +D  + K++     G   F
Sbjct: 202 KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETF 260

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           I    D +  + +V  + E T GG
Sbjct: 261 I----DFRTTKDMVGAIQEATQGG 280

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 85/365 (23%), Positives = 135/365 (36%), Gaps = 39/365 (10%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P      + Y  G  L  + + V  PKA+E+ + +  S +CHTD +   G  P  +  P 
Sbjct: 7   PKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C+ C  G  + C     +   G 
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNCPEADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  +  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY- 163

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A++Q GD VA+ G AG +G   VQ AKA    R++ +D  + K +   + G   F
Sbjct: 164 KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           I    D +  + I   +I+ T+GG         N  V   A+E+     +  G  +++G+
Sbjct: 223 I----DFRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGL 274

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
            A  +  S    Q+V      GS  G     R  +   VR  +   +KV    T    FE
Sbjct: 275 PAGAKCKSDVFNQVVKSISIVGSYVGNRADTREALDFFVRGLVRSPIKVVGLSTLPEIFE 334

Query: 361 EINSG 365
           ++  G
Sbjct: 335 KMEKG 339

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/350 (21%), Positives = 133/350 (38%), Gaps = 33/350 (9%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXX 78
           G  L  + + V  PK++E+ I +  S +CHTD +   G  P     P +           
Sbjct: 19  GGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 78

Query: 79  XXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGK 137
                   K GD+  +      C  C++C  G  + C     +   G   DG        
Sbjct: 79  MGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHADLS---GYTHDG-------- 127

Query: 138 GETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGD 197
                      +F +Y                L  V  + C   T Y  A+K+A+++ G+
Sbjct: 128 -----------SFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKSANLRAGE 175

Query: 198 TVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGET 256
            VA+ GA G +G   +Q AKA    R++ +D  D K +     G   FI    D  + + 
Sbjct: 176 WVAISGACGGLGSLAIQFAKAM-GYRVVGIDGGDEKAKMFKDLGGEVFI----DFTKTKD 230

Query: 257 IVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
           IV  +I+ T+GG     + + + + +  +++ C    G ++++G+    Q  S    Q+V
Sbjct: 231 IVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGMPGGAQVKSDVFNQVV 289

Query: 317 TGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
                 GS  G     R  +    R  +   + + +       FE++  G
Sbjct: 290 KSISIVGSYVGNRADTREALDFFSRGLVKSPIHIAKLSDVPEIFEKMEKG 339

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 134/358 (37%), Gaps = 39/358 (10%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXX 73
           + Y +   L  + + V  PKA+E+ I +  S +CHTD +   G  P  +  P +      
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD+  +      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           +  G  VA+ G AG +G   VQ AKA    R++ +D  + K E     G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAAAGQEI 308
            + + IV  +++ TDGG         N  V   A+EA     +  G ++++G+ A  +  
Sbjct: 223 TKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPAGAKCC 278

Query: 309 STRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           S    Q+V      GS  G     R  +    R  +   +KV    T    +E++  G
Sbjct: 279 SDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKG 336

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 97/264 (36%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P      + Y  G  L+ + + V  PK +E+ I +  S +CHTD +   G  P  +  P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                TN + GD   +      C  C+ C  G    C     +   G 
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHADLS---GY 159

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 160 THDG-------------------SFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+KTAD+  G  VA+ G AG +G   VQ AKA    R++ +D  D K+E   K G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           I    D    + +V  + E T GG
Sbjct: 259 I----DYTTTKDMVGAIQEATQGG 278

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 94/201 (46%), Gaps = 21/201 (10%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPK 248
           K A V+ G  V VFGAG VGL     A+A  A+ +I VD+ D K + A  FGAT+  N  
Sbjct: 164 KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSS 223

Query: 249 TDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
               +    +A  ++   GG   D  F+C+G   V  DA     K  G  + +G+   G+
Sbjct: 224 QFSTDKAQDLADGVQKLLGGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GK 279

Query: 307 EISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLN----GTLKVQEFVTHKRPFE 360
             +  P   V+G+  K      + G  R   G   RD +N    G + V+  +THK  FE
Sbjct: 280 NYTNFPIAEVSGKEMK------LIGCFRYSFGDY-RDAVNLVATGKVNVKPLITHKFKFE 332

Query: 361 EINSGFED--LHHGDCLRTVL 379
           +    ++    H G+ ++T++
Sbjct: 333 DAAKAYDYNIAHGGEVVKTII 353

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 81/333 (24%), Positives = 121/333 (36%), Gaps = 35/333 (10%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y  G PL  + + V  PK +E+ I +  S +CHTD +   G  P
Sbjct: 23  LQSTIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWP 82

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
             +  P +                 N + GD   +      C  C+ C  G  + C    
Sbjct: 83  LPVKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNC---E 139

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
                G   DG                   +F +Y                L  V  + C
Sbjct: 140 HADLSGYTHDG-------------------SFQQYATADATQAAQIPRGTDLAEVAPILC 180

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+KTA +Q G+ VA+ GA G +G   +Q AKA    R++ +D  +AK +   
Sbjct: 181 AGVTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFK 238

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWG 294
           + G   FI+  T  K  E ++  + E T GG         N  V   A+ A     +  G
Sbjct: 239 ELGGETFID-FTKYKNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTG 293

Query: 295 QSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFG 327
             +I+G+ A     S     +V     KGS  G
Sbjct: 294 TVVIVGMPAGAYVKSDVFSHVVKSISIKGSYVG 326

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 94/201 (46%), Gaps = 21/201 (10%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPK 248
           K A V+ G  V VFGAG VGL     A+A  A+ +I VD+ D K + A  FGAT+  N  
Sbjct: 164 KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSS 223

Query: 249 TDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
               +    +A  ++   GG   D  F+C+G   V  DA     K  G  + +G+   G+
Sbjct: 224 QFSTDKAQDLADGVQKLLGGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GK 279

Query: 307 EISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLN----GTLKVQEFVTHKRPFE 360
             +  P   V+G+  K      + G  R   G   RD +N    G + V+  +THK  FE
Sbjct: 280 NYTNFPIAEVSGKEMK------LIGCFRYSFGDY-RDAVNLVATGKVNVKPLITHKFKFE 332

Query: 361 EINSGFED--LHHGDCLRTVL 379
           +    ++    H G+ ++T++
Sbjct: 333 DAAKAYDYNIAHGGEVVKTII 353

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 94/202 (46%), Gaps = 21/202 (10%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPK 248
           K A V+    V VFGAG VGL     A+A  AS ++ VD+ D K + A  FGAT+  N  
Sbjct: 164 KLAGVRFSTRVVVFGAGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSS 223

Query: 249 TDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
               +    +A  +E   GG   D  F+C+G   V  DA     K  G  + +G+   G+
Sbjct: 224 KIPTDKAQELASEVEKLLGGNHADVVFECSG-ADVCIDAGVKVTKVGGTMVQVGM---GK 279

Query: 307 EISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLN----GTLKVQEFVTHKRPFE 360
             +  P   V+G+  K      + G  R   G   RD +N    G + V+  +TH+  FE
Sbjct: 280 NYTNFPIAEVSGKEMK------LIGCFRYSFGDY-RDAVNLVATGKVNVKPLITHRFKFE 332

Query: 361 EINSGFED--LHHGDCLRTVLS 380
           +    ++    H GD ++T+++
Sbjct: 333 DAAKAYDYNISHGGDVVKTIIA 354

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 96/264 (36%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A V Y  G PL  + + V  PKA+E+ I +  S +CHTD +   G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C+ C +G  + C     +   G 
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHADLS---GY 153

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 154 THDG-------------------SFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K AD++ G  V + G AG +G   VQ AKA    R+I +D   AK E     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAM-GYRVIGIDGGKAKEELFKSMGGEVF 252

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           I    D  + + +V  + E T GG
Sbjct: 253 I----DFTKSKDMVKDIQEATKGG 272

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 95/264 (35%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P      + Y  G PL  + + V  PKA+E+ I +  S +CHTD +   G  P     P 
Sbjct: 29  PKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 88

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C+ C SG  + C     +   G 
Sbjct: 89  VGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHADLS---GY 145

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                +  V  + C   T Y 
Sbjct: 146 THDG-------------------SFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY- 185

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K AD++ G  V + G AG +G   VQ AKA    R+I +D    K E     G   F
Sbjct: 186 KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAM-GYRVIGIDGGPGKEELFKSLGGEIF 244

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           +    D  + + IVA + E T GG
Sbjct: 245 V----DFTKTKDIVAEIQEATRGG 264

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 114/303 (37%), Gaps = 32/303 (10%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63
           +Q  P    A V Y     L  + V V  PK +E+ + +  S +CH+D +   G  P  L
Sbjct: 3   SQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 64  -FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
            FP I                   K GD   +      C  C++C  G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
                 DGT    +G            TF EY                L  V  + C   
Sbjct: 119 ------DGTGFTHDG------------TFQEYATADAVQAAHIPQNVDLAEVAPILCAGI 160

Query: 182 TGYGAAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           T Y  A+K A++  G  V + GA G +G   VQ A A    R+I +D  +AK++   +  
Sbjct: 161 TVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAM-GYRVIGIDGGEAKQKLFEELH 218

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
              FI    D  + + +V  +I+ TDGG     + + +   +  +   C    G  +++G
Sbjct: 219 GEIFI----DFTKEKDVVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 301 VAA 303
           + A
Sbjct: 274 MPA 276

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 113/297 (38%), Gaps = 32/297 (10%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y  G PL+   + V  PKA E+ I +  S +CHTD +   G  P     P 
Sbjct: 7   PRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C++C     + C     +   G 
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNCPEADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 163

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A+++ GD VA+ GA G +G   +Q A A    R++ +D  + K +   + G   F
Sbjct: 164 KALKSANLRAGDWVAISGACGGLGSLAIQYATAM-GYRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           I    D ++ + IVA +++ T+GG     + + +   +  + E      G  +++G+
Sbjct: 223 I----DFRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGL 274

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 100/264 (37%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y  G PL  + V V  PK +E+ I I  S +CHTD +   G  P +   P 
Sbjct: 7   PQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           I                   K GD+  V      C  C+ C     + C     +   G 
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F EY                L  V  L C   T Y 
Sbjct: 124 THDG-------------------SFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY- 163

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+AD+  G  VA+ GA G +G   +Q AKA    R++ +D  + K++   + G   F
Sbjct: 164 KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           +    D +  + + A +I+ T+GG
Sbjct: 223 L----DFRLEKDMEAAIIKATNGG 242

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 128/350 (36%), Gaps = 80/350 (22%)

Query: 30  VDPPKA---HEVRIKIVNSAICHTD----------------AYTLSGSDPEGLFPCILXX 70
           +D PK    HE+ I +    IC TD                 + LSG D     P  +  
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 71  XXXXXXXXXXXXXTNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGA 116
                        T  KPGD VV   T  C              + C  C  G  N C  
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 117 VRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLL 176
             + QG G +  G                    F+E                PL+   L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 177 GCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWA 236
              ++  + AA + A+ +EG    V G+G +GL+++   K   A +I+V +    +RE A
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 237 SKFGATDFINPKTDLKEGETIVARLIEMT--DGGLDHTFDCTGNTKVMRDALE-ACHKGW 293
            K     F NP       +  + +L E++  D G D+TFDC+G       A++ AC +G 
Sbjct: 231 EKLNVVVF-NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH 287

Query: 294 GQSIIIGVAAAG-QEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDY 342
               I+ VA  G + ++  P  +          +G  K    MG + RD+
Sbjct: 288 ----IVNVAIWGPKPVAFHPMDM---------TYGEKKLTGTMGYVTRDF 324

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 116/306 (37%), Gaps = 32/306 (10%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +S T   P      + Y +G  L  + + V  P+ +E+ + +  S +CHTD +   G  P
Sbjct: 19  LSSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWP 78

Query: 61  -EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
            +   P +                 N + GD   +      CQ C+ C  G  + C    
Sbjct: 79  LDTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHAD 138

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
            +   G   DG                   TF +Y                L  V  + C
Sbjct: 139 LS---GYTHDG-------------------TFQQYATADAIQAAHIPKGTDLAGVAPILC 176

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A++++  + G+ VA+ G AG +G    Q A+A    R++ +D  + K +   
Sbjct: 177 AGVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFK 234

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSI 297
             G   FI    D  + + I A ++E T GG     + + + K M  ++E   +  G  +
Sbjct: 235 SLGGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVV 289

Query: 298 IIGVAA 303
           ++G+ A
Sbjct: 290 LVGLPA 295

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 77/356 (21%), Positives = 137/356 (38%), Gaps = 35/356 (9%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y +   L  + + V  PK +E+ I +  S +CHTD +   G  P     P +      
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD   V    + C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ G+ VA+ G AG +G   VQ AKA    R++ +D    K+E  +  G   FI    D 
Sbjct: 168 LRAGNWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGPGKQELFTSLGGEVFI----DF 222

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
            + + I+  +++ TDGG     + + +   +  + + C    G  +++G+  AG + S+ 
Sbjct: 223 TKEKDIIGAVVKATDGGAHGIINVSVSEAAIEASTKYCRAN-GTVVLVGL-PAGAKCSSD 280

Query: 312 PFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
            F  V   +    ++ G +   R  +    R  +   +KV    +    +E++  G
Sbjct: 281 VFNHVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSSLPEIYEKMEKG 336

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 97/264 (36%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P      + Y +G  L  + + V  PK +E+ I +  S +CHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                 N + GD   +      C  C+ C  G  + C          +
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------L 142

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             D +    +G            +F +Y                L  V  + C   T Y 
Sbjct: 143 HADLSGYTHDG------------SFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+KTAD++ G  VA+ G AG +G   VQ AKA    RI+ +D    K E     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           I    D  + + IV+ + E T GG
Sbjct: 249 I----DFTKTKDIVSAIQEATKGG 268

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 76/362 (20%), Positives = 136/362 (37%), Gaps = 33/362 (9%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A +  + G PL  + + V  PK++E+ + I  S +CHTD +   G  P +   P 
Sbjct: 7   PKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD+  V      C  C++C  G  + C     +   G 
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY- 163

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A+++ G+ VA+ GA G +G   +Q A A    R++ +D  D K +   +     F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLCIQYANAM-GYRVLGIDGGDDKAKLFKQLHGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           I    D  + + +++ + ++T+GG     + + +   +  + + C    G  +++G+   
Sbjct: 223 I----DFTKTKDVISEVNKVTNGGAHGVINVSVSEAAIEASTKYCRAN-GTVVLVGLPGG 277

Query: 305 GQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
            +  S    Q+V      GS  G     R  +    R  +   + V    T    FE++ 
Sbjct: 278 AKCKSDVFNQVVKSMTIVGSYVGNRADTREALDFFTRGLVKAPIHVAPLSTLPTIFEKME 337

Query: 364 SG 365
            G
Sbjct: 338 KG 339

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 87/365 (23%), Positives = 135/365 (36%), Gaps = 39/365 (10%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y +G  L  + V V  PK +E+ I I  S +CHTD +   G  P +   P 
Sbjct: 7   PKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           I                   K GD+  V      C  C+ C     + C     +   G 
Sbjct: 67  IGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNCPEADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F EY                L  V  + C   T Y 
Sbjct: 124 THDG-------------------SFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY- 163

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+AD+  G+ VA+ GA G +G   VQ AKA    R++ +D  + K++   + G   F
Sbjct: 164 KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           +    D +  + + A +I+ T+GG         N  V   A+EA     +  G  +++G+
Sbjct: 223 L----DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGL 274

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFE 360
            A     S    Q+V      GS  G     R  +   VR  +   + +    T    +E
Sbjct: 275 PANAYCKSEVFSQVVKSYKIVGSYVGNRADTREALDFFVRGLVKSPIHIVGLSTLPEIYE 334

Query: 361 EINSG 365
           ++  G
Sbjct: 335 KMEKG 339

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 94/203 (46%), Gaps = 23/203 (11%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN-- 246
           K A V+ G  V VFGAG VGL     A+A  AS ++ +D+ D K + A +FGAT   N  
Sbjct: 164 KLAGVRFGSRVVVFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSS 223

Query: 247 --PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
             P    +E    V +L  ++    D  F+C+G    + DA     K  G  + IG+   
Sbjct: 224 KFPADKTQELADEVEKL--LSGHHADIVFECSGADACI-DAGVKITKVGGTMVQIGM--- 277

Query: 305 GQEISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
           G+  +  P   V+G+  K       +FG  +        V+   +G + V+  +TH+  F
Sbjct: 278 GKNYTNFPIAEVSGKEMKLIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFKF 331

Query: 360 EEINSG--FEDLHHGDCLRTVLS 380
           E+      F   H G+ ++T+++
Sbjct: 332 EDAAKAYDFNIAHGGEVVKTIIA 354

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 79/355 (22%), Positives = 131/355 (36%), Gaps = 33/355 (9%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXX 73
           + Y +   L  + + V  PKA+E+ I +  S +CHTD +   G  P  +  P +      
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                          GD   +      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L     + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           +  G  VA+ G AG +G   VQ AKA    R++ +D  + K E     G   FI+  T+ 
Sbjct: 168 LSAGQWVAISGAAGGLGSLAVQYAKAM-GYRVVGIDGGEGKEELFRSIGGEVFIDFTTE- 225

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
              + IV  +I+ TDGG     + + +   +  +   C    G ++++G+ A  +  S  
Sbjct: 226 ---KDIVGAVIKATDGGAHGIINVSVSEAAIEASTRYCRAN-GTTVLVGMPAGAKCCSDV 281

Query: 312 PFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
             Q+V      GS  G     R  +    R  +   +KV    T    +E++  G
Sbjct: 282 FNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKG 336

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 126/351 (35%), Gaps = 39/351 (11%)

Query: 22  PLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXXXX 80
           PL  +++ V  PK +E+ I +  S +CHTD +   G  P     P +             
Sbjct: 49  PLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEVIALG 108

Query: 81  XXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGE 139
               N K GD   +      C  C+ C     + C            PD           
Sbjct: 109 SNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC------------PDA---------- 146

Query: 140 TLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTV 199
            L  +    +F +Y                L  V  + C   T Y  A+K+A+++ G  V
Sbjct: 147 DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY-KALKSANLKAGQWV 205

Query: 200 AVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIV 258
           A+ G AG +G   VQ AKA    R++ +D    K E     G   FI    D ++   IV
Sbjct: 206 AISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVFI----DFQKESDIV 260

Query: 259 ARLIEMTDGGLDHTFDCTGNTKVMRDALEACHK---GWGQSIIIGVAAAGQEISTRPFQL 315
             ++  T+GG         N  V   A+ A  K     G S+++G+ A     S    Q+
Sbjct: 261 GAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGMPAGAVCKSEVFDQV 316

Query: 316 VTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           V      GS  G     R  +    R  ++  + V    T    FE++  G
Sbjct: 317 VRSTKIVGSYVGNRADTREALDFFARGLVHAPINVVPLSTLPEIFEKMEKG 367

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 56/104 (53%), Gaps = 6/104 (5%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AV+ +  ++G +  + GAG +GL+ +   KA  AS+I+V ++ + +R  ASK G   F +
Sbjct: 184 AVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSELAERRRILASKMGVEVF-D 242

Query: 247 PKTDLKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALEA 288
           P    K G+  V  L  +  G  G D+ FDC+G       AL+A
Sbjct: 243 PS---KHGDNAVTELRNIPRGQHGFDYAFDCSGVKATFNTALKA 283

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 97/203 (47%), Gaps = 23/203 (11%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGAT-DFINP 247
           K A V+ G  V VFGAG VGL     A A  AS +I VD+ D + + A  FGA+  F + 
Sbjct: 164 KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSS 223

Query: 248 KTDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305
           K  + E + + A  +E   GG   D  F+C+G   V  DA     K  G  + +G+   G
Sbjct: 224 KFSVDEAQQL-ADEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---G 278

Query: 306 QEISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLN----GTLKVQEFVTHKRPF 359
           +  +  P   V+G+  +      + G  R   G   RD +N    G + V+  +TH+  F
Sbjct: 279 KNYTNFPIAEVSGKEMR------LIGCFRYSFGDY-RDAVNLVASGKVNVKPLITHRFKF 331

Query: 360 EEINSGFED--LHHGDCLRTVLS 380
           E+    ++    H GD ++T+++
Sbjct: 332 EDAAKAYDYNIAHGGDVVKTIIA 354

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 97/203 (47%), Gaps = 23/203 (11%)

Query: 189 KTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGAT-DFINP 247
           K A V+ G  V VFGAG VGL     A A  AS +I VD+ D + + A  FGA+  F + 
Sbjct: 164 KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSS 223

Query: 248 KTDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAG 305
           K  + E + + A  +E   GG   D  F+C+G   V  DA     K  G  + +G+   G
Sbjct: 224 KFSVDEAQQL-ADEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---G 278

Query: 306 QEISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLN----GTLKVQEFVTHKRPF 359
           +  +  P   V+G+  +      + G  R   G   RD +N    G + V+  +TH+  F
Sbjct: 279 KNYTNFPIAEVSGKEMR------LIGCFRYSFGDY-RDAVNLVASGKVNVKPLITHRFKF 331

Query: 360 EEINSGFED--LHHGDCLRTVLS 380
           E+    ++    H GD ++T+++
Sbjct: 332 EDAAKAYDYNIAHGGDVVKTIIA 354

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AVK A V+ GD V VFGAG VGL V    KA  A+ ++ +D+ D K + + + G+T  IN
Sbjct: 162 AVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN 221

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKG 292
            K D+ E    +    ++     +   DCTG    +R ++ AC  G
Sbjct: 222 SK-DMAEEALALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG 266

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 99/271 (36%), Gaps = 31/271 (11%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y     L  + + V  PK +E+ I +  S +CHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
             +  P +                   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
                   PD            L  +    +F ++                L  V  + C
Sbjct: 140 --------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K AD++ GD VA+ G AG +G   VQ A A    R++ +D  + K +   
Sbjct: 182 AGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVLGIDAGEEKEKLFK 239

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGG 268
           K G   FI    D  + + +V+ + E T GG
Sbjct: 240 KLGGEVFI----DFTKTKNMVSDIQEATKGG 266

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 107/284 (37%), Gaps = 35/284 (12%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y  G  L+ + + V  PK++E+ I I  S +CHTD +   G  P     P 
Sbjct: 7   PETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD+  +      C  C++C     + C           
Sbjct: 67  VGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
            PD            L  +    +F +Y                L  V  + C   T Y 
Sbjct: 116 -PDA----------DLSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY- 163

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A+++ G+ VA+ GA G +G   +Q AKA    R++ +D  D K     + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAM-GYRVLGIDGGDEKAALFKELGGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEA 288
           I    D  + + +V  +++ T+GG         N  V   A+EA
Sbjct: 223 I----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 104/277 (37%), Gaps = 35/277 (12%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXX 73
           + Y  G  L  + + V  PKA+E+ I +  S +CHTD +   G  P  +  P +      
Sbjct: 14  IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPLVGGHEGA 73

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD+  +      C  C++C     + C     +   G   DG   
Sbjct: 74  GVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNCPEADLS---GYTHDG--- 127

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 128 ----------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSAN 170

Query: 193 VQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           +  G+ VA+ GA G +G   +Q AKA    RI+ +D  D K     + G   FI    D 
Sbjct: 171 LSAGEWVAISGACGGLGSLAIQYAKAM-GYRILGIDGGDEKAALFKELGGEVFI----DF 225

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEA 288
            + + I A +IE T+GG         N  V   A+E+
Sbjct: 226 TKTKDIEAAVIEATNGGAHGVI----NVSVSEAAIES 258

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/363 (21%), Positives = 136/363 (37%), Gaps = 35/363 (9%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y +   L  + + V  PK +E+ I +  S +CHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD+  +      C  C++C  G  + C     +   G 
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GY 120

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F EY                L  V  + C   T Y 
Sbjct: 121 THDG-------------------SFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A+++ G   A+ G AG +G   VQ AKA    R++ +D    K E  +  G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGPGKEELFTSLGGEVF 219

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           I    D  + + IV+ +++ T+GG     + + +   +  +   C    G  +++G+  A
Sbjct: 220 I----DFTKEKDIVSAVVKATNGGAHGIINVSVSEAAIEASTRYCRAN-GTVVLVGL-PA 273

Query: 305 GQEISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLNGTLKVQEFVTHKRPFEEI 362
           G + S+  F  V   +    ++ G +   R  +    R  +   +KV    +    +E++
Sbjct: 274 GAKCSSDVFNHVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSSLPEIYEKM 333

Query: 363 NSG 365
             G
Sbjct: 334 EKG 336

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 132/358 (36%), Gaps = 39/358 (10%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y +   L  + + V  PKA+E+ I +  S +CHTD +   G  P     P +      
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                          GD+  +      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           +  G  VA+ G AG +G   VQ AKA    R++ +D  + K E     G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAAAGQEI 308
            + + IV  +++ TDGG         N  V   A+EA     +  G ++++G+ A  +  
Sbjct: 223 TKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPANAKCS 278

Query: 309 STRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           S    Q+V      GS  G     R  +    R  +   +KV    T    +E++  G
Sbjct: 279 SDVFNQVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKG 336

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/362 (21%), Positives = 133/362 (36%), Gaps = 33/362 (9%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P      + Y  G  L  + + V  PK +E+ I I  S +CHTD +   G  P  +  P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                TN + GD   V    + C  C++C  G  + C     +   G 
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKADLS---GY 145

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 146 THDG-------------------SFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+KT+  + G  VA+ G AG +G   VQ A A    R++ +D  + K E     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           +    D  + + +V+ + E T+GG     + + +   ++ + E   +  G  +++G+ A 
Sbjct: 245 V----DFTKTKDMVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAH 299

Query: 305 GQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363
               S     +V     KGS  G     R  +    R+ +   +K+       + +E + 
Sbjct: 300 AYVKSEIFSHVVKSISIKGSYVGNRADTREAIDFFSRNLVKSPIKIIGLSELPKVYELME 359

Query: 364 SG 365
            G
Sbjct: 360 EG 361

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/355 (21%), Positives = 132/355 (37%), Gaps = 33/355 (9%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y +   L  + + V  PK +E+ I +  S +CHTD +   G  P     P +      
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD   +    + C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ G  VA+ G AG +G   VQ AKA    R++ +D  + K E  +  G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGEGKEELFTSLGGEVFI----DF 222

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
            + + IV+ +++ TDGG     + + +   +  +   C    G  +++G+ A  +  S  
Sbjct: 223 TKEKDIVSAVVKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAGAKCCSDV 281

Query: 312 PFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
              +V      GS  G     R  +    R  +   +KV    T    +E++  G
Sbjct: 282 FNHVVKSISIVGSYVGNRADTREALDFFARGLVKSPIKVVGLSTLPEIYEKMEKG 336

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 120/317 (37%), Gaps = 34/317 (10%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y  G  L  + + V  PK +E+ I +  S +CHTD +   G  P     P +      
Sbjct: 37  IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 96

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                          GD   +      C  C++C     + C            PD    
Sbjct: 97  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 141

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                   L  +    +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 142 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSAN 193

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ GD VA+ G AG +G   VQ AKA    R++ +D  + K +   + G   F+    D 
Sbjct: 194 LKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVVGIDGGEEKGKLVKQLGGEAFV----DF 248

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
            + + +VA + E+T+GG     + + +   M  + +      G  +++G+  AG  I + 
Sbjct: 249 TKTKDMVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPT-GTVVLVGL-PAGAVIKSE 306

Query: 312 PFQLVTGRV-WKGSAFG 327
            F  V   +  KGS  G
Sbjct: 307 VFSHVVKSINIKGSYVG 323

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 99/271 (36%), Gaps = 31/271 (11%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y     L  + + V  PK +E+ I +  S +CHTD +   G  P
Sbjct: 24  LQSTAAIPETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
             +  P +                   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
                   PD            L  +    +F ++                L  V  + C
Sbjct: 140 --------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K AD++ GD VA+ G AG +G   VQ A A    R++ +D  + K +   
Sbjct: 182 AGVTVY-KALKEADLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVLGIDAGEEKEKLFK 239

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGG 268
           K G   FI    D  + + +V+ + E T GG
Sbjct: 240 KLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 122/328 (37%), Gaps = 34/328 (10%)

Query: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EG 62
           T   P +    + Y  G  L+ E + V  PK +E+ I +  S +CHTD +   G  P   
Sbjct: 25  TASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPT 84

Query: 63  LFPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQ 121
             P +                   K GD   +      C  C++C     + C     + 
Sbjct: 85  KLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHADLS- 143

Query: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVT 181
             G   DG                   +F +Y                L  V  + C   
Sbjct: 144 --GYTHDG-------------------SFQQYATADYVQAARIPEGTDLAEVSPILCAGV 182

Query: 182 TGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFG 240
           T Y  A+K+A+++ GD VA+ G AG +G   VQ AKA    R++ +D    K E   K G
Sbjct: 183 TVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGAEKGELVKKLG 240

Query: 241 ATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIG 300
              FI    D  + + +V  + E T+GG     + + +   M  + +      G  +++G
Sbjct: 241 GEVFI----DFTKHKNLVEAVQEATNGGPHGVINVSVSEAAMTASTQFVRPT-GTVVLVG 295

Query: 301 VAAAGQEISTRPFQLVTGRV-WKGSAFG 327
           +  AG  I +  F  V   +  KGS  G
Sbjct: 296 L-PAGAVIKSEVFSHVVKSINIKGSYVG 322

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 80/358 (22%), Positives = 132/358 (36%), Gaps = 39/358 (10%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXX 73
           + Y    PL  + + V  P  +E+ I ++ S +CHTD +   G  P  +  P +      
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD+  +      C  C+ C     + C     +   G   DG   
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNCPEADLS---GYTHDG--- 126

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L+ +  + C   T Y  A+K+A+
Sbjct: 127 ----------------SFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSAN 169

Query: 193 VQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ GD +A+ GA G +G   +Q  KA    RI+ +D    K E   K G   FI    D 
Sbjct: 170 LKAGDWLAISGACGGLGSLAIQYGKAM-GFRILGIDGGAEKEELFKKLGGEYFI----DF 224

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAAAGQEI 308
            + + I+A + + T+GG         N  V   A+EA     +  G  +++G+ A     
Sbjct: 225 TQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTVVLVGLPAGAVCK 280

Query: 309 STRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           S    Q+V      GS  G     R  +   VR  +   +KV         F+++ +G
Sbjct: 281 SNVFNQVVKSTKIVGSYVGNRADTREAIDFFVRGLVKSPIKVVGLSQLASVFDDMQAG 338

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 96/257 (37%), Gaps = 31/257 (12%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y  G  L+ + + V  PKA+E+ I +  S +CHTD +   G  P     P +      
Sbjct: 13  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 72

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD   +      C  C++C     + C     +   G   DG   
Sbjct: 73  GVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNCPEADLS---GYTHDG--- 126

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 127 ----------------SFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALKSAN 169

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ GD VA+ G AG +G   VQ AKA    R++ +D  + K +     G   FI    D 
Sbjct: 170 LKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDAGEEKAKLFKDLGGEYFI----DF 224

Query: 252 KEGETIVARLIEMTDGG 268
            + + I   +IE T GG
Sbjct: 225 TKSKNIPEEVIEATKGG 241

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 99/264 (37%), Gaps = 31/264 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P    A V    G  L  + + V  P A+E+ I +  S +CHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C+ C     + C     +   G 
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHADLS---GY 120

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG+                   F +Y                L  V  + C   T Y 
Sbjct: 121 THDGS-------------------FQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A+++ G+ VA+ GA G +G   VQ AKA    R+I +D  D K +   K G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAM-GYRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 245 INPKTDLKEGETIVARLIEMTDGG 268
           +    D ++ + +VA ++E+T GG
Sbjct: 220 V----DFRKSKDVVAEILEVTGGG 239

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 123/306 (40%), Gaps = 51/306 (16%)

Query: 84  TNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDG 129
           T VK GDHVV    + C              + C  C  G  NLC       G GV+  G
Sbjct: 87  TKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG 145

Query: 130 TSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVK 189
                               F+E                PL+   L+     T +  AVK
Sbjct: 146 --------------------FAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVK 183

Query: 190 TADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKT 249
            +  ++G +  V GAG +GL  +   K   AS+I+V +I + + E A K G   F NP  
Sbjct: 184 ISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSK 242

Query: 250 DLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEAC-HKGWGQSIIIGVAAAGQEI 308
              +   I+  L +  D G D+++DC+G       +L+A   KG   +I +      + +
Sbjct: 243 HGHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKALTFKGTATNIAVW---GPKPV 298

Query: 309 STRPFQL-VTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQ---EFVTHKRPFEE-IN 363
             +P  + +  +V  GS    ++   E   +VR   NG + ++   + +T K+  E+   
Sbjct: 299 PFQPMDVTLQEKVMTGSIGYVVEDFEE---VVRAIHNGDIAMEDCKQLITGKQRIEDGWE 355

Query: 364 SGFEDL 369
            GF++L
Sbjct: 356 KGFQEL 361

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 111/295 (37%), Gaps = 32/295 (10%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXX 73
           + Y +   L  + + V  PK +E+ I +  S +CHTD +   G  P     P +      
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD   +    + C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ G  VA+ G AG +G   VQ AKA    R++ +D    K E  +  G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAM-GYRVVGIDGGPGKEELFTSLGGEVFI----DF 222

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
            + + IV  +I+ TDGG     + + +   +  +   C    G  +++G+ A  +
Sbjct: 223 TKEKDIVGAVIKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAGAK 276

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 53/104 (50%), Gaps = 6/104 (5%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AVK ++++ G +  V GAG +GL+ +   +   A +I+V +    +RE A+K G   F N
Sbjct: 182 AVKISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF-N 240

Query: 247 PKTDLKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALEA 288
           P    + GE  V  L ++  G  G D +FDC+G        L A
Sbjct: 241 P---FEHGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 82/352 (23%), Positives = 124/352 (35%), Gaps = 39/352 (11%)

Query: 22  PLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXXXX 80
           PL  + + V  PK +E+ I +  S +CHTD +   G  P     P +             
Sbjct: 18  PLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGEVVALG 77

Query: 81  XXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGE 139
               N K GD   +      C  C+ C     + C            PD           
Sbjct: 78  SDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA---------- 115

Query: 140 TLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTV 199
            L  +    +F +Y                L  V  + C   T Y  A+K+A+++ G  V
Sbjct: 116 DLSGYTHDGSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKSANLKAGQWV 174

Query: 200 AVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIV 258
           A+ G AG +G   VQ A+A    R++ +D    K E     G   FI    D  +   I 
Sbjct: 175 AISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI----DFTKEHDIA 229

Query: 259 ARLIEMTDGGLDHTFDCTGNTKVMRDALEACHK---GWGQSIIIGVAAAGQEISTRPFQL 315
             +I+ T+GG         N  V   A+ A  K     G S+++G+ A     S    Q+
Sbjct: 230 EAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGMPAGAICKSEVFDQV 285

Query: 316 VTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGF 366
           V      GS  G     R  +    R  +   +K+    T    FE++  G 
Sbjct: 286 VRSTKIVGSYVGNRADTREALDFFARGLVKAPIKIVGLSTLPEIFEKMEKGL 337

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 82/358 (22%), Positives = 131/358 (36%), Gaps = 39/358 (10%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y +   L  + + V  PKA+E+ I +  S +CHTD +   G  P     P +      
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                          GD   +      C  C++C  G  + C     +   G   DG   
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG--- 124

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                L  V  + C   T Y  A+K+A+
Sbjct: 125 ----------------SFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           +  G  VA+ G AG +G   VQ AKA    R+I +D  + K E     G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAM-GYRVIGIDGGEGKEELFRSIGGEVFV----DF 222

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGVAAAGQEI 308
            + + IV  +++ T+GG         N  V   A+EA     +  G ++++G+ A  +  
Sbjct: 223 TKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGMPANAKCC 278

Query: 309 STRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           S    Q+V      GS  G     R  +    R  +   +KV    T    +E++  G
Sbjct: 279 SDVFNQVVKSISIVGSYVGNRADTREALDFFSRGLVKSPIKVVGLSTLPEIYEKMEKG 336

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 83/219 (37%), Gaps = 42/219 (19%)

Query: 87  KPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
           K GDHVV   TA C                C+ C +G  N+C  +  T G GV   G   
Sbjct: 90  KIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNICKYLGLT-GAGVEGGG--- 145

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                            F+E                PL+   L+       +  AVK + 
Sbjct: 146 -----------------FAEKMVINEHHCHKIPHHMPLDVASLIQPISVCWH--AVKVSH 186

Query: 193 VQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK 252
            ++G +V + G G +GL  +   K      I+V +    +RE A K GA  F      L 
Sbjct: 187 YKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMGARVFDPSNMSL- 245

Query: 253 EGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALEAC 289
             +  +  L EM  G  G D+TFDC+G    ++ A+E C
Sbjct: 246 --DNSIKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC 282

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 82/372 (22%), Positives = 138/372 (37%), Gaps = 40/372 (10%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           MS +Q  P    A + Y  G  L+ + + V  PK++E+ I +  S +CHTD +   G  P
Sbjct: 1   MSASQ-IPKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWP 59

Query: 61  -EGLFPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
                P +                   K GD+  +      C  C++C     + C    
Sbjct: 60  LPTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNCPEAD 119

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
            +   G   DG                   +F +Y                L  V  + C
Sbjct: 120 LS---GYTHDG-------------------SFQQYATADAVQAARIPAGTDLAEVAPVLC 157

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K+A+++ G+ VA+ GA G +G   +Q AKA    R++ +D  + K     
Sbjct: 158 AGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAM-GYRVLGIDGGEEKAALFK 215

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWG 294
           + G   FI    D  + + +V  +++ T+GG         N  V   A+EA     +  G
Sbjct: 216 ELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANG 267

Query: 295 QSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFV 353
             +++G+    +  S    Q+V      GS  G     R  +    R  +   +KV    
Sbjct: 268 TVVLVGLPGGAKCKSDVFNQVVKSTTIVGSYVGNRADTREALDFFARGLVKSPIKVVGLS 327

Query: 354 THKRPFEEINSG 365
                +E++  G
Sbjct: 328 ELPSIYEKMEKG 339

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 122/306 (39%), Gaps = 51/306 (16%)

Query: 84  TNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDG 129
           TN+K GDHVV   T  C               +C  C  G  N C  +    G GV   G
Sbjct: 87  TNIKAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRGFYNCCAHL-GFMGLGVHSGG 145

Query: 130 TSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVK 189
                               F+E                PL+   L+     + +  AV+
Sbjct: 146 --------------------FAEKVVVSEKHVVKIPNTLPLDVAALVEPISVSWH--AVR 183

Query: 190 TADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKT 249
            + +Q+G +  V GAG +GL+ +   +   AS+I+V +  + +R  A+K G   F +P  
Sbjct: 184 ISKLQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRRNQAAKLGVETF-DPSE 242

Query: 250 DLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQE-I 308
             ++   I+ +L    + G D  +DC+G        +   H    + + + +A  G + I
Sbjct: 243 HKEDAVNILKKLAPGGE-GFDFAYDCSGVKPTFDTGV---HATTFRGMYVNIAIWGHKPI 298

Query: 309 STRPFQL-VTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTL---KVQEFVTHKRPFEE-IN 363
             +P  + +  +   GS    IK   +   +V+   NG++   K +  +T ++  E+   
Sbjct: 299 DFKPMDVTLQEKFVTGSMCYTIK---DFEDVVQALGNGSIAIDKARHLITGRQKIEDGFT 355

Query: 364 SGFEDL 369
            GF++L
Sbjct: 356 KGFDEL 361

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 79/355 (22%), Positives = 131/355 (36%), Gaps = 33/355 (9%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y     L+ + + V  PK  E+ I ++ S +CHTD +   G  P +   P +      
Sbjct: 16  IFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 75

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                        K GD   +      C  C+ C     + C     +   G   DG   
Sbjct: 76  GVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNCPEADLS---GYTHDG--- 129

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                           +F +Y                +  V  + C   T Y  A+K+A+
Sbjct: 130 ----------------SFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALKSAE 172

Query: 193 VQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ GD VA+ G AG +G   VQ AKA    R++ +D  D K ++    G   F+    D 
Sbjct: 173 LKAGDWVAISGAAGGLGSLAVQYAKAM-GYRVLGIDGGDEKEKFFKSMGGEVFV----DF 227

Query: 252 KEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTR 311
              + IV  + E T+GG     + + + K +  + +      G  +++G+ A     S  
Sbjct: 228 MTCKDIVGAVKEATNGGAHGCINVSVSEKAIEASTQYVRTN-GTVVLVGLPAGAYCKSEV 286

Query: 312 PFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
             Q+V      GS  G     R  +   VR  +  T+KV    T    +E++  G
Sbjct: 287 FDQVVKSYKIVGSYVGNRADTREALDFFVRGLVKPTIKVVGLSTLPEIYEKMEKG 341

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 84/186 (45%), Gaps = 14/186 (7%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AV+ + +Q G T  V GAG +GL+ V   ++  A  IIV +  D +R+ A   GA  F N
Sbjct: 181 AVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTIIVSEPADTRRQKAEALGAQTF-N 239

Query: 247 PKTDLKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
           P    + G+ ++  L ++  G  G + ++DC G ++     L   H    + + + +A  
Sbjct: 240 PT---EHGDNVIEALRKLAPGGEGFNFSYDCCGTSETFSAGL---HTLTPKGVAVNIAVW 293

Query: 305 G-QEISTRPFQLVTG-RVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEI 362
           G + I   P  + T  R   GS     +   E   +V     G + + +  T     E I
Sbjct: 294 GPKPIDFYPMDVTTSERFVTGSICYTTQDFEE---VVDAMDKGKIDINKVKTMITGRERI 350

Query: 363 NSGFED 368
            +GFE+
Sbjct: 351 ENGFEN 356

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 99/271 (36%), Gaps = 31/271 (11%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y     L  + + V  PK +E+ I +  S +CHTD +   G  P
Sbjct: 24  LQSTAAIPKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
             +  P +                   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LAVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNCPEAD 143

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
            +   G   DG                   +F ++                L  V  + C
Sbjct: 144 LS---GYTHDG-------------------SFQQFATADAIQAAKIQPGTDLAEVAPILC 181

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K A+++ GD VA+ G AG +G   VQ A A    R++ +D  + K +   
Sbjct: 182 AGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVLGIDAGEEKEKLFK 239

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGG 268
           + G   FI    D  + + +V+ + E T GG
Sbjct: 240 QLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 78/174 (44%), Gaps = 16/174 (9%)

Query: 169 PLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDI 228
           PL+   L+     T + A  K     +G T  + G+G +GL+++   KA  AS+I+V ++
Sbjct: 165 PLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEV 222

Query: 229 NDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEA 288
              +R+ A K     F +P    K     +  L E  D G D  FDC+G    M  A+  
Sbjct: 223 AQVRRKLAEKMKVEVF-DPSVHGKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAI-- 278

Query: 289 CHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDY 342
            H    +  I+ VA  G   ST  F ++   + + +  G I      G +VRD+
Sbjct: 279 -HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI------GYVVRDF 322

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A K A  + GD V VFGAG VGL     AK   A +++ +D+ D K E A  FGAT  IN
Sbjct: 162 ANKQAGTRFGDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVIN 221

Query: 247 PKTDLKEGETIVARLIEMTDGGLDH--TFDCTGNTKVMRDALEACHKGWGQSIIIGVAAA 304
                   E  +A  I+   GG+D     +CTG    +R  + A   G G  + +G+   
Sbjct: 222 SSKLRINDEFELAVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG-GTFVQVGMGKD 280

Query: 305 GQEISTRPF 313
              I    F
Sbjct: 281 DANIPITQF 289

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/285 (21%), Positives = 107/285 (37%), Gaps = 32/285 (11%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXX 78
           G PL   ++ V  PK  E+ I +  S +CHTD +   G  P     P +           
Sbjct: 53  GGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVA 112

Query: 79  XXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGK 137
                   + GD   +      C  C+ C  G  + C     +   G   DG        
Sbjct: 113 MGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNCPEADLS---GYTHDG-------- 161

Query: 138 GETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGD 197
                      +F +Y                L  V  + C   T Y  A+K+A+++ G+
Sbjct: 162 -----------SFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKSANLRAGN 209

Query: 198 TVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGET 256
            VA+ GA G +G   +Q A+A    R++ +D  D K     K G   F+    D ++ + 
Sbjct: 210 WVAISGACGGLGSLAIQYARAM-GYRVLEIDGGDEKEALFRKLGGEVFV----DFRKSKD 264

Query: 257 IVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           +VA +++ T GG     + + +   +  + E      G  +++G+
Sbjct: 265 VVADVVKATGGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGL 308

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 112/297 (37%), Gaps = 32/297 (10%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPC 66
           P    A +    G  L  + + V  PK+ E+ I +  S +CHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD   +      C  C++C  G  + C     +   G 
Sbjct: 67  VGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNCPNADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY- 163

Query: 186 AAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A+++ G+ VA+ G AG +G   VQ AKA    RI+ +D  + K +   + G   F
Sbjct: 164 KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAM-GYRILGIDGGEEKEKLFRELGGEIF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           I    D  + + IV  +I+ T+GG     + + +   +  + E C    G  +++G+
Sbjct: 223 I----DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGL 274

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 96/257 (37%), Gaps = 31/257 (12%)

Query: 15  VAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXX 73
           + Y  G  L+ + + V  PKA+E+ I +  S +CHTD +   G  P     P +      
Sbjct: 11  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 70

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                          GD   +      C  C++C     + C            PD    
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 115

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                   L  +    +F +Y                L  V  + C   T Y  A+K+AD
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSAD 167

Query: 193 VQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDL 251
           ++ GD VA+ GA G +G   +Q AKA    R++ +D    K +   + G   F+    D 
Sbjct: 168 LKAGDWVAISGACGGLGSLAIQYAKAM-GYRVLGIDTGAEKAKLFKELGGEYFV----DY 222

Query: 252 KEGETIVARLIEMTDGG 268
              + ++  +++ T+GG
Sbjct: 223 AVSKDLIKEIVDATNGG 239

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 103/278 (37%), Gaps = 56/278 (20%)

Query: 37  EVRIKIVNSAICHTDAYTLS----------GSDPEG--LFPCILXXXXXXXXXXXXXXXT 84
           EV I++  + IC TD +  S          GS P      P  +               T
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 85  NVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDGT 130
            VK GDHVV      C              + C  C  G  N+C     T   G+   GT
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT---GL---GT 141

Query: 131 SRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKT 190
           S    G G           F+E                PL+   L+     T + A  K 
Sbjct: 142 S----GGG-----------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 191 ADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTD 250
           A  Q+G T  V GAG +GL+ +   K   AS+I+V ++   +R+ A+  G   F NP   
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NP--- 240

Query: 251 LKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDAL 286
             E +  +A L ++ +G  G D  FDC+G       AL
Sbjct: 241 -AEHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 98/271 (36%), Gaps = 31/271 (11%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           M+     P      + Y     L  + + V  PKA+E+ I +  S +CHTD +   G  P
Sbjct: 1   MATLHAVPETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWP 60

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
                P +                   K GD+  +      C  C++C     + C    
Sbjct: 61  LATKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNCPEAD 120

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
            +   G   DG                   +F +Y                L  V  + C
Sbjct: 121 LS---GYTHDG-------------------SFQQYATADYVQAARIPQGTDLAQVAPILC 158

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K+A++  G+ VA+ G AG +G   VQ AKA    RI+ +D  D K+    
Sbjct: 159 AGITVY-KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAM-GYRILGIDGGDEKKALFH 216

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGG 268
           + G   F+    D  + + +   ++  T+GG
Sbjct: 217 ELGGEIFV----DFTKSKNVEQDILVATNGG 243

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 18/189 (9%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A+K A  + G +V V G G +GL  +   +    S I+V +    +RE A + GAT + +
Sbjct: 181 AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPAKVRRELAERMGATTY-D 239

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
           P     E      R + +   G D+ FD +G  + +  A+E C    G ++ + +    +
Sbjct: 240 PSQHNTEKNIQNLRKMILGGDGFDYVFDNSGTPETLETAIE-CLTVRGTAVNVAMWPPHK 298

Query: 307 EISTRPFQLVT-GRVWKGSA------FGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
            +   P  +    +++ GS       F G+    E G + +D        +  +T K P 
Sbjct: 299 RVEFSPMAVTKEEKIYTGSMCYTQFDFEGVIDAFERGLIDKDI------ARHMITAKVPI 352

Query: 360 EEINSGFED 368
           E+   G ED
Sbjct: 353 ED---GLED 358

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 50/101 (49%), Gaps = 1/101 (0%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AV+ +  ++G +V + GAG +GL  +        S ++V +    +R++A K GA  + +
Sbjct: 220 AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVY-D 278

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALE 287
           P     +      R I     G D+ FDC+GN   ++ A+E
Sbjct: 279 PSAKDHDESIKYLRSIAPGGDGFDYAFDCSGNPATLKAAIE 319

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 63/271 (23%), Positives = 98/271 (36%), Gaps = 31/271 (11%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y     L  + + V  PK +E+ I +  S +CHTD +   G  P
Sbjct: 24  LQSTIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWP 83

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
             +  P +                   K GD   +      C  C+FC SG  + C    
Sbjct: 84  LPVKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC---- 139

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
                   PD            L  +    +F ++                L  V  + C
Sbjct: 140 --------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILC 181

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K A+++ GD VA+ G AG +G   VQ A A    R++ +D    K +   
Sbjct: 182 AGVTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAM-GYRVLGIDAGAEKEKLFK 239

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGG 268
           + G   FI    D  + + +V+ + E T GG
Sbjct: 240 QLGGEVFI----DFTKTKDMVSDIQEATKGG 266

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 120/306 (39%), Gaps = 51/306 (16%)

Query: 84  TNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDG 129
           T VK GDHVV    + C              + C+ C  G  NLC       G GV+  G
Sbjct: 87  TKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLC-THGGFIGLGVISGG 145

Query: 130 TSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVK 189
                               F+E                PL+   L+     T +  AVK
Sbjct: 146 --------------------FAEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVK 183

Query: 190 TADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKT 249
            +  ++G +  V GAG +GL  +   K   A +I+V ++ + + E A   G   F   K 
Sbjct: 184 ISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVFNPSKH 243

Query: 250 DLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEAC-HKGWGQSIIIGVAAAGQEI 308
             K  E  V R +  +  G D+++DC+G       +L+A   KG   +I    A  G + 
Sbjct: 244 GQKSIE--VLRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNI----AVWGPK- 296

Query: 309 STRPFQLVTGRVWKGSAFGGIKGRSE-MGGLVRDYLNGTLKVQ---EFVTHKRPFEE-IN 363
              PFQ +   + +    G I    E   G+V+   NG + ++   + +T K+  E+   
Sbjct: 297 -PVPFQPMDVTLQEKILTGSIGYVVEDFEGVVQAIHNGDITLEDCKQLITGKQKIEDGWE 355

Query: 364 SGFEDL 369
            GF++L
Sbjct: 356 KGFQEL 361

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 102/254 (40%), Gaps = 35/254 (13%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXX 79
           G  L  + + V  PK++E+ I ++ S +CH+D +   G  P  L   ++           
Sbjct: 19  GGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPLV--GGHEGAGVV 76

Query: 80  XXXXTNV---KPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRN 135
               +NV   K GD+  +      C  C+FC       C     T   G + DG      
Sbjct: 77  VGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GTVHDG------ 127

Query: 136 GKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQE 195
                        +F +Y                L  +  L C   T Y  A+K+A+++ 
Sbjct: 128 -------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY-KALKSANMRP 173

Query: 196 GDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEG 254
           G  VA+ GA G +G   +Q A A    R++ +D  + K ++    G   FI    D K+ 
Sbjct: 174 GQWVAISGACGGLGTYAIQYATAM-GYRVLGIDSGEEKAKYFKTLGGEVFI----DYKKS 228

Query: 255 ETIVARLIEMTDGG 268
           + +VA +I+ TDGG
Sbjct: 229 KDVVADVIKATDGG 242

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 79/357 (22%), Positives = 132/357 (36%), Gaps = 46/357 (12%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXX 79
           G  L+ + + V  P+ +E+ I +  S +CHTD +   G  P    P  L           
Sbjct: 18  GGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWP---LPTKLPLVGGHEGAGI 74

Query: 80  XXXXTNV-----KPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRF 133
                ++     + GD   +      C  C++C     + C     +   G   DG    
Sbjct: 75  VVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQADLS---GYTHDG---- 127

Query: 134 RNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADV 193
                          +F +Y                L  V  + C   T Y  A+K+A++
Sbjct: 128 ---------------SFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANL 171

Query: 194 QEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK 252
           + G+ VA+ GA G +G   VQ AKA    R++ +D  D K +   + G   FI    D  
Sbjct: 172 RAGEWVAISGASGGLGSLAVQYAKAM-GYRVLGIDGGDEKAKLFKQLGGEYFI----DFT 226

Query: 253 EGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEAC---HKGWGQSIIIGVAAAGQEIS 309
           + + ++A +I+ TDGG         N  V   A+ A     +  G  +++G+ A     S
Sbjct: 227 KSKDVIAEVIKATDGGAHGVI----NVSVSEGAISASTRYARANGTVVLVGLPANAYCKS 282

Query: 310 TRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
               Q+V      GS  G     R  +    R  +   +K+    T    +E++  G
Sbjct: 283 EVFNQVVKSVAIVGSYVGNRADTREALDFFARGLVKSPIKIVGLSTLPEIYEKMEKG 339

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 86/221 (38%), Gaps = 43/221 (19%)

Query: 84  TNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDG 129
           T VK GDHVV    + C              + C  C  G  NLC       G GV+  G
Sbjct: 87  TKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCTHA-GFIGLGVISGG 145

Query: 130 TSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVK 189
                               F+E                PL+   L+     T +  AV+
Sbjct: 146 --------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVR 183

Query: 190 TADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKT 249
            +  ++G +  V GAG +GL  +   K   A +I+V ++ + + E A + G   F +P+ 
Sbjct: 184 LSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR- 241

Query: 250 DLKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALEA 288
             K GE  V  L  +T    G D+++DC+G       +L+A
Sbjct: 242 --KHGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 94/271 (34%), Gaps = 28/271 (10%)

Query: 1   MSETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP 60
           +  T   P      + Y  G  L  + + V  PK +E+ + +  S +CHTD +   G  P
Sbjct: 20  LQSTVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWP 79

Query: 61  EGL-FPCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVR 118
             +  P +                 N + GD   +      C  C+ C SG  + C    
Sbjct: 80  LSVKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC---E 136

Query: 119 ATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGC 178
                G   DG                   +F +Y                L  V  + C
Sbjct: 137 HADLSGYTHDG-------------------SFQQYATADAVQAAKIPEGTNLAEVAPVLC 177

Query: 179 GVTTGYGAAVKTADVQEGDTVAVFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWAS 237
              T Y  A+K A +  G  V + G AG +G   VQ  KA    R+I +D    K E   
Sbjct: 178 AGITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFK 235

Query: 238 KFGATDFINPKTDLKEGETIVARLIEMTDGG 268
             G   FI+  T  K    +VA + + T+GG
Sbjct: 236 SLGGEVFID-FTKQKTDSDMVAAIQKATNGG 265

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 187 AVKTADVQEGD--TVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
           AVK A  ++G      V GAG +GL+ +   KA  AS+I+V ++   +RE A K G   F
Sbjct: 181 AVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVVSELAAIRRELALKMGVEVF 240

Query: 245 INPKT-DLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEA 288
              K  D K+G   +  + E  D G D  FDC+G       AL +
Sbjct: 241 DPSKHGDEKQGIKKLREIPEDHD-GFDFAFDCSGVETTFNTALHS 284

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 53/106 (50%), Gaps = 6/106 (5%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A + +    G +  V GAG +GL+++   KA+ AS+IIV +    +RE A +     F +
Sbjct: 181 AARVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMHVETF-D 239

Query: 247 PKTDLKEGETIVARLIEMT-DG-GLDHTFDCTGNTKVMRDALEACH 290
           P T    G+  VA L   T DG G D  FDC+G        L+A H
Sbjct: 240 PST---HGDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/215 (22%), Positives = 77/215 (35%), Gaps = 37/215 (17%)

Query: 87  KPGDHVVPLYTAECQ--------------QCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
           K GDHVV   T  C+               C  C  G  N+C  +    G GV   G   
Sbjct: 90  KVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL-GLCGAGVQSGG--- 145

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
                            F+E                PL+   L+       +  A++  +
Sbjct: 146 -----------------FAERVVMNESHCHKVPDDLPLDIAALIQPIAVCWH--ALRICN 186

Query: 193 VQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK 252
            ++G +  V G+G +GL ++        + I+V +    +R++A + GAT F        
Sbjct: 187 FKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVFDPSSLPTH 246

Query: 253 EGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALE 287
           E      R I     G D+TFDC+GN      ++E
Sbjct: 247 EESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/352 (23%), Positives = 128/352 (36%), Gaps = 35/352 (9%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXX 78
           G  L  E + V  P ++EV I +  S +CHTD +T  G  P +   P +           
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 79  XXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGK 137
                   + GD   V    + C  C+ C  G    C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 138 GETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGD 197
                      TF +Y                L  V  + C   + Y  A+K  ++Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 198 TVAVFGA-GTVGLSVVQGAKARNASRIIVVD-INDAKREWASKFGATDFINPKTDLKEGE 255
            VA+FGA G +G   VQ AKA    R++ +D   + +++     G   F+    D  + +
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAM-GYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVD 250

Query: 256 TIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
            I A + + T GG     + T +       ++ C +  G  + +GV      + T  F +
Sbjct: 251 NIPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTI 309

Query: 316 VT-GRVWKGSAFGG-IKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           V  G   KGSA G     R  +    R  +   +K+       + FE + SG
Sbjct: 310 VQHGFSIKGSASGSRADTREAVDFFTRGLIKSPIKILGLSELPKAFELLESG 361

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 92/249 (36%), Gaps = 31/249 (12%)

Query: 23  LRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXXXXXXXXXX 81
           L+   + V  PK++E+ I +  S +CHTD +   G  P  +  P +              
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 82  XXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGET 140
                K GD   +      C  C+ C +G    C         G   DG           
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANC---EHADLSGYTHDG----------- 156

Query: 141 LYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTVA 200
                   +F +Y                L  +  + C   T Y  A+KTA+++ G+ VA
Sbjct: 157 --------SFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 201 VFG-AGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVA 259
           + G AG +G   VQ AKA    R++ +D  + K +     G   F+    D  + + IVA
Sbjct: 208 ISGAAGGLGSLAVQYAKAM-GYRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVA 262

Query: 260 RLIEMTDGG 268
            +   T GG
Sbjct: 263 DIQNATKGG 271

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 95/249 (38%), Gaps = 31/249 (12%)

Query: 23  LRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL-FPCILXXXXXXXXXXXXX 81
           L  + + V  P  +E+ I +  S +CHTD +   G  P  +  P +              
Sbjct: 22  LEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGVVVALGS 81

Query: 82  XXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGET 140
              N K GD+  +      C  C+ C  G  + C     +   G   DG           
Sbjct: 82  NVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQADLS---GYTHDG----------- 127

Query: 141 LYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTVA 200
                   +F +Y                L  V  + C   T Y  A+K+A+++ G  VA
Sbjct: 128 --------SFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY-KALKSAELEAGQWVA 178

Query: 201 VFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVA 259
           + GA G +G   VQ AKA    R++ +D  D K +   + G   FI    D  + + I+ 
Sbjct: 179 ISGACGGLGSLAVQYAKAM-GYRVLGIDGGDEKAKMFKELGGEYFI----DFTKCKDIIG 233

Query: 260 RLIEMTDGG 268
            +++ T+GG
Sbjct: 234 EVVKATNGG 242

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/366 (21%), Positives = 130/366 (35%), Gaps = 41/366 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPC 66
           P    A + Y  G PL  + + V  P A E+ I +  S +CHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 67  ILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGV 125
           +                   K GD+  +      C  C+ C     + C     +   G 
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNCPEADLS---GY 123

Query: 126 MPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYG 185
             DG                   +F +Y                L  V  + C   T Y 
Sbjct: 124 THDG-------------------SFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY- 163

Query: 186 AAVKTADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDF 244
            A+K+A++  GD VA+ GA G +G   +Q A A    R++ +D    K E   + G   F
Sbjct: 164 KALKSANLSAGDWVAISGACGGLGSLCIQYATAM-GYRVLGIDGGAEKAELFKQLGGEVF 222

Query: 245 INPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACH---KGWGQSIIIGV 301
           I    D    + +   +I+ T+GG         N  V   A+E+     +  G  +++G+
Sbjct: 223 I----DFTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIESSTRYVRANGTVVLVGL 274

Query: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVRDYLNGTLKVQEFVTHKRPF 359
              G +  +  F  V   +    ++ G +   R  +    R  +   +KV    T    F
Sbjct: 275 -PGGAKCRSDVFSHVVKSISIVGSYVGNRADTREALDFFSRGLVKSPIKVVGLSTLPEVF 333

Query: 360 EEINSG 365
           E++  G
Sbjct: 334 EKMEKG 339

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 84/219 (38%), Gaps = 39/219 (17%)

Query: 84  TNVKPGDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDG 129
           T VK GDHVV    + C              + C+ C  G  NLC A     G GV+  G
Sbjct: 87  TKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLC-AHSGFVGLGVISGG 145

Query: 130 TSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVK 189
                               F+E                PL+   L+     T +  AVK
Sbjct: 146 --------------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVK 183

Query: 190 TADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKT 249
            +  ++G +  V GAG +GL  +   K   A +I+V ++ + + + A       F NP  
Sbjct: 184 LSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQ 242

Query: 250 DLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEA 288
              +   ++  L E  D G D+++DC+G       +L+A
Sbjct: 243 HGHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 110/298 (36%), Gaps = 34/298 (11%)

Query: 8   PIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGS---DPEGLF 64
           P    A V Y  G  L+   + V  PK +E+ + I  S +CHTD +   G     P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 65  PCILXXXXXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123
           P +                TN + GD+  V      C +C+FC                K
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFC---------------QK 131

Query: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTG 183
           G  P       N +  TL  +    TF +Y                L  V  + C   T 
Sbjct: 132 GFEP-------NCETPTLSGYTHDGTFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243
           Y  A+KTA +  G  VA+ GAG    S+          R++ +D  + K       G   
Sbjct: 185 Y-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSLGGET 243

Query: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
           F+    D  + + IV+ + E T GG     + + +T  +  ++E   +  G  +++G+
Sbjct: 244 FV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVVLVGL 296

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 61/116 (52%), Gaps = 5/116 (4%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A K A  + G  V V GAG VGL     A+A  A+ ++ VDI + K E + +FGAT  ++
Sbjct: 160 ANKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVS 219

Query: 247 PKTDLKEGETIVARLIEMTDGGLDH-TFDCTGNTKVMRDALEACHKGWGQSIIIGV 301
             +D    E  V+ + ++  G L +   +C+G    +R  ++AC K  G  + +G+
Sbjct: 220 SSSD---EERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM 271

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 73/182 (40%), Gaps = 8/182 (4%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A + A  Q    V VFGAG VGL     AKA  A+ + +VDI+  K   A   G T  ++
Sbjct: 162 ANRLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD 221

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
             +D    E +  +L       +D  FDC+G    +  A+  C  G      + V ++  
Sbjct: 222 -SSDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTH---VQVGSSRD 277

Query: 307 EISTRPFQLVTGRVWKGSAFGGIK-GRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
            +S   F L    V +    G  +    +    V    +  +     VTH+ PF+     
Sbjct: 278 YVS---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEA 334

Query: 366 FE 367
           ++
Sbjct: 335 YK 336

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/252 (23%), Positives = 92/252 (36%), Gaps = 31/252 (12%)

Query: 20  GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXX 78
           G  L    + V   KA+E+ I +  S +CH+D Y      P     P +           
Sbjct: 29  GGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHEGAGVVVG 88

Query: 79  XXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGK 137
                 N K GD   V    + C  C+ C  G    C          +  +     RNG 
Sbjct: 89  MGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC----------LKSEYNGFTRNG- 137

Query: 138 GETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGD 197
                      +F +Y                L  +    C   T Y  A+K+A+++ G 
Sbjct: 138 -----------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKSANIRAGQ 185

Query: 198 TVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGET 256
            +A+ GA G +G   +Q  KA    R++ +D  +AK     + G   FI    D  + + 
Sbjct: 186 WMAITGACGGLGSVAIQYCKAM-GYRVVGIDAGEAKANLFKELGGEVFI----DFTKSKD 240

Query: 257 IVARLIEMTDGG 268
           +VA ++  T+GG
Sbjct: 241 LVADVVSATNGG 252

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 84/211 (39%), Gaps = 25/211 (11%)

Query: 85  NVKPGDHVVPLYTAECQ---QCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETL 141
           N+K GDHVV   T  C+   +           C A +              F N   E  
Sbjct: 88  NIKVGDHVVVETTGTCKDRYRWPDVKHASDEECAACK------------KDFYNCCSELG 135

Query: 142 YHFMGCST--FSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTV 199
           +  +GC +  F+E                PL+   L+     + +  AV+ + ++ G + 
Sbjct: 136 FCGLGCHSGGFAEKVVISEKHVVKVPKDIPLDVAALVEPLAVSWH--AVRISQLKAGQSA 193

Query: 200 AVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVA 259
            + GAG +GL+ V   +   A  I+V + + ++R+ A   GA  F NP      G+  V 
Sbjct: 194 LILGAGPIGLATVLALQGHGAGTIVVSEPSASRRKQAEALGALTF-NP---FDHGDKAVD 249

Query: 260 RLIEMTDG--GLDHTFDCTGNTKVMRDALEA 288
            L ++  G  G D ++DC+G        L A
Sbjct: 250 ELRKIPPGSDGFDFSYDCSGLKATFNTGLYA 280

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 83/215 (38%), Gaps = 40/215 (18%)

Query: 89  GDHVVPLYTAEC--------------QQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFR 134
           GDHVV   T+ C              + C  C  G  N+C  +    G GV   G     
Sbjct: 92  GDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRGLYNICSHL-GLCGVGVQSGG----- 145

Query: 135 NGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQ 194
                          FSE                PL+   L+     + +  A++ + + 
Sbjct: 146 ---------------FSERVVMNQKHVIKIPKHIPLDVAALVQPLAVSWH--AIRISGLT 188

Query: 195 EGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEG 254
            G +  V G G +GL  +   +A  AS+I+V +    +RE A   GA  F +P T+ +E 
Sbjct: 189 AGKSALVVGGGPIGLGTILALQAYGASKIVVSEPAKNRRELAKLMGAEVF-DP-TEWEEH 246

Query: 255 ETI-VARLIEMTDGGLDHTFDCTGNTKVMRDALEA 288
           E +   R +     G D++FDC+G     R ++ A
Sbjct: 247 EAVEYLRKVAPGGDGFDYSFDCSGLPVTFRASVHA 281

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 90/196 (45%), Gaps = 9/196 (4%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A + A+   G  V VFGAG VGL     A A  AS ++ VD+ + K E +  FGAT+ IN
Sbjct: 161 ANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTIN 220

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
                 E E       E+     +   DC+G    +R A++   K  G  + +G+   G+
Sbjct: 221 STKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVL-KAGGSYVQVGM---GK 276

Query: 307 EISTRPFQLVTGRVWKGSAFGGIKGR-SEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSG 365
           +    P  ++  +  +    G  +   ++    V+    G + V++ +TH   FEE    
Sbjct: 277 DNINFPIAMIGAKELR--VLGSFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEEAIDA 334

Query: 366 FE-DLHHG-DCLRTVL 379
           +  +L HG + ++T++
Sbjct: 335 YNFNLEHGSEVVKTMI 350

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 1/91 (1%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A+   D + G T  + GAG +GL  +    A   S I V +    +RE A K GA  F +
Sbjct: 181 AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEKMGARVF-D 239

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTG 277
           P     +      R +     G D+TFDC+G
Sbjct: 240 PTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A++  + + G T  + GAG +GL  +    A     I+V +    +RE A K GA  +  
Sbjct: 181 AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDP 240

Query: 247 PKTDLKEGETIVARLIEMTDG--GLDHTFDCTGNTKVMRDALE 287
                KE    +  L  + DG  G D+TFDC+G    +  A++
Sbjct: 241 TAHAAKES---IDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 84/225 (37%), Gaps = 28/225 (12%)

Query: 14  AVAYAA-GEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXX 71
           A+ +A+ G  L  + + V  P + E+ I +  S +CHTD +   G  P     P +    
Sbjct: 9   AIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 72  XXXXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGT 130
                          K GD   +      C  C++C  G  + C     +   G   DG 
Sbjct: 69  GAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHADLS---GYTHDG- 124

Query: 131 SRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKT 190
                             +F +Y                L  V  + C   T Y  A+K+
Sbjct: 125 ------------------SFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKS 165

Query: 191 ADVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKRE 234
           AD++ G  VA+ GA G +G   VQ A+A    R++ +D  D KR+
Sbjct: 166 ADLKAGQWVAISGACGGLGSLAVQYARAM-GYRVLGIDGGDDKRK 209

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 1/101 (0%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A+   + + G T  + GAG +GL  +    A     I+V +    +RE A K GA  +  
Sbjct: 181 AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVYDP 240

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALE 287
            +   KE    +  + E  D G D+TFDC+G    +  A++
Sbjct: 241 TEHAAKESIDYLRSIAEGGD-GFDYTFDCSGLEITLNAAIQ 280

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 1/101 (0%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A+   + + G T  + GAG +GL  +    A     I+V +    +RE A K GA  +  
Sbjct: 181 AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAEKMGARVYDP 240

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALE 287
            +   +E    +  + E  D G D+TFDC+G    +  A++
Sbjct: 241 TEHAARESIDYLRSVAEGGD-GFDYTFDCSGLEVTLNAAIQ 280

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 80/224 (35%), Gaps = 34/224 (15%)

Query: 97  TAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXX 156
            + C QC  C SG    C    +T  K   PDG              ++    ++ +   
Sbjct: 106 ASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------------YVSQGGYASHVRA 150

Query: 157 XXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAK 216
                       P E V  L CG  T +    +    +    VAV G G +G   +  A+
Sbjct: 151 HEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPKVAVIGIGGLGHMAIMIAR 210

Query: 217 ARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFD-- 274
           A  A  +       +KR+ A K GA  F             VA      + GLD TFD  
Sbjct: 211 ALGA-EVYAFSRGHSKRDDALKMGAHHF-------------VATGDADWNAGLDDTFDLI 256

Query: 275 --CTGNTKVMR-DALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
             C  +T  +  +A+  C K     + +G+    +E+S +PF  
Sbjct: 257 LNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPFSF 300

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 95/247 (38%), Gaps = 33/247 (13%)

Query: 23  LRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDP-EGLFPCILXXXXXXXXXXXXX 81
           L ++ + V  PKA+E+ I +  S +CH+D +   G  P +   P +              
Sbjct: 25  LELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGA 84

Query: 82  XXTNVKPGDHV-VPLYTAECQQCKFC-VSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGE 139
                K GD+  +    + C  C+ C +S + N   A           D +   R+G   
Sbjct: 85  SVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA-----------DISGFTRDG--- 130

Query: 140 TLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTV 199
                    +F +Y                L  V  + C   T +  A+KTA++  G+ V
Sbjct: 131 ---------SFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF-KALKTANLTAGNWV 180

Query: 200 AVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIV 258
           A+ GA G +G   +Q AKA   S ++ +D    K    +  G   F+    D  + E +V
Sbjct: 181 AISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL----DFSKSENLV 235

Query: 259 ARLIEMT 265
             ++  T
Sbjct: 236 PEVVSAT 242

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 77/175 (44%), Gaps = 24/175 (13%)

Query: 173 VCLLGCGVTTGYGAAVKTA--DVQEGDT-VAVFGAGTVGLSVVQGAKARNASRIIVVDIN 229
           V  L CG  T Y + +K A  DV +    VA+ G G +G   +  +KA +   +  +  +
Sbjct: 171 VAPLQCGGLTVY-SPIKRALKDVTDKKPRVAIIGIGGLGHMAIMISKALDC-EVWALSTS 228

Query: 230 DAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTF----DCT-GNTKVMRD 284
           D+K+E A K GA  F+N  T  K+             GGL  TF     CT   TK+  +
Sbjct: 229 DSKKEDAKKMGADHFVN--TTEKD-----------VWGGLQDTFHLILSCTISYTKLPFE 275

Query: 285 ALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT-GRVWKGSAFGGIKGRSEMGGL 338
           +L       G+ I +G+ +  Q +   P QL   G  +  S  G IK   E+  L
Sbjct: 276 SLLGTLVATGKFISVGLPSKDQPLEIHPMQLAAHGVSFSASHLGSIKELEELLAL 330

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 192 DVQEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTD 250
           +VQ+GD + V+ A G VGL   Q  KAR A  I V    D K + A ++GA   IN   D
Sbjct: 164 NVQKGDFILVYAAAGGVGLIFDQLLKARGARTIAVAS-TDEKLQLAKEYGAEFLINSTKD 222

Query: 251 LKEGETIVARLIEMTDG-GLDHTFDCTGN 278
                 IV ++ E T+G G+   FD  G 
Sbjct: 223 -----DIVEKVKEFTNGEGVAAAFDSIGK 246

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 84/356 (23%), Positives = 137/356 (38%), Gaps = 34/356 (9%)

Query: 23  LRIEKVTVDPPKA--HEVRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXXX 80
           L  +K + D   A   +V IK++   +C +D +  +G        C++            
Sbjct: 19  LHPKKASYDLKTAGDRDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVG 78

Query: 81  XXXT-NVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKG 138
              T  VK GD V V   +  C +C+ C++G    C          + PDG S+ + G G
Sbjct: 79  PKCTAGVKVGDRVGVGAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDG-SKAQGGFG 137

Query: 139 ETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDT 198
             +          EY               PL       CG  T +   ++   V  G T
Sbjct: 138 SHV-------RTHEYFVHPIPKELDTVNAAPLL------CGGITAFSPLLR-GQVGPGKT 183

Query: 199 VAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIV 258
           V + G G +G   +  AKA  A ++I +  + +K+E   K GA ++I       EG+   
Sbjct: 184 VGIVGIGGIGHIAILFAKAMGA-KVIAISRSASKKEDCLKLGADEYIAS----AEGDDWK 238

Query: 259 ARLIEMTDGGLDHTFDCTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVT 317
            +      G +D    C  + +K   D+L +  K  G+   IG+      +S  P  L+ 
Sbjct: 239 QKFA----GSIDFMLLCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLL- 293

Query: 318 GRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHHGD 373
           G  +  SA G      +M  LV+   N  L V+     ++   E    FE + +GD
Sbjct: 294 GIKFGFSALGSRNEFQKMFELVKKN-NIKLWVETLPIGEKGLHE---AFERVENGD 345

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 112/316 (35%), Gaps = 56/316 (17%)

Query: 14  AVAYAAGEPLRIEKVTVDP--PKAHEVRIKIVNSAICHTDAYTLSGSDPEGLFP------ 65
           A+AY     +R      +P   K  +V I IV   IC TD + L   D    FP      
Sbjct: 3   ALAYFGTRDIRFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHELL--DGPNFFPKDGETH 60

Query: 66  --------CILXXXXXXXXXXXXXXXTNVKPGDHVVPLYTAECQQ----------CKFCV 107
                     +               T  +PGDHVV   T  CQ           CK C 
Sbjct: 61  EISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETCKACK 120

Query: 108 SGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXX 167
            G  N+C  +    G GV   G                    F+E               
Sbjct: 121 RGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFKVPSW 159

Query: 168 XPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVD 227
            PL+   L+       +  AVK   V+EG +  + G G +GL ++   +    + I+V +
Sbjct: 160 IPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDIVVSE 217

Query: 228 INDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGG--LDHTFDCTGNTKVMRDA 285
               +R+ A K GA   ++   D K  E  +  L  ++  G   D TFDC+G +     +
Sbjct: 218 PAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSGISVTFESS 275

Query: 286 LEACHKGWGQSIIIGV 301
           ++ C    G +I + V
Sbjct: 276 IK-CLTFRGTAINVAV 290

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/308 (21%), Positives = 113/308 (36%), Gaps = 29/308 (9%)

Query: 37  EVRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXXXXXXTN-VKPGDHV-VP 94
           ++ +KI    +C +D +  SG   +   P I+               T+ VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 95  LYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYT 154
                C +CK C++G  + C     T         ++ + +G       ++    +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQTY--------STPYEDG-------YVSKGGYADYV 139

Query: 155 XXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQG 214
                         P      L CG  T +   ++      G  VA+ G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 215 AKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFD 274
           AKA  A  +  +    +K+E A K GA  FI  K +    E             LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 275 CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRS 333
           C G+ T +  + L       G+ + I +    + +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEELK 308

Query: 334 EMGGLVRD 341
           ++  LV +
Sbjct: 309 QLLKLVSE 316

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 194 QEGDTVAVFGA-GTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK 252
           Q G+ V V+ A G VG  ++Q   AR+  R+I V   D K + A   GA   IN      
Sbjct: 147 QVGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSR--- 202

Query: 253 EGETIVARLIEMTDG-GLDHTFDCTGN 278
             E IVA+++E TDG G+  ++D  G 
Sbjct: 203 --EDIVAKVLEFTDGEGVGASYDSVGK 227

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 69/318 (21%), Positives = 109/318 (34%), Gaps = 48/318 (15%)

Query: 27  KVTVDPPK---AHEVRIKIVNSAICHTDAYTLSGSDPEGLFPC----------ILXXXXX 73
           K+T   PK   AH+V I++    IC ++ ++L          C          ++     
Sbjct: 24  KLTSYEPKNFEAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVV 83

Query: 74  XXXXXXXXXXTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSR 132
                     T    GD V +      C +C  C SG    C     T          SR
Sbjct: 84  GKVVAVGSNVTLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSR 135

Query: 133 FRNGKGETLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTAD 192
           + +G       ++    ++ +               P E V  L CG  T Y    +  +
Sbjct: 136 YADG-------YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIE 188

Query: 193 VQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK 252
             +   VA+ G G +G   +  +KA  A  +       +K+E A K GA  FI       
Sbjct: 189 GVKDPKVAIIGIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFI------A 241

Query: 253 EGETIVARLIEMTDGGLDHTFDCTGN-----TKVMRDALEACHKGWGQSIIIGVAAAGQE 307
            GE       E  + GL+ TFD   N     T +  + L  C K     I +G+    ++
Sbjct: 242 TGE-------EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDED 294

Query: 308 ISTRPFQLVTGRVWKGSA 325
              +PF   +     GS+
Sbjct: 295 FKVKPFSFFSNGCCIGSS 312

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 61/152 (40%), Gaps = 19/152 (12%)

Query: 169 PLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDI 228
           P E V  L CG  T +    +    ++   VA+ G G +G   +  +KA  A  +  V  
Sbjct: 163 PSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA-EVSAVSR 221

Query: 229 NDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFD----CTGNTKVMR- 283
             +KR+ A K GA  FI             A      + GLD TFD    C  +T  +  
Sbjct: 222 GYSKRDDALKMGADHFI-------------ATSEPNWNAGLDDTFDLILNCASSTSSLDL 268

Query: 284 DALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
           +AL  C K     + +G+    ++   +PF  
Sbjct: 269 NALLPCLKVNCNFVSVGLPHIDEDFKVKPFSF 300

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 1/101 (0%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AV+ +  + G +V + G G +GL  +        + ++V +    +R+ A K GA  + +
Sbjct: 181 AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVY-D 239

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALE 287
           P T   +      R I     G D+TFDC+GN   ++ A+E
Sbjct: 240 PMTRDHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIE 280

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 82/186 (44%), Gaps = 12/186 (6%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           A+  A  + G +V + G G +GL  +        + IIV +    +R++A K GA  + +
Sbjct: 181 AINIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-D 239

Query: 247 PKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQ 306
           P     E      R +     G D+ FDC+G    ++ ++E C    G ++ + + A  +
Sbjct: 240 PLQCSHEQSIPNLRKMAPGADGFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNK 298

Query: 307 EISTRPFQLVTG-RVWKGSAFGGIKGRSEMGGLVRDYLNGTL---KVQEFVTHKRPFEEI 362
            ++  P  +    +++ GS         E   ++  + +G++   K +  +T K   E+ 
Sbjct: 299 AVNFYPMDITKQEKIYTGSMCYTYHDFEE---VIEAFGDGSIDAEKARHMITSKVRLEQ- 354

Query: 363 NSGFED 368
             G+ED
Sbjct: 355 --GYED 358

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 61/141 (43%), Gaps = 9/141 (6%)

Query: 140 TLYHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADV----QE 195
           T Y  +  STF EYT               L+    +G  + T   A     +V    +E
Sbjct: 137 TTYRDLRTSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEE 196

Query: 196 GDTVAVFGAGT-VGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEG 254
             ++ ++G  T VG+ VVQ AK+   ++II +  +    ++    GAT  I+ +   ++ 
Sbjct: 197 KKSIVIWGGSTGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHRE---EKT 252

Query: 255 ETIVARLIEMTDGGLDHTFDC 275
           E IV  + ++   G+ H  D 
Sbjct: 253 EDIVNEIKKICPNGVSHGVDL 273

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 90/360 (25%), Positives = 129/360 (35%), Gaps = 47/360 (13%)

Query: 26  EKVTVDPPKA--HEVRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXXXXX- 82
           +KV  DP K   H++ IK+    +C +D +  SG+  +   P ++               
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 83  XTNVKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETL 141
            + +K GD V V      C  C+ C +     C     T G+   PDG S     KG   
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDGYS----SKG--- 135

Query: 142 YHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKT--ADVQEGDTV 199
                   +++Y               P      L CG  T Y   V+      ++   V
Sbjct: 136 -------GYADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIV 188

Query: 200 AVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVA 259
            + G G  GL     AKA  A  +  +    AK+E A K GA  FI  K +   G     
Sbjct: 189 GIGGIGHQGLLF---AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEPDWGTKYFD 244

Query: 260 --RLIEMTDGGL-DHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLV 316
              LI +    L D  F+   NT           K  G  + I V    + +S +PF L 
Sbjct: 245 TFDLIVVCASSLTDVDFNTVPNTM----------KIGGSIVSISVPEQNETLSLKPFGL- 293

Query: 317 TGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE--INSGFEDLHHGDC 374
            G     SA G I   SEM  L++      +K+        P  E  +   FE +  GDC
Sbjct: 294 KGVSISNSALGSI---SEMRDLLKLVSENNIKLW---VETIPIGEKGVKEAFERMDKGDC 347

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 31.6 bits (70), Expect = 0.41,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFI 245
           AV+   V+ GD V V     +GL V    +     +++++   D+K++ + +FG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 187 AVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFIN 246
           AVK A  ++G +  + G G +GL  +   K      I++ +    +RE+A K GA  +  
Sbjct: 181 AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVYDP 240

Query: 247 PKTDLKEGETIVARLIEM--TDGGLDHTFDCTGNTKVMRDALEAC 289
                 E    V  L EM     G D+TFDC+G    +  A+E C
Sbjct: 241 TGVPFDES---VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 124/340 (36%), Gaps = 32/340 (9%)

Query: 36  HEVRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXXXXXXTNVKPGDHV-VP 94
           ++V +KI    +C +D +T SG   E   P ++                 +K GD V + 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 95  LYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYT 154
                C +C  C S     C     T  K    D T  + N KG           +++Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGY-NSKG----------GYADYI 142

Query: 155 XXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQG 214
                         P      L CG  T +   ++      G  V + G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 215 AKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFD 274
           AKA  A     +  + AK+E A K GA  FI      KE      +  +      D    
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFIA----TKEEPDWATKYFDT----FDLIVV 252

Query: 275 CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRS 333
           C+ + T +  + +    K  G+ + I V    + ++ +PF L+ G     SA GGI    
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIK 311

Query: 334 EMGGLVRDYLNGTLKVQEFVTHKRPFEEINSGFEDLHHGD 373
           +M  LV    N  + V+     ++  +E+   FE +  GD
Sbjct: 312 QMLDLVSKK-NLKIWVETIPISEKGVKEV---FERMEKGD 347

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 107/295 (36%), Gaps = 30/295 (10%)

Query: 26  EKVTVDPPKAHE--VRIKIVNSAICHTDAYTLSGSDPEGLFPCILXXXXXXXXXXXXXXX 83
           +KV  +P   ++  + IKI    +C +D +  SG+  +   P ++               
Sbjct: 22  KKVQFEPKTFYDNDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKC 81

Query: 84  TN-VKPGDHV-VPLYTAECQQCKFCVSGKTNLCGAVRATQGKGVMPDGTSRFRNGKGETL 141
           T+ +K GD V V      C  C  C +     C  V  T G    PDG     NGKG   
Sbjct: 82  TSGMKVGDRVGVGAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDGY----NGKG--- 133

Query: 142 YHFMGCSTFSEYTXXXXXXXXXXXXXXPLETVCLLGCGVTTGYGAAVKTADVQEGDTVAV 201
                   ++ Y               P      L CG  T Y   ++      G  V +
Sbjct: 134 -------GYANYIRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGI 185

Query: 202 FGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARL 261
            G G +G   +  AK+  A  +  +  +DAK+E A K GA  FI  K +   G+      
Sbjct: 186 LGIGGIGHMGIIFAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDT- 243

Query: 262 IEMTDGGLDHTFDCTGNTK-VMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQL 315
                  LD    C G+ K V  D L       G+ + I +  A +++    F L
Sbjct: 244 -------LDLIVICAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL 291

>Ecym_5311 Chr5 complement(631236..632099) [864 bp, 287 aa] {ON}
           similar to Ashbya gossypii AER015C
          Length = 287

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 8/92 (8%)

Query: 222 RIIVVDINDAKREWASKFGATDFINPKTD-LKEGETIVARLIEMTDGGLDHTFDCTGNTK 280
           ++IV+D+ND     A K    + +      L        R+ ++ DG  ++ F  +G  K
Sbjct: 155 KLIVIDVNDPL---APKLNDIEDVEKHLPGLLRATNEWFRIYKIPDGKPENQFAFSGEAK 211

Query: 281 VMRDALEA---CHKGWGQSIIIGVAAAGQEIS 309
             + ALE    CH+ W Q +I G AA  ++I 
Sbjct: 212 NRKYALEVVRECHEAWKQ-LICGKAADSKKID 242

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 221 SRIIVVDINDAKREWASKFGAT-DFINPKTDLKEGETIVARLIEMTDG-GLDHTFDCTG 277
           S +I VD+ D K + A  FGAT  F + K  + E + +   L ++  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 72/175 (41%), Gaps = 24/175 (13%)

Query: 140 TLYHFMGCSTFSEYTXXXXXXXXXX----------XXXXPLETVCLLGCGVTTGYGAAVK 189
           T Y  +  STF EYT                         LE    +G G+ T  G+A+ 
Sbjct: 136 TSYRDLETSTFQEYTVFDSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAIS 194

Query: 190 T---------ADVQE-GDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKF 239
           +         AD Q+ G+ V   G+ +VGL V+Q AKA      IVV      +E+  + 
Sbjct: 195 SLVDLSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLEL 254

Query: 240 GATDFINPKTDLKE-GETIVARLIEMTDGGLDHTFDCTGN--TKVMRDALEACHK 291
           GA+  I+     +E  + I++   E  D G+D     T    TK++++  E   K
Sbjct: 255 GASCIIDRHQSEEEILDDILSHCPEGIDFGIDVISKETATLLTKILQNNNENVKK 309

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 215 AKARNASRIIVVDINDAKREWASKFGATDFINPKTDLKEGETIVARLIEMTDGGLDHTFD 274
           AKA  A  +  +  ++AK+E + K GA  +I  K +   GE                TFD
Sbjct: 199 AKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPNWGEKYF------------DTFD 245

Query: 275 ----CTGN-TKVMRDALEACHKGWGQSIIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGI 329
               C  + T V  D +    K  G+ + I +    Q ++ +PF L+ G     SA G I
Sbjct: 246 LIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GVSIANSALGSI 304

Query: 330 KGRSEMGGLVRD 341
           K   ++  LV +
Sbjct: 305 KEIEQLLKLVSE 316

>KAFR0B00110 Chr2 (8533..9777) [1245 bp, 414 aa] {ON} 
          Length = 414

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 50/120 (41%), Gaps = 9/120 (7%)

Query: 194 QEGDTVAVFGAGT-VGLSVVQGAKARNASRIIVVDINDAKREWASKFGATDFINPKTDLK 252
           Q    + ++G  T VG +++Q  +  N    IVV  +    +   K+GA D      D  
Sbjct: 210 QNSFPILIWGGTTAVGQALIQLIRTFNGYSKIVVTASKKNEKLLKKYGADDVF----DYH 265

Query: 253 EGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAAAGQEISTRP 312
           + E I     + TD    H  DC  + + +    E C    G++ ++ +    Q+ + RP
Sbjct: 266 DPEVIAKIKAKYTD--FRHLIDCVSSKETIHQVYE-CSSDNGEATLLNLLMLSQD-AIRP 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,517,507
Number of extensions: 1329781
Number of successful extensions: 2779
Number of sequences better than 10.0: 168
Number of HSP's gapped: 2753
Number of HSP's successfully gapped: 173
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)