Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL146C7.352ON1071075227e-70
Ecym_47217.352ON1071074151e-53
KLLA0D12298g7.352ON1151073804e-48
KAFR0L014907.352ON1071033561e-44
Smik_12.2597.352ON1141033501e-43
TPHA0F029907.352ON1071033491e-43
SAKL0F11418g7.352ON1151063492e-43
TBLA0E004407.352ON1151033422e-42
NDAI0E044607.352ON1061043394e-42
YLR200W (YKE2)7.352ON1141033396e-42
Suva_10.2957.352ON1141033387e-42
ZYRO0F11748g7.352ON1091033388e-42
NCAS0E028607.352ON1051023352e-41
KNAG0B026107.352ON119993353e-41
Skud_12.2647.352ON1141013334e-41
TDEL0C019607.352ON1071023335e-41
Kpol_530.297.352ON1071023301e-40
Kwal_56.246487.352ON1131023232e-39
CAGL0A03971g7.352ON1061033212e-39
KLTH0H01210g7.352ON1131033152e-38
Smik_5.1107.139ON10592670.39
YEL003W (GIM4)7.139ON11191670.39
NDAI0A082507.139ON11397650.66
Suva_5.837.139ON11291650.73
KLLA0D13904g7.139ON11154650.80
TDEL0F045108.326ON74339660.96
NDAI0G044402.653ON170888661.0
ZYRO0F01166g2.591ON74847641.9
Kwal_YGOB_KLTH0E14146gna 1ON19540622.5
KAFR0L006407.139ON11152612.6
NCAS0I007907.139ON11251612.9
TBLA0D046107.186ON117451614.4
SAKL0F04906g7.139ON11368594.9
TPHA0H017305.421ON43230605.5
KAFR0H022408.326ON62338607.1
TDEL0H030207.139ON11151588.0
KLLA0B08800gna 2ON57051598.0
NCAS0C032408.326ON62050599.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL146C
         (107 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   205   7e-70
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   164   1e-53
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   150   4e-48
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   141   1e-44
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   139   1e-43
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   139   1e-43
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   139   2e-43
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   136   2e-42
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   135   4e-42
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   135   6e-42
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   134   7e-42
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   134   8e-42
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   133   2e-41
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   133   3e-41
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   132   4e-41
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   132   5e-41
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   131   1e-40
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   129   2e-39
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   128   2e-39
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   125   2e-38
Smik_5.110 Chr5 (152227..152541) [315 bp, 105 aa] {ON} YEL003W (...    30   0.39 
YEL003W Chr5 (148176..148194,148283..148599) [336 bp, 111 aa] {O...    30   0.39 
NDAI0A08250 Chr1 (1891840..1892181) [342 bp, 113 aa] {ON} Anc_7....    30   0.66 
Suva_5.83 Chr5 (123910..123931,124027..124343) [339 bp, 112 aa] ...    30   0.73 
KLLA0D13904g Chr4 complement(1195920..1196236,1196332..1196350) ...    30   0.80 
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    30   0.96 
NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa]...    30   1.0  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    29   1.9  
Kwal_YGOB_KLTH0E14146g s27 complement(1195778..1196296,1196300.....    28   2.5  
KAFR0L00640 Chr12 (120745..120763,120859..121175) [336 bp, 111 a...    28   2.6  
NCAS0I00790 Chr9 complement(141413..141729,141805..141826) [339 ...    28   2.9  
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    28   4.4  
SAKL0F04906g Chr6 complement(392819..393135,393197..393221) [342...    27   4.9  
TPHA0H01730 Chr8 (395984..397282) [1299 bp, 432 aa] {ON} Anc_5.4...    28   5.5  
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    28   7.1  
TDEL0H03020 Chr8 (499495..499513,499583..499899) [336 bp, 111 aa...    27   8.0  
KLLA0B08800g Chr2 complement(772732..774444) [1713 bp, 570 aa] {...    27   8.0  
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     27   9.1  

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  205 bits (522), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 107/107 (100%), Positives = 107/107 (100%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60
           MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP
Sbjct: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60

Query: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG
Sbjct: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  164 bits (415), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/107 (78%), Positives = 93/107 (86%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60
           MS EQVA KYTQLQGELE+L+VTRQKLETQLQENKIVNEELQ+L+ + QVYKLTGGVLLP
Sbjct: 1   MSVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLP 60

Query: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           VE EEA  NVSKRLEFI+GEI RCE NIK KQ+E+E AR  L+KLR 
Sbjct: 61  VEHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  150 bits (380), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 90/107 (84%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60
           MSAE+   KYT+LQGELEEL+V RQKLETQLQENKIV++E  +L+ +  VYKLTGGVLLP
Sbjct: 1   MSAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLP 60

Query: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           VEQ EA+GNV KRLEFIE EI+RCE NIK KQ+E+E AR+ L+KLR 
Sbjct: 61  VEQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  141 bits (356), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 84/103 (81%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
           ++A +Y +LQ ELEEL+V RQKLETQLQENKIVN+E ++L+ ETQVYKLTG VLLP+EQ+
Sbjct: 3   ELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQD 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           EA GNV KRLEFIE EI RCE NIK KQ E+E  R  LVKLR 
Sbjct: 63  EARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRS 105

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 79/103 (76%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
           ++ TKY  LQGELEE +V RQKLETQLQENKIVNEE   L+  T VYKLTG VLLPV+Q 
Sbjct: 3   ELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQS 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           EA GNV KRLEFIE EI RCE+NIK KQE++E  R  L+KL  
Sbjct: 63  EARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNN 105

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  139 bits (349), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
            VA KY  +QGELEEL++ RQKLETQLQENKIVN+E   L  +T +YKLTG V+LP+EQ 
Sbjct: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           EA+ NV KRLEFIE EI+RCE+NIK KQ+E++  R  L+K+RG
Sbjct: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRG 105

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  139 bits (349), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 89/106 (83%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60
           ++A++++ +YT +Q ELE+LV+ RQKLETQLQENKIV +E   L+ E+QVYKLTGGVLLP
Sbjct: 4   LNAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLP 63

Query: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLR 106
           VEQEEA+GNV KRL+FI+ EI RCE+NIK+KQ ++E  R  LV+LR
Sbjct: 64  VEQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLR 109

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  136 bits (342), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60
           MS+ ++ATKY   Q ELE  +VTRQKLETQLQENKIVN+E + L+ ET+V+KLTG VLLP
Sbjct: 1   MSSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLP 60

Query: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALV 103
           +EQ+EA  N+ KRLEFI+ EI RCE+NIK KQ EME  R+ L+
Sbjct: 61  IEQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM 103

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  135 bits (339), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 81/104 (77%)

Query: 3   AEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVE 62
           A  + +KY  LQGELE+L++ RQKLETQLQENKIV EE   L  E+QVYKLTG VLLPV+
Sbjct: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61

Query: 63  QEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLR 106
           QEEA  NV KRLEFI+ EI RCE NIK KQ+E++  R+ ++K+R
Sbjct: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMR 105

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  135 bits (339), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 79/103 (76%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
           ++  KY QLQ ELEE +V RQKLETQLQENKIVNEE   L+ +T VYKLTG VLLPVEQ 
Sbjct: 3   ELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQS 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           EA  NV KRLEFIE EI RCE+NI+ KQEE+E  R+ L+KL  
Sbjct: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNN 105

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  134 bits (338), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 79/103 (76%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
           ++  KY  LQ ELEE +V RQKLETQLQENKIVNEE   L+ +T VYKLTG VLLPVEQ 
Sbjct: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           EA GNV KRLEFIE EI+RCE+NI+ KQEE+E  R  LVKL  
Sbjct: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNN 105

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  134 bits (338), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (79%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
           ++A +Y +LQGELE  +V RQKLETQLQENKIV++E   L+ +++VYKLTG VLLPVEQ+
Sbjct: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           +A  NVSKRLEFI+ EI RCE NIK KQEE E  +A L+KLR 
Sbjct: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRS 105

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  133 bits (335), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 6   VATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEE 65
           +  +Y  LQ ELE  ++ RQKLETQLQENKIV +E + L  ET+VYKLTG VLLPVEQ+E
Sbjct: 4   LPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQDE 63

Query: 66  AEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           A  NV KRLEFI+ EI +CE+NIKQKQEE+E  RA ++K+RG
Sbjct: 64  ARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKMRG 105

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 67/99 (67%), Positives = 80/99 (80%)

Query: 7   ATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEEA 66
           A KY + Q  LEEL+V RQKLETQLQENKIV EE  AL+ +++VYKLTG VLLPV+Q+EA
Sbjct: 5   AAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVDQDEA 64

Query: 67  EGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKL 105
             NV KRLEFI GEI RCE+NIK+KQE +EG R+ L+KL
Sbjct: 65  RTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  132 bits (333), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 79/101 (78%)

Query: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64
           ++  +Y  LQ ELEE +V RQKLETQLQENKIVNEE   +  +T VYKLTG VLLPVEQ 
Sbjct: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62

Query: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKL 105
           EA GNV KRLEFIE EI+RCE+NI++KQ+E+E  R  L+KL
Sbjct: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKL 103

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  132 bits (333), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 79/102 (77%)

Query: 6   VATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEE 65
           +A  Y  LQ ELE LV+ RQKLETQLQENKIV+EE   L+ +TQVYKLTG VLLPVEQ E
Sbjct: 4   LAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQSE 63

Query: 66  AEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           A  NV+KRLEFI+ EI RCE N+K KQ+E E  RA L+KLRG
Sbjct: 64  ANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRG 105

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  131 bits (330), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 81/102 (79%)

Query: 6   VATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEE 65
           +A KY ++QGELEE++V R++LETQLQENKIVNEE + L+ +TQVYKLTG VLLPVEQ E
Sbjct: 4   LANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQFE 63

Query: 66  AEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107
           A  NV KRLEFIE EI++CE NIK KQ E+   R  L+K RG
Sbjct: 64  ARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRG 105

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 78/102 (76%)

Query: 2   SAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPV 61
           SA+++   YT  Q ELEELV  RQ+LETQLQENKIV +E  +L+ ETQVYKLTG VLLPV
Sbjct: 4   SAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPV 63

Query: 62  EQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALV 103
           EQ EA+ NVSKRLEFI  EI+RCE NIK KQ  +E  RA L+
Sbjct: 64  EQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELL 105

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  128 bits (321), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLP 60
           MSAE +  KY  LQ ELEELV  RQKLETQLQENKIVNEE   L+ +T VYKLTG VLLP
Sbjct: 1   MSAE-LGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLP 59

Query: 61  VEQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALV 103
           VE ++A+ NV KRLEFI  EI+RCE NI+ KQ+E+E  R  L+
Sbjct: 60  VEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  125 bits (315), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 77/103 (74%)

Query: 2   SAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPV 61
           SA+ +   Y   Q ELEELV+ RQKLETQLQENKIV +E   L+ ETQVYKLTG VLLPV
Sbjct: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63

Query: 62  EQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVK 104
           EQ EA+ NVSKRLEFI  EI RCE+NIK KQ  +E  RA L++
Sbjct: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106

>Smik_5.110 Chr5 (152227..152541) [315 bp, 105 aa] {ON} YEL003W
          (REAL)
          Length = 105

 Score = 30.4 bits (67), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 47/92 (51%)

Query: 8  TKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEEAE 67
          +KY + +  LE+L     +L     E+ IV + L+  +P  + Y++ GG L+  + + + 
Sbjct: 4  SKYNEYKQILEDLQTKIIELGHDKDEHTIVLKTLKDAEPTRKCYRMIGGALVESDVQTSL 63

Query: 68 GNVSKRLEFIEGEIRRCEQNIKQKQEEMEGAR 99
            +  + E IEG I + ++ + Q  +E E  +
Sbjct: 64 PILETKKENIEGTINKMKETLIQTAQEFEKWK 95

>YEL003W Chr5 (148176..148194,148283..148599) [336 bp, 111 aa] {ON} 
           GIM4Subunit of the heterohexameric cochaperone prefoldin
           complex which binds specifically to cytosolic chaperonin
           and transfers target proteins to it
          Length = 111

 Score = 30.4 bits (67), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%)

Query: 9   KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEEAEG 68
           KY + +  LEEL     +L     E+ IV + L+  +P  + Y++ GG L+  + + +  
Sbjct: 11  KYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGALVESDVQTSLP 70

Query: 69  NVSKRLEFIEGEIRRCEQNIKQKQEEMEGAR 99
            +  + E IEG I + ++ + Q  +E E  +
Sbjct: 71  ILETKKENIEGTISKMKETLIQTAKEFEKWK 101

>NDAI0A08250 Chr1 (1891840..1892181) [342 bp, 113 aa] {ON} Anc_7.139
           YEL003W
          Length = 113

 Score = 29.6 bits (65), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 14/97 (14%)

Query: 9   KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEEAEG 68
           KY + +  LE+L     +L     E+ IV + L+   PE + Y++ GG L+       E 
Sbjct: 13  KYNEYKQTLEQLQSKVIELGNDKDEHDIVLDTLKTADPERKCYRMIGGALV-------ES 65

Query: 69  NVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKL 105
           NV   L  ++ +     QN+   Q+ +   R+ L+K+
Sbjct: 66  NVKTTLPILQTK----RQNL---QDAVNTMRSELIKI 95

>Suva_5.83 Chr5 (123910..123931,124027..124343) [339 bp, 112 aa]
           {ON} YEL003W (REAL)
          Length = 112

 Score = 29.6 bits (65), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 45/91 (49%)

Query: 9   KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQEEAEG 68
           KY + +  LEEL     +L     E+ IV + L+  +P  + Y++ GG L+  + + +  
Sbjct: 12  KYNEYKQILEELQAKIIELGHDKDEHDIVLKTLKDTEPRRKCYRMIGGALVESDVQTSLP 71

Query: 69  NVSKRLEFIEGEIRRCEQNIKQKQEEMEGAR 99
            +  + E +EG I + +  + Q  +E E  +
Sbjct: 72  ILKTKKENLEGTISKMKDTLIQTAQEFEKWK 102

>KLLA0D13904g Chr4 complement(1195920..1196236,1196332..1196350)
          [336 bp, 111 aa] {ON} similar to uniprot|P40005 YEL003w
          Saccharomyces cerevisiae GIM4 subunit of the
          heterohexameric cochaperone prefoldin complex
          Length = 111

 Score = 29.6 bits (65), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 9  KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVE 62
          KY + +G LEEL     +L     E+ IV + L    PE + Y++ G  L+  +
Sbjct: 11 KYNEFKGTLEELQSKIIELGRDKDEHDIVLKTLNETDPERKCYRMVGSALVDTD 64

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 30.0 bits (66), Expect = 0.96,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (58%)

Query: 12  QLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQV 50
           QL+  LE      ++LE QLQENK+  E LQ +  E ++
Sbjct: 171 QLRLALERQHEVNKRLEQQLQENKLQQERLQRVLDEQEM 209

>NDAI0G04440 Chr7 complement(1060016..1065142) [5127 bp, 1708 aa] {ON}
            Anc_2.653 YKL014C
          Length = 1708

 Score = 30.0 bits (66), Expect = 1.0,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 11/88 (12%)

Query: 21   VVTRQKLETQLQEN----KIVNEELQALQPETQVYKLTGGVLLPVEQEEAEGNVSKRLEF 76
            + T + LE  LQ       +++E L+ L+      K+  G+L   +QE+   N+    EF
Sbjct: 1000 ISTSKLLEVFLQSPYFSIDVISENLETLKENKYAKKIAIGILEKNQQEQE--NIK---EF 1054

Query: 77   IEGEIRRCEQNIK--QKQEEMEGARAAL 102
            +E  +++C +N++  Q+ E++E + A L
Sbjct: 1055 VELCVKQCYENLRTPQENEDIEDSLALL 1082

>ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON}
           similar to uniprot|Q05080 Saccharomyces cerevisiae
           YMR032W HOF1 Bud neck-localized SH3 domain-containing
           protein required for cytokinesis
          Length = 748

 Score = 29.3 bits (64), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 7/47 (14%)

Query: 3   AEQVATKYTQLQGELEELVVTR-------QKLETQLQENKIVNEELQ 42
           AEQ+  +YT L G++E L V +       + LE +LQE ++   +LQ
Sbjct: 109 AEQLQARYTTLSGKVERLRVDKYNKKVGCENLEKRLQEAQVRARDLQ 155

>Kwal_YGOB_KLTH0E14146g s27
          complement(1195778..1196296,1196300..1196368) [588 bp,
          195 aa] {ON} ANNOTATED BY YGOB -
          Length = 195

 Score = 28.5 bits (62), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 33 ENKIVNEELQALQPETQVYKLTGGVLLPVEQEEAEGNVSK 72
          +NKI  E L+A +    ++ L G     V Q++  GN++K
Sbjct: 20 DNKITTEFLEASESLVTLFDLLGNSAFTVVQKDLTGNITK 59

>KAFR0L00640 Chr12 (120745..120763,120859..121175) [336 bp, 111
          aa] {ON} Anc_7.139 YEL003W
          Length = 111

 Score = 28.1 bits (61), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%)

Query: 8  TKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLL 59
           KY + +  LE+L     +L     E+ IV + L+   PE + Y++ GG L+
Sbjct: 10 VKYNEYKQILEDLQAKIIELGHDKDEHDIVLDTLEKTDPERKCYRMVGGALV 61

>NCAS0I00790 Chr9 complement(141413..141729,141805..141826) [339
          bp, 112 aa] {ON} Anc_7.139 YEL003W
          Length = 112

 Score = 28.1 bits (61), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%)

Query: 9  KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLL 59
          KY + +  LEEL     +L     E+ IV E L    PE + Y++ GG L+
Sbjct: 12 KYNEYKQVLEELQSKIIELGHDKDEHGIVLETLSGTDPERKCYRMIGGALV 62

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 59  LPVEQEEAEGNVS----KRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKL 105
           L + Q   + N S    KR E I  EI+ CE +I Q+Q ++E  + +++++
Sbjct: 732 LAMAQRSVDSNQSTQLIKRNEAISLEIKSCENSITQEQNKLESIQNSIIQI 782

>SAKL0F04906g Chr6 complement(392819..393135,393197..393221) [342
          bp, 113 aa] {ON} similar to uniprot|P40005
          Saccharomyces cerevisiae YEL003W GIM4 Subunit of the
          heterohexameric cochaperone prefoldin complex which
          binds specifically to cytosolic chaperonin and
          transfers target proteins to it
          Length = 113

 Score = 27.3 bits (59), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 1  MSAEQVAT----KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGG 56
          MS EQ +     KY + +  LEEL     +L    +E+++V + L+   P  + Y++ GG
Sbjct: 1  MSTEQRSNVLQLKYNEYKQTLEELQAKIIELGNDKEEHEVVLKTLENTDPSRKCYRMVGG 60

Query: 57 VLLPVEQE 64
           L+  + E
Sbjct: 61 ALVETDVE 68

>TPHA0H01730 Chr8 (395984..397282) [1299 bp, 432 aa] {ON}
          Anc_5.421 YHR111W
          Length = 432

 Score = 27.7 bits (60), Expect = 5.5,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 12 QLQGELEELVVTRQKLETQLQENKIVNEEL 41
          QL+ E+E L     KL +QL E+K+ NE L
Sbjct: 3  QLRKEIENLREENAKLRSQLSESKVNNESL 32

>KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.326
           YLR131C
          Length = 623

 Score = 27.7 bits (60), Expect = 7.1,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 12  QLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQ 49
           +L+  LE      +KLE QL+EN++  E+LQ +  E +
Sbjct: 143 ELRAALERQKEVNRKLEQQLRENQLQQEKLQRVLEEQE 180

>TDEL0H03020 Chr8 (499495..499513,499583..499899) [336 bp, 111 aa]
          {ON} Anc_7.139 YEL003W
          Length = 111

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 9  KYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLL 59
          KY   +  LEEL     +L     E+ +V   L    PE + Y++ GG L+
Sbjct: 11 KYNDYKQTLEELQSKIIELGHDKDEHDVVLNTLNGTNPERKCYRMIGGALV 61

>KLLA0B08800g Chr2 complement(772732..774444) [1713 bp, 570 aa] {ON}
           similar to uniprot|P22580 Saccharomyces cerevisiae
           YDR242W AMD2 Putative amidase
          Length = 570

 Score = 27.3 bits (59), Expect = 8.0,   Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 7/51 (13%)

Query: 4   EQVATKYT-------QLQGELEELVVTRQKLETQLQENKIVNEELQALQPE 47
           +Q+   YT       Q+ GEL  + +TR  ++  +  N + N  LQ L PE
Sbjct: 70  QQIVNDYTIKDLVEKQVSGELTAVEITRAYIKAAIVANYVTNFALQFLIPE 120

>NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326
          Length = 620

 Score = 27.3 bits (59), Expect = 9.1,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 30/50 (60%)

Query: 1   MSAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQV 50
           M ++ +  +  +L+  LE+     +KLE QL+EN++  E+LQ +  E ++
Sbjct: 172 MISQTLFKQQEELRLALEQQKEVNKKLELQLRENQLQQEKLQKVLMEQEM 221

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.322 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,729,271
Number of extensions: 371268
Number of successful extensions: 2257
Number of sequences better than 10.0: 208
Number of HSP's gapped: 2231
Number of HSP's successfully gapped: 228
Length of query: 107
Length of database: 53,481,399
Length adjustment: 77
Effective length of query: 30
Effective length of database: 44,652,117
Effective search space: 1339563510
Effective search space used: 1339563510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)