Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL147W7.351ON24624611811e-166
Ecym_47227.351ON2532417165e-95
SAKL0F11396g7.351ON2542476827e-90
ZYRO0F11726g7.351ON2512516506e-85
KLLA0D12320g7.351ON2502506411e-83
KLTH0H01232g7.351ON2572506254e-81
Kwal_56.246447.351ON2582486184e-80
TDEL0C019707.351ON2602506161e-79
YLR201C (COQ9)7.351ON2602505978e-77
Suva_10.2967.351ON2602465873e-75
Kpol_530.307.351ON2602455812e-74
Smik_12.2607.351ON2602465742e-73
Skud_12.2657.351ON2602505717e-73
KNAG0B026207.351ON2652465641e-71
TBLA0E004507.351ON2792435521e-69
KAFR0L014807.351ON2642455404e-68
NDAI0E044707.351ON2642505301e-66
CAGL0A03949g7.351ON2682445162e-64
TPHA0F029807.351ON2642535152e-64
NCAS0E028707.351ON2612474919e-61
ABL024W2.450ON73445711.4
TPHA0F032908.647ON14816681.9
TDEL0C062001.81ON70051674.3
KLLA0C02299g1.81ON65851675.0
NDAI0B009705.80ON63655658.4
AEL213W5.80ON57142658.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL147W
         (246 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   459   e-166
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   280   5e-95
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   267   7e-90
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   254   6e-85
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   251   1e-83
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   245   4e-81
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   242   4e-80
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   241   1e-79
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   234   8e-77
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   230   3e-75
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   228   2e-74
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   225   2e-73
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   224   7e-73
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   221   1e-71
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   217   1e-69
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   212   4e-68
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   208   1e-66
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   203   2e-64
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   202   2e-64
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   193   9e-61
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    32   1.4  
TPHA0F03290 Chr6 complement(713719..714165) [447 bp, 148 aa] {ON...    31   1.9  
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...    30   4.3  
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...    30   5.0  
NDAI0B00970 Chr2 (224933..226843) [1911 bp, 636 aa] {ON} Anc_5.8...    30   8.4  
AEL213W Chr5 (232373..234088) [1716 bp, 571 aa] {ON} Syntenic ho...    30   8.6  

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  459 bits (1181), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 227/246 (92%)

Query: 1   MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAG 60
           MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAG
Sbjct: 1   MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAG 60

Query: 61  DLGYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQR 120
           DLGYG                   SAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQR
Sbjct: 61  DLGYGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQR 120

Query: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180
           VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA
Sbjct: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180

Query: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240
           VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK
Sbjct: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240

Query: 241 SQLTRG 246
           SQLTRG
Sbjct: 241 SQLTRG 246

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  280 bits (716), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 134/241 (55%), Positives = 173/241 (71%), Gaps = 1/241 (0%)

Query: 6   RRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYG 65
           RR YH N+ E+AVGN LRPL Y + SPQYKVL  ALE +VP  GF + AIV AA +LGY 
Sbjct: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73

Query: 66  XXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQRVEADR 125
                              ++V ELVKFHLVTKR  L +   +G  ++E+LFL+R+EA++
Sbjct: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQ-EGTKTLEELFLKRLEANK 132

Query: 126 PLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAVAMAY 185
            L   L ++LSIL++PG+FLVNT +PELF+L+DD+IYYS EKD  DLAWYSKR AV+MAY
Sbjct: 133 SLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKRLAVSMAY 192

Query: 186 VSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKSQLTR 245
           +ST LFMA+D SP  + T+ FA+ R+ Q+D +GTAYNN+EEFAW+QLL  +NL +SQL R
Sbjct: 193 ISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNLARSQLVR 252

Query: 246 G 246
           G
Sbjct: 253 G 253

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  267 bits (682), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 126/247 (51%), Positives = 167/247 (67%), Gaps = 3/247 (1%)

Query: 3   RVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDL 62
           ++ RR YHPN LEHA    L PL Y +DSPQ+K+L  AL+  VP  GFNERA+  +  DL
Sbjct: 8   KIARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDL 67

Query: 63  GYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNV---SMEQLFLQ 119
           GY                     AVLEL+KFHLV+KR +L D  A G +   S+E LFL+
Sbjct: 68  GYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVADGTLESPSLENLFLK 127

Query: 120 RVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRA 179
           R+E ++P+A  L+QLLS L+LPG FL   A+PEL RLSDD++Y+S E DH D AWYSKR 
Sbjct: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187

Query: 180 AVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLV 239
           A++ AYVS+ LFMA+D+S   ++T+ FA+ +L+ +  LG AYNNVEE+AWY LL +++L 
Sbjct: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247

Query: 240 KSQLTRG 246
           KSQ+TR 
Sbjct: 248 KSQMTRS 254

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  254 bits (650), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 132/251 (52%), Positives = 167/251 (66%), Gaps = 5/251 (1%)

Query: 1   MF-RVCR---RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIV 56
           MF R+C+   R YHP+  EH   +RL PL Y  DSPQY VL  AL+  VPV+GFNERAIV
Sbjct: 1   MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV 60

Query: 57  RAAGDLGYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALA-DAAAQGNVSMEQ 115
            +   L Y                     AV+ELVKFHLV KR+ L+ D +++   S+E 
Sbjct: 61  HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLSSEEKPSLED 120

Query: 116 LFLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWY 175
           LF++R+E + P+AG L+QLLS +S+PG F V+TA+PEL RLSDDLIYYS EKDH D AWY
Sbjct: 121 LFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWY 180

Query: 176 SKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMA 235
           SKR  ++ AYVS+ LFMA+D+S   EET  FAR +LQ+   LG  YNN EE+ WY LL +
Sbjct: 181 SKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNS 240

Query: 236 MNLVKSQLTRG 246
           +NL KSQ+ RG
Sbjct: 241 INLAKSQMARG 251

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  251 bits (641), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 167/250 (66%), Gaps = 4/250 (1%)

Query: 1   MFRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAG 60
           M RV  RLYHPN LEHA+   ++PL Y  DS Q+KVL  AL  HVP  GFNERAIV++  
Sbjct: 1   MSRVFTRLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLN 60

Query: 61  DLGYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVAL-ADAAAQGNV---SMEQL 116
           +LG G                    +VLELVKFHLV+KR  L  D     +     ++ L
Sbjct: 61  ELGMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLDSDKPLPDLKTL 120

Query: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176
           FLQR++ +  +A  L+QLLSI+S+PGEFL +TA+ EL +L+DD+I+YS E+DH D AWYS
Sbjct: 121 FLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYS 180

Query: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236
           KR A++ AYVS+ LFMA+D+S   +ET+ FA+ +L +V  LG+ YNN EE+ W+ LL ++
Sbjct: 181 KRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSI 240

Query: 237 NLVKSQLTRG 246
           NL KSQ+TRG
Sbjct: 241 NLAKSQITRG 250

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  245 bits (625), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 156/250 (62%), Gaps = 7/250 (2%)

Query: 4   VCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLG 63
           + RRLYHP+ LEH + +   PL Y   S Q+KVL+ AL  HVP  GFNERA+V +  DL 
Sbjct: 8   LARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLD 67

Query: 64  YGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNVS-------MEQL 116
            G                    AVLEL+KFHLVTKR AL         S       +E L
Sbjct: 68  LGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETL 127

Query: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176
           F +R+E ++P+A  LTQLLS LS+PGEFLV TA+PEL RLSDD++Y+S E D  D AWYS
Sbjct: 128 FHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYS 187

Query: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236
           KR A++ A+VS+ LFMA+DRS    +T  FA  +L  V  LG  YNN EE+ WY LLM++
Sbjct: 188 KRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSV 247

Query: 237 NLVKSQLTRG 246
           NL KSQLTR 
Sbjct: 248 NLAKSQLTRS 257

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  242 bits (618), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 159/248 (64%), Gaps = 7/248 (2%)

Query: 6   RRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYG 65
           RR Y PN LE+ +  +L PLAY   S Q+KVL  AL+ HVP  GFNERA+V +  DLG G
Sbjct: 11  RRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLG 70

Query: 66  XXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALAD-------AAAQGNVSMEQLFL 118
                               AVLELVKFHLVTKR AL         A+     ++E LF 
Sbjct: 71  SQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFH 130

Query: 119 QRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKR 178
           +R+E + P+A  +TQLL+IL++PGEFL+ +A+PEL RLSDD+IY+S E D  D AWYSKR
Sbjct: 131 KRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKR 190

Query: 179 AAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNL 238
           AA++ A+VS+ LFMA+D+SP   +T  FA  +L  V  LG  Y N EE+ WY LLM++NL
Sbjct: 191 AAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNL 250

Query: 239 VKSQLTRG 246
            KSQ+TR 
Sbjct: 251 AKSQITRS 258

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  241 bits (616), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 127/250 (50%), Positives = 159/250 (63%), Gaps = 6/250 (2%)

Query: 3   RVCRRLYHPNTLEHAVG-NRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGD 61
           R+  R Y P   E+    N   PL Y +DSPQYKVL   L   VP+ GFNERAIV +  +
Sbjct: 11  RIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAIVNSLNE 70

Query: 62  LGYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNV-----SMEQL 116
           LGY                     A++EL+KFHLV KR+ L +  +         S+E L
Sbjct: 71  LGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQLPSLEHL 130

Query: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176
            ++R+E + P+A  L+QLLS LS+PG FLV+ +MPEL RLSDD+IY+S EKDH D AWYS
Sbjct: 131 VIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDHNDFAWYS 190

Query: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236
           KR AV+ AYVS+ LFMA+DRSP  +ET  FAR +L +V +LG  YNN EEFAWY LL  +
Sbjct: 191 KRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAWYTLLSTI 250

Query: 237 NLVKSQLTRG 246
           NLVKSQL RG
Sbjct: 251 NLVKSQLARG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  234 bits (597), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 118/250 (47%), Positives = 159/250 (63%), Gaps = 8/250 (3%)

Query: 5   CR--RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDL 62
           C+  RLYH N +EH     ++PL Y ++SPQYKVL  AL+  VP  GF+ER+IV +  +L
Sbjct: 11  CKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNEL 70

Query: 63  GYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALA-----DAAAQGNV-SMEQL 116
           GY                    +AV+EL+KF LV KR  L      D   Q  + S+E L
Sbjct: 71  GYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHL 130

Query: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176
            L+R+E D+P+ G L++L+S L++P  FL  TA+PEL RLSDD+IY+S EKDH D AWY+
Sbjct: 131 LLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYA 190

Query: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236
           KR AV+  Y+ + LFMA+D+S   +ET  FA+ +L +V  LG  YNN EEFAWY L+  +
Sbjct: 191 KRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTV 250

Query: 237 NLVKSQLTRG 246
           NL+KSQL RG
Sbjct: 251 NLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  230 bits (587), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 152/246 (61%), Gaps = 6/246 (2%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           RLYH N +EH     ++PLAY + SPQYKVL  AL+ +VP  GF ER+IV +   LGY  
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 67  XXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNV------SMEQLFLQR 120
                             +AV+EL+KF LV KR  L +             S+E L L+R
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLLLKR 134

Query: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180
           +E D+P+  QLT L+S L++P  FL  TA+PEL RLSDD+IY+S EKDH D AWY+KR A
Sbjct: 135 LEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240
           V+  Y+ + LFMA+D+S    ET  FA+ +L +V  LG  YNN EEFAWY L+  +NLVK
Sbjct: 195 VSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 241 SQLTRG 246
           SQL RG
Sbjct: 255 SQLARG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  228 bits (581), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 156/245 (63%), Gaps = 5/245 (2%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           R YHPN  E+     L PL Y +DS QYK+L  +L+  VP  GFNERAIV +   LGY  
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 67  XXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALA-----DAAAQGNVSMEQLFLQRV 121
                             +A++EL+KF+LV KR  L+     D   +   S+E L ++R+
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRL 135

Query: 122 EADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAV 181
           + D P+   L+QL++ LS+PG FL +T++PEL RL+DD+IY+S EKDHPD AWY+KR  V
Sbjct: 136 KMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGV 195

Query: 182 AMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKS 241
           + AY+S+ LFMA+DRSP   +T  FA+ +L+++  LG  YNN EE+AWY L+ ++N+ KS
Sbjct: 196 STAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKS 255

Query: 242 QLTRG 246
           +  RG
Sbjct: 256 KAARG 260

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  225 bits (574), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 157/246 (63%), Gaps = 6/246 (2%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           RLYHPN +EH   + ++PL Y ++SPQYKVL  ALE +VP  GF+ER+IV +  +LGY  
Sbjct: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYPS 74

Query: 67  XXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNVSMEQL------FLQR 120
                             +AV+EL+KF LV KR  L +A         +L       L+R
Sbjct: 75  SMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSLEHLLLRR 134

Query: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180
           +E D+P+ G L++L+S L++P  FL  TA+PEL RLSDD+IY+S EKDH D AWY+KR A
Sbjct: 135 LEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240
           V+  Y+ + LFMA+D+S   ++T  FA+ +L +V  LG  YNN EEFAWY L+  +NLVK
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 241 SQLTRG 246
           SQL RG
Sbjct: 255 SQLVRG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  224 bits (571), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 117/250 (46%), Positives = 155/250 (62%), Gaps = 8/250 (3%)

Query: 5   CR--RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDL 62
           C+  RLYH N +EH     ++PL Y + SPQYKVL  AL  +VP  GF+ER+IV +   L
Sbjct: 11  CKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKL 70

Query: 63  GYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALA-----DAAAQGNV-SMEQL 116
           GY                    +AV+ELVKF LV KR  L      D  ++  + S+E L
Sbjct: 71  GYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHL 130

Query: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176
            L+R+E D+ + GQL  L+S L++P   L  TA+PEL RLSDD+IY+S E+DH D AWY+
Sbjct: 131 LLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYA 190

Query: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236
           KR AV+  Y+ + LFMA+D+S   +ET  FA+ +L +V  LG  YNN EEFAWY L+  +
Sbjct: 191 KRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTV 250

Query: 237 NLVKSQLTRG 246
           NLVKSQL RG
Sbjct: 251 NLVKSQLARG 260

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  221 bits (564), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 155/246 (63%), Gaps = 7/246 (2%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           RLYHPN +E+A    + PL Y  DSPQ ++L   L+  VP  GF ERA++++   +GY  
Sbjct: 19  RLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAVGYDS 78

Query: 67  XXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNV-------SMEQLFLQ 119
                              AV+ELVKF+LV KR AL ++ A   +       S+E L ++
Sbjct: 79  SMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEHLLVK 138

Query: 120 RVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRA 179
           R++ D PL+ QL  L + L+LP +F+VN A+PELFRLSDD+IY+S EKDH D AWYSKR 
Sbjct: 139 RLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWYSKRL 198

Query: 180 AVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLV 239
            V++AY ++ LFMA+D S   ++T+ FAR +L ++ +LG  YNNVEE+AWY ++  +N  
Sbjct: 199 GVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTTVNRA 258

Query: 240 KSQLTR 245
           K+  +R
Sbjct: 259 KAGFSR 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  217 bits (552), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 155/243 (63%), Gaps = 3/243 (1%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           R Y+  + +    + L PL Y +DS QY++L+ A++  VP  GF ERAI+ +   LGY  
Sbjct: 37  RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNS 96

Query: 67  XXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALA---DAAAQGNVSMEQLFLQRVEA 123
                              AVLEL+KF+LV+KR+ L+   D   +   S+E L L+R++ 
Sbjct: 97  SMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETKDLPSLEYLLLKRLQM 156

Query: 124 DRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAVAM 183
           D+ +  +L ++++ LS+PG FL  T++PELFRLSDD+IY+S EKDH D+AWYSKR AV+ 
Sbjct: 157 DKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRLAVST 216

Query: 184 AYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKSQL 243
            Y+++ +FMA+D S    +TL FA+ +L +V +LG  YNN EEF W+ L+ ++N+VKSQL
Sbjct: 217 TYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIVKSQL 276

Query: 244 TRG 246
            R 
Sbjct: 277 ARS 279

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  212 bits (540), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 154/245 (62%), Gaps = 1/245 (0%)

Query: 2   FRVCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGD 61
           F+  RRLYHP + E+     + PL Y  DS Q K+L  +L+ +VP  GFNE++I+++  D
Sbjct: 19  FKCLRRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSIND 78

Query: 62  LGYGXXXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALADAAAQGNVSMEQLFLQRV 121
           LGY                     AVLEL+K++LV+KR+ L         +  +  L + 
Sbjct: 79  LGYSSSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELLLKR 138

Query: 122 EA-DRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180
              D P++ QL  L + L+ PG+F+ + ++PELF+L+DD+I++S EKDH D+AWYSKR A
Sbjct: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198

Query: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240
           V+MAYV++ +FM +D S   + T+ FA  ++ +V +LG  YNNVEE+AW+ L+ ++NLVK
Sbjct: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258

Query: 241 SQLTR 245
           SQ +R
Sbjct: 259 SQFSR 263

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  208 bits (530), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 149/250 (59%), Gaps = 8/250 (3%)

Query: 5   CRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGY 64
             R +H NTLE+A    L PL Y +DS QYK+L  AL   VP  GF + AI  +  +L  
Sbjct: 15  INRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNELDL 74

Query: 65  GXXXXXXXXXXXXXXXXXXXS-AVLELVKFHLVTKRVALAD-------AAAQGNVSMEQL 116
                               S AV+EL+KF LV+KR  L +        A     S+E L
Sbjct: 75  SSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLETL 134

Query: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176
            ++R++ D+PL  QL+ L + L +P   L N A+PELF LSDDLIY+S EKDH D+AWY+
Sbjct: 135 LIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAWYA 194

Query: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236
           KR  V+ AYVS+ L+M ++     ++T+ FA+ +L ++ +LG  YNN EE+AWY L+++M
Sbjct: 195 KRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMVSM 254

Query: 237 NLVKSQLTRG 246
           NLVK++L RG
Sbjct: 255 NLVKARLARG 264

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  203 bits (516), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 145/244 (59%), Gaps = 5/244 (2%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           R YHP + E+       PL Y  +SP++K+L   +E  VP  GF E+AIV +   +    
Sbjct: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83

Query: 67  XXXXXXXXXXXXXXXXXXSAVLELVKFHLVTKRVALAD-----AAAQGNVSMEQLFLQRV 121
                              AV+EL+KF LV KR  + +     A A    S+E L L+R+
Sbjct: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLKRL 143

Query: 122 EADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAV 181
           + D P+A  LTQ+ + L +P  F+ N ++PEL RL+DD+IYYS EKDH D AWY+KRAA+
Sbjct: 144 KMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203

Query: 182 AMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKS 241
           A  Y+++  FMA+D+S    ET+ FA+ +L +V +LG  YNNVEEF W+ L+ A+NL KS
Sbjct: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263

Query: 242 QLTR 245
           Q+ R
Sbjct: 264 QMAR 267

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  202 bits (515), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 156/253 (61%), Gaps = 12/253 (4%)

Query: 4   VCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLG 63
           V  R +HP T E+ + N+L P  Y +DSPQ+K+L  A++  V   GF+ERAI+ A  +L 
Sbjct: 14  VNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAIIEAMKELK 73

Query: 64  YGXXXXXXXXXXXXXXXXXXXSA--VLELVKFHLVTKRVALADAAAQGNVSMEQLFL--- 118
                                S+  V+EL+KF+LV KR  + +      ++M+Q  L   
Sbjct: 74  IENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDP--LTMQQEELPSL 131

Query: 119 -----QRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLA 173
                +R+E D P+   ++  +S L +PG FL+++A+PEL RL+DD+IY+S EKDH D A
Sbjct: 132 ESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEKDHHDFA 191

Query: 174 WYSKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLL 233
           WYSKR  V+ AY+S+ LFMA+D S   +ETL FA+ +L++V  LG  YNN EE+AWY LL
Sbjct: 192 WYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEYAWYVLL 251

Query: 234 MAMNLVKSQLTRG 246
            ++N+VKS+++R 
Sbjct: 252 NSVNMVKSRMSRA 264

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  193 bits (491), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 146/247 (59%), Gaps = 7/247 (2%)

Query: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGX 66
           R YHP+  E+     L PL Y ++S QYK+L  AL   VP  GF E+AI  +  +LG+  
Sbjct: 15  RSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNELGFSS 74

Query: 67  XXXXXXXXXXXXXXXXXXS-AVLELVKFHLVTKRVALADAAAQGNV------SMEQLFLQ 119
                             S AV+EL+KF LV+KR  L +             S+E L L+
Sbjct: 75  SLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTTPKNELPSLESLLLK 134

Query: 120 RVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRA 179
           R+E D+ +  Q+  L + L+ P  FL + A+PEL RLSDD+IY+S EKDH D+AWY+KR 
Sbjct: 135 RLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAWYTKRL 194

Query: 180 AVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLV 239
            V+ AYVS+ L+MA+D S   E+TL FA+ +L ++  LG  YNN EE+AWY  +++ NLV
Sbjct: 195 GVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMVSTNLV 254

Query: 240 KSQLTRG 246
           +++L R 
Sbjct: 255 RARLARS 261

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%)

Query: 154 FRLSDDLIYYSGEKDHPDLAWYSKRAAVAMAYVSTNLFMARDRSP 198
           F   DD  ++SG  DH    W      VA A+   +L MA D SP
Sbjct: 262 FHPHDDRFFFSGCLDHTVRTWSILEGEVAEAFNCGDLIMALDVSP 306

>TPHA0F03290 Chr6 complement(713719..714165) [447 bp, 148 aa] {ON}
          Anc_8.647 YPL135W
          Length = 148

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 1  MFRVCRRLYHPNTLEH 16
          +F + +RLYHPN +EH
Sbjct: 11 LFTITKRLYHPNVIEH 26

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 176 SKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQ-QVDSLGTAYNNVE 225
           S+R +V ++ +ST L  + D+   LEE L+ A+R +Q Q +SL  +YN+++
Sbjct: 8   SRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLD-SYNDLK 57

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%)

Query: 176 SKRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEE 226
           SKR ++ +  +ST L  + D+   LEE L  A++ +    ++  +YN +++
Sbjct: 7   SKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQ 57

>NDAI0B00970 Chr2 (224933..226843) [1911 bp, 636 aa] {ON} Anc_5.80
           YGR246C
          Length = 636

 Score = 29.6 bits (65), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 191 FMARDRSPAL---EETLHFARRRLQQVDSLGT--AYNNVEEFAWYQLLMAMNLVK 240
           FM+   S AL   E TL+ ARR+L+ V    +   Y     F WY+L +A N V+
Sbjct: 67  FMSHGGSSALDSRENTLNNARRKLRAVSHALSIPEYITDAAFQWYKLALAYNFVQ 121

>AEL213W Chr5 (232373..234088) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR246C (BRF1)
          Length = 571

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 201 EETLHFARRRLQQVDSLGTAYNNVEE--FAWYQLLMAMNLVK 240
           E TL+ ARR+LQ V         V E  F WYQL ++ N V+
Sbjct: 79  EATLNNARRKLQAVSHALQIPEYVREAAFQWYQLALSNNFVQ 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,263,554
Number of extensions: 695501
Number of successful extensions: 1511
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1495
Number of HSP's successfully gapped: 28
Length of query: 246
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 139
Effective length of database: 41,212,137
Effective search space: 5728487043
Effective search space used: 5728487043
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)