Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL144C7.354ON54945024120.0
Ecym_47197.354ON51344421920.0
KLLA0D12254g7.354ON51344421720.0
KLTH0H01166g7.354ON50744121590.0
SAKL0F11462g7.354ON49843521570.0
Kwal_56.246547.354ON50744121550.0
TPHA0F030107.354ON50944721510.0
Kpol_530.277.354ON50843921370.0
NDAI0A018807.354ON50343521290.0
Smik_12.2577.354ON50844021230.0
Skud_12.2627.354ON50544021180.0
NCAS0A141707.354ON51043521180.0
YLR197W (NOP56)7.354ON50444021160.0
Suva_10.2937.354ON50544021020.0
ZYRO0F11792g7.354ON51344121000.0
CAGL0A04015g7.354ON50843620930.0
TBLA0E020807.354ON51343920890.0
KAFR0L015107.354ON50044120850.0
TDEL0C019407.354ON51043620820.0
KNAG0B025907.354ON49943920630.0
KNAG0J006508.787ON5244178501e-107
ZYRO0F12518g8.787ON5194158461e-106
KNAG0G031908.787ON5234158461e-106
KLTH0H15334g8.787ON5114108421e-106
TDEL0B011108.787ON5044158401e-105
SAKL0B05874g8.787ON5134108391e-105
TBLA0B028308.787ON5174158321e-104
KAFR0D015808.787ON5014168301e-104
TPHA0G011608.787ON5144158311e-104
Smik_15.4918.787ON5164138301e-104
Skud_15.4788.787ON5124158291e-104
KAFR0B035408.787ON4994158281e-104
Suva_8.3618.787ON5054158281e-104
Kpol_1010.58.787ON5144138291e-104
YOR310C (NOP58)8.787ON5114158281e-104
TPHA0I006508.787ON5404188301e-104
NDAI0E005508.787ON5234158251e-103
NCAS0B008708.787ON5154158231e-103
KLLA0F08613g8.787ON5114138171e-102
Ecym_14898.787ON5144138011e-100
AFR328C8.787ON5134117992e-99
Kwal_34.158948.787ON5124137912e-98
CAGL0I09790g8.787ON5134157842e-97
KNAG0B011403.429ON4922121741e-12
TPHA0D039303.429ON4712351723e-12
TDEL0F031103.429ON4342431713e-12
ZYRO0C12386g3.429ON4442261687e-12
Kpol_1018.1383.429ON4932431671e-11
YGR091W (PRP31)3.429ON4941991643e-11
KAFR0K015303.429ON5062241617e-11
Kwal_23.39953.429ON4742151607e-11
Skud_7.3903.429ON4952391599e-11
TBLA0C023203.429ON5112511581e-10
NCAS0E011603.429ON4792581545e-10
Suva_7.3743.429ON5132191536e-10
NDAI0G012903.429ON4961961536e-10
ADR032W3.429ON4391961482e-09
Smik_6.1773.429ON4822191455e-09
Ecym_44493.429ON4622181331e-07
SAKL0F06050g3.429ON4732211286e-07
KLLA0D14883g3.429ON4672221279e-07
KLTH0F12034g3.429ON5242741206e-06
CAGL0G03025g3.429ON4791241181e-05
TDEL0G021301.174ON965218810.37
Kpol_1045.796.8ON508112780.71
YCL014W (BUD3)1.406ON163687752.0
ADR389C7.31ON392133705.8
SAKL0F15202g7.501ON45553705.9
Kwal_26.87518.668ON84834707.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL144C
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON} Syn...   933   0.0  
Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar...   848   0.0  
KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} high...   841   0.0  
KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly...   836   0.0  
SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {...   835   0.0  
Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]...   834   0.0  
TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {O...   833   0.0  
Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON} (71285..7...   827   0.0  
NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354    824   0.0  
Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197...   822   0.0  
Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197...   820   0.0  
NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa] ...   820   0.0  
YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}  NOP56Esse...   819   0.0  
Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197...   814   0.0  
ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {...   813   0.0  
CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {...   810   0.0  
TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {O...   809   0.0  
KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {...   807   0.0  
TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.3...   806   0.0  
KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.3...   799   0.0  
KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8....   332   e-107
ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]...   330   e-106
KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {O...   330   e-106
KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]...   328   e-106
TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.7...   328   e-105
SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {...   327   e-105
TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.7...   325   e-104
KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {O...   324   e-104
TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.7...   324   e-104
Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {...   324   e-104
Skud_15.478 Chr15 complement(836937..837160,837194..838505) [153...   323   e-104
KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {O...   323   e-104
Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 ...   323   e-104
Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON} (13325.....   323   e-104
YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON} ...   323   e-104
TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.7...   324   e-104
NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787    322   e-103
NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {O...   321   e-103
KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {...   319   e-102
Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {O...   313   e-100
AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}...   312   2e-99
Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310...   309   2e-98
CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {...   306   2e-97
KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {O...    72   1e-12
TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.4...    71   3e-12
TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.4...    70   3e-12
ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} simila...    69   7e-12
Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]...    69   1e-11
YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splic...    68   3e-11
KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3....    67   7e-11
Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {O...    66   7e-11
Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W ...    66   9e-11
TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {O...    65   1e-10
NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {O...    64   5e-10
Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W ...    64   6e-10
NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {O...    64   6e-10
ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic ho...    62   2e-09
Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W ...    60   5e-09
Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}...    56   1e-07
SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} simila...    54   6e-07
KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weak...    54   9e-07
KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]...    51   6e-06
CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} simila...    50   1e-05
TDEL0G02130 Chr7 (417378..420275) [2898 bp, 965 aa] {ON} Anc_1.1...    36   0.37 
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...    35   0.71 
YCL014W Chr3 (96281..101191) [4911 bp, 1636 aa] {ON}  BUD3Protei...    33   2.0  
ADR389C Chr4 complement(1408968..1410146) [1179 bp, 392 aa] {ON}...    32   5.8  
SAKL0F15202g Chr6 (1223198..1224565) [1368 bp, 455 aa] {ON} high...    32   5.9  
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    32   7.2  

>ACL144C Chr3 complement(94809..96458) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR197W
           (SIK1)
          Length = 549

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/450 (100%), Positives = 450/450 (100%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN
Sbjct: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
           GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP
Sbjct: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQEASEAAEGAT 450
           LKNEIAIQEAIALFNKDKPQEASEAAEGAT
Sbjct: 421 LKNEIAIQEAIALFNKDKPQEASEAAEGAT 450

>Ecym_4719 Chr4 (1410528..1412069) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ACL144C
          Length = 513

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/444 (91%), Positives = 428/444 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVEL SF PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELASFVPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALEN NDISEGLLSEHLKAVLDLNLPKGS+KK+VVLA+SDKNLGPSIKEEFPYVDCI++
Sbjct: 61  QALENCNDISEGLLSEHLKAVLDLNLPKGSSKKAVVLAISDKNLGPSIKEEFPYVDCIAS 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG+KLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGSKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVL IRDK SL D+SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLHIRDKTSLTDDSLHDLAAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGIAERVISNARISMGQDLSEVDM+NV VFAERV NLV+YR+QLY+YLC KMHTVAP
Sbjct: 241 DDDAGIAERVISNARISMGQDLSEVDMDNVCVFAERVANLVDYRKQLYDYLCAKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFISKASAKNKGRISRYLANKCS+ASRIDNY+DDPTN FGQVLKKQVEQRLEFYATG+PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSIASRIDNYADDPTNAFGQVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQEASE 444
           LKNE+AIQEAI LFNK++PQE  E
Sbjct: 421 LKNEVAIQEAIDLFNKNRPQEEVE 444

>KLLA0D12254g Chr4 (1045077..1046618) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 513

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/444 (90%), Positives = 428/444 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SEHLKA+LDLNLPKGS+KK+V LA+SDKNLGPSIKE FP+VDCISN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSSKKTVTLAISDKNLGPSIKEVFPFVDCISN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQPGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFI+DKASLN+ESLHDLS IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLNEESLHDLSEIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
             DAGI+ERVI NARISMGQDLSE DMENV++FA+RVV+LVEYR+QLY+YLCEKMHTVAP
Sbjct: 241 DNDAGISERVIDNARISMGQDLSETDMENVTIFAKRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISH+GSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHSGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSD+P+NVFGQVLKKQVEQRLEFYA+G+PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGQVLKKQVEQRLEFYASGTPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQEASE 444
           LKNE AI+EAI L+NKDKP    E
Sbjct: 421 LKNESAIKEAIELYNKDKPAHEEE 444

>KLTH0H01166g Chr8 (116579..118102) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197W SIK1 Component of the small (ribosomal) subunit
           (SSU) processosome that contains U3 snoRNA
          Length = 507

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/441 (90%), Positives = 424/441 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SE+LKAVLD+NLPKGS KK+V LA+SDKNLGPSIKE FPY+DC+SN
Sbjct: 61  QALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNLGPSIKEVFPYIDCMSN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLKDLQ+GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFI+DKASL ++SLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIKDKASLTEDSLHDLTAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGIAERVI NARISMGQDLSE DMENV VFAERV +L +YRRQLY+YLC KMHTVAP
Sbjct: 241 DDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLADYRRQLYDYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI KASAKNKGRISRYLANKCS+ASRIDNYSD+P+NVFG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQE 441
           LKNE+AIQEAI L+NKDKP+E
Sbjct: 421 LKNELAIQEAIELYNKDKPEE 441

>SAKL0F11462g Chr6 complement(889390..890886) [1497 bp, 498 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 498

 Score =  835 bits (2157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/435 (91%), Positives = 422/435 (97%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SEHLKA+LDLNLPKGSAK +V LA+SDKNLGPSIKE FPYVDCISN
Sbjct: 61  QALENANDISEGLVSEHLKALLDLNLPKGSAKSTVTLAISDKNLGPSIKETFPYVDCISN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLKDLQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASL++ESLHDL++IL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLDEESLHDLASIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGIAERVI NARISMGQDLSE DMENV +FAERVV+L +YRRQLY+YLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCIFAERVVSLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSD+PTNVFG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYSTGAPT 420

Query: 421 LKNEIAIQEAIALFN 435
           LKNE+AIQEAI L+N
Sbjct: 421 LKNELAIQEAIELYN 435

>Kwal_56.24654 s56 complement(1090443..1091966) [1524 bp, 507 aa]
           {ON} YLR197W (SIK1) - homology to microtubule binding
           proteins and to X90565_5.cds [contig 161] FULL
          Length = 507

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/441 (90%), Positives = 425/441 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQ QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+S++LKAVLD+NLPKGS+KK+V LA+SDKNLGPSIKE FPYVDC+SN
Sbjct: 61  QALENANDISEGLVSDYLKAVLDMNLPKGSSKKTVTLAISDKNLGPSIKEAFPYVDCMSN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLKDLQ+GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASL+++SLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLSEDSLHDLSAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
             DAGIAERVI NARISMGQDLSE DM+NV VFAERV +L +YRRQLYEYLC KMHTVAP
Sbjct: 241 DNDAGIAERVIDNARISMGQDLSETDMDNVCVFAERVTSLADYRRQLYEYLCSKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI KA+AKNKGRISRYLANKCS+ASRIDNYSD+PTNVFG VLKKQVEQRLEFY+TGSPT
Sbjct: 361 GFIGKAAAKNKGRISRYLANKCSIASRIDNYSDEPTNVFGTVLKKQVEQRLEFYSTGSPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQE 441
           LKNE+AIQEAI L+NKDKP+E
Sbjct: 421 LKNELAIQEAIELYNKDKPEE 441

>TPHA0F03010 Chr6 complement(658541..660070) [1530 bp, 509 aa] {ON}
           Anc_7.354 YLR197W
          Length = 509

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/447 (88%), Positives = 426/447 (95%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLL+EEPTGY IFKVKLQQDDIGSRL EVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLYEEPTGYAIFKVKLQQDDIGSRLGEVQQQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SE+LKA+LDLNLPKGS KKSVVL +SDKNLGPSIKE+FPYVDC++N
Sbjct: 61  EALENANDISEGLVSENLKALLDLNLPKGSEKKSVVLGISDKNLGPSIKEDFPYVDCMAN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLLRG+RLHG KL KDLQ GDL+RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLLRGIRLHGEKLFKDLQTGDLDRAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FA+LVLFI+DKASLNDESLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYSFARLVLFIKDKASLNDESLHDLTAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGI++RVI NARISMGQDLSE DM+N+ VFA+RVV+LVEYRRQLY+YLCEKMHTVAP
Sbjct: 241 NDDAGISQRVIDNARISMGQDLSETDMDNICVFAKRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KA+AKNKGRISRYLANKCSMASRIDNYSD+PTNVFG VLKKQVEQRLEFYATGSPT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGSPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQEASEAAE 447
           LKNE+AIQEA+ L+NKD P+    A E
Sbjct: 421 LKNELAIQEAMKLYNKDAPKSEDAAEE 447

>Kpol_530.27 s530 (71285..72811) [1527 bp, 508 aa] {ON}
           (71285..72811) [1527 nt, 509 aa]
          Length = 508

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/439 (89%), Positives = 422/439 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRL+EVQ+QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLQEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+S+ LKAVLDLNLPKGS KKSVV+A+SDKNLGPSIKE FPYVDCISN
Sbjct: 61  EALENANDISEGLVSDSLKAVLDLNLPKGSEKKSVVMAISDKNLGPSIKEVFPYVDCISN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASLN++SLHDLSAIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEDSLHDLSAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
             DAG+AERVI NARISMGQDLSE DM+NV +FA+RVV+L +YR+QLY+YLCEKMHTVAP
Sbjct: 241 DNDAGVAERVIDNARISMGQDLSETDMDNVCIFAQRVVSLADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFISKASAKNKGRISRYLANKCSMASRIDNYSD+PT+VFG VLKKQVEQRLEFYATG+PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYATGTPT 420

Query: 421 LKNEIAIQEAIALFNKDKP 439
           LKNE+AI EA+ L+NKDKP
Sbjct: 421 LKNEVAIHEAMELYNKDKP 439

>NDAI0A01880 Chr1 (422978..424489) [1512 bp, 503 aa] {ON} Anc_7.354
          Length = 503

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/435 (90%), Positives = 419/435 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENAND+SEGL+SE LKA+LDLNLPKGS  K+V LA+SDKNLGPSIKEEFPYVDC++N
Sbjct: 61  EALENANDVSEGLVSESLKAILDLNLPKGSKGKTVTLAISDKNLGPSIKEEFPYVDCLAN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASLNDESLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
           G+DAGIA+RVI NARISMGQD+SE DMENVS+FA+RVV+LVEYR+QL++YLCEKMHTVAP
Sbjct: 241 GDDAGIAQRVIDNARISMGQDISETDMENVSIFAQRVVSLVEYRKQLFDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSD+PTNVFG VLKKQVEQRLEFY TG PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYNTGKPT 420

Query: 421 LKNEIAIQEAIALFN 435
           LKNE+AIQEA+ L+N
Sbjct: 421 LKNELAIQEAMDLYN 435

>Smik_12.257 Chr12 (493092..494618) [1527 bp, 508 aa] {ON} YLR197W
           (REAL)
          Length = 508

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/440 (89%), Positives = 418/440 (95%), Gaps = 1/440 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAK-KSVVLAVSDKNLGPSIKEEFPYVDCIS 119
            ALENANDISEGL+SE LKA+LDLNLPK S+K K+V LA+SDKNLGPSIKEEFPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKNKNVTLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLND+SLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVA 299
           L ED+GIA+RVI NARISMGQD+SE DMENV VFA+RV +L +YRRQLY+YLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSD+P+NVFG VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNEIAIQEAIALFNKDKP 439
           TLKNE+AIQEA+ L+NKDKP
Sbjct: 421 TLKNELAIQEAMELYNKDKP 440

>Skud_12.262 Chr12 (492745..494262) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/440 (88%), Positives = 419/440 (95%), Gaps = 1/440 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKLVEL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLVELASFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKK-SVVLAVSDKNLGPSIKEEFPYVDCIS 119
            ALENANDISEGL+SE LKA+LDLNLPK S+KK ++ LA+SDKNLGPSIKE+FPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEDFPYVDCIS 120

Query: 120 NELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLND+SLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYAFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVA 299
           L ED+GIA+RVI NARISMGQD+SE DMENV VFA+RV +L +YRRQLY+YLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSD+P+NVFG VLKKQVEQRLEFY TG+P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNTGTP 420

Query: 420 TLKNEIAIQEAIALFNKDKP 439
           T+KNE+AIQEA+ L+NKDKP
Sbjct: 421 TMKNELAIQEAMELYNKDKP 440

>NCAS0A14170 Chr1 complement(2783782..2785314) [1533 bp, 510 aa]
           {ON} Anc_7.354
          Length = 510

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/435 (90%), Positives = 418/435 (96%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQDDIGSRLKEVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDDIGSRLKEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SE LKAVLDLNLPK S  K++ LA+SDKNLGPSIKE+FPYVDCI+N
Sbjct: 61  EALENANDISEGLVSESLKAVLDLNLPKASKSKTITLAISDKNLGPSIKEDFPYVDCIAN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGDKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASLNDESLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGIAERVI NARISMGQD+SE DMENV VFA+RVV+LVEYR+QLY+YLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDISETDMENVGVFAQRVVSLVEYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KASAKNKGRISRYLANKCSMASRIDNYSD+PT+VFG VLKKQVEQRLEFY+TG+PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSMASRIDNYSDEPTSVFGAVLKKQVEQRLEFYSTGTPT 420

Query: 421 LKNEIAIQEAIALFN 435
           LKNE+AI+EA+ L+N
Sbjct: 421 LKNELAIKEAMDLYN 435

>YLR197W Chr12 (546097..547611) [1515 bp, 504 aa] {ON}
           NOP56Essential evolutionarily-conserved nucleolar
           protein component of the box C/D snoRNP complexes that
           direct 2'-O-methylation of pre-rRNA during its
           maturation; overexpression causes spindle orientation
           defects
          Length = 504

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/440 (88%), Positives = 419/440 (95%), Gaps = 1/440 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+ELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKK-SVVLAVSDKNLGPSIKEEFPYVDCIS 119
            ALENANDISEGL+SE LKA+LDLNLPK S+KK ++ LA+SDKNLGPSIKEEFPYVDCIS
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCIS 120

Query: 120 NELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAI 239
           LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLND+SLHDL+A+
Sbjct: 181 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAAL 240

Query: 240 LGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVA 299
           L ED+GIA+RVI NARISMGQD+SE DMENV VFA+RV +L +YRRQLY+YLCEKMHTVA
Sbjct: 241 LNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYS++P+NVFG VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNEIAIQEAIALFNKDKP 439
           TLKNE+AIQEA+ L+NKDKP
Sbjct: 421 TLKNELAIQEAMELYNKDKP 440

>Suva_10.293 Chr10 (518873..520390) [1518 bp, 505 aa] {ON} YLR197W
           (REAL)
          Length = 505

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/440 (87%), Positives = 418/440 (95%), Gaps = 1/440 (0%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDIGSRLKEVQ+QINDFG+FTKL+EL SFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELASFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKK-SVVLAVSDKNLGPSIKEEFPYVDCIS 119
            ALENANDISEGL+SE LKA+LDLNLPK S+KK ++ LA+SDKNLGPSIKE+FPYVDCIS
Sbjct: 61  EALENANDISEGLVSEGLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEQFPYVDCIS 120

Query: 120 NELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           NELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL
Sbjct: 121 NELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 180

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAI 239
           LDQLDKD+NTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLN++SLHDL+A+
Sbjct: 181 LDQLDKDVNTFAMRVKEWYGWHFPELAKLVPDNYSFAKLVLFIKDKASLNEDSLHDLAAL 240

Query: 240 LGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVA 299
           L +D+GIA+RVI NARISMGQDLSE DMENV +FA+RV +L +YRRQLY+YLCEKMHTVA
Sbjct: 241 LNDDSGIAQRVIDNARISMGQDLSETDMENVCIFAQRVASLADYRRQLYDYLCEKMHTVA 300

Query: 300 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 359
           PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH
Sbjct: 301 PNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYH 360

Query: 360 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSP 419
           SGFISKASAKNKGRISRYLANKCSMASRIDNYSD+P+NVFG VLKKQVEQRLEFY TG P
Sbjct: 361 SGFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSNVFGTVLKKQVEQRLEFYNTGKP 420

Query: 420 TLKNEIAIQEAIALFNKDKP 439
           TLKNE+AIQEA+ L+NKDKP
Sbjct: 421 TLKNELAIQEAMELYNKDKP 440

>ZYRO0F11792g Chr6 complement(962314..963855) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12460 Saccharomyces
           cerevisiae YLR197W SIK1 Component of the small
           (ribosomal) subunit (SSU) processosome that contains U3
           snoRNA
          Length = 513

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/441 (87%), Positives = 416/441 (94%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY IFKVKLQQD+IGSRL+EVQKQINDFGSFTKL+ELVSF+PFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAIFKVKLQQDNIGSRLEEVQKQINDFGSFTKLLELVSFSPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGLLSE LKAVLDLNLPKGS K+SV L +SDKNLGPSIKE FPYVDC SN
Sbjct: 61  EALENANDISEGLLSESLKAVLDLNLPKGSKKQSVTLGISDKNLGPSIKEVFPYVDCFSN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL+QDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELSQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DK SL+++SLHDL+A+L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYNFAKLVLFIKDKTSLSEDSLHDLAALL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DA IAERV+ NARISMGQDLS  DMENV +FA+RVVNL +YRRQLY+YLCEKMHTVAP
Sbjct: 241 NDDAAIAERVMDNARISMGQDLSSADMENVCIFAQRVVNLADYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFISKA+AKNKGRISRYLANKC+MASRIDNYSD+PTN+FG VLKKQVEQRLEFY TG PT
Sbjct: 361 GFISKAAAKNKGRISRYLANKCTMASRIDNYSDEPTNIFGTVLKKQVEQRLEFYTTGHPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQE 441
           LKNE+AIQEAI L+N++KP+E
Sbjct: 421 LKNELAIQEAIELYNENKPEE 441

>CAGL0A04015g Chr1 complement(402070..403596) [1527 bp, 508 aa] {ON}
           similar to uniprot|Q12460 Saccharomyces cerevisiae
           YLR197w SIK1 involved in pre-rRNA processing
          Length = 508

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/436 (88%), Positives = 414/436 (94%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAAHAL 63
           IEYLLFEEPTGY +FKVKL QD+IGS+LKEVQ+QINDFG FTKLVELVSFAPFKGAA AL
Sbjct: 3   IEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFTKLVELVSFAPFKGAAEAL 62

Query: 64  ENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISNELA 123
           ENANDISEGL+SE LK VL+LNLPKGSAK +V LA+SDKNLGPSIKE FPYVDCI+NELA
Sbjct: 63  ENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKNLGPSIKEAFPYVDCIANELA 122

Query: 124 QDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
           QDL+RGVRLHG KLLK LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL
Sbjct: 123 QDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 182

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGED 243
           DKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLN+ESLHDL+A++ ED
Sbjct: 183 DKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNEESLHDLAAVVNED 242

Query: 244 AGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLS 303
           AGIAER+I NARISMGQDLSE DMENV VFA+RVV+LV+YR+QLY+YLCEKMHTVAPNLS
Sbjct: 243 AGIAERIIDNARISMGQDLSETDMENVCVFAQRVVSLVDYRKQLYDYLCEKMHTVAPNLS 302

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
            LIGEVIGARLISHAGSLT+LSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI
Sbjct: 303 GLIGEVIGARLISHAGSLTSLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 362

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPTLKN 423
           +KASAKNKGRISRYLANKCSMASRIDNYSD+PTNVFG VLKKQVEQRLEFYATG PTLKN
Sbjct: 363 AKASAKNKGRISRYLANKCSMASRIDNYSDEPTNVFGSVLKKQVEQRLEFYATGKPTLKN 422

Query: 424 EIAIQEAIALFNKDKP 439
           E+AI EA+ LFNKDKP
Sbjct: 423 ELAIHEAMELFNKDKP 438

>TBLA0E02080 Chr5 complement(505617..507158) [1542 bp, 513 aa] {ON}
           Anc_7.354 YLR197W
          Length = 513

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/439 (87%), Positives = 418/439 (95%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           M+ I+YLLFEEPTGY +F+VKLQQD+IGS+L EVQKQINDF SFTKLVELVSFAPFKGAA
Sbjct: 1   MSAIQYLLFEEPTGYAVFQVKLQQDNIGSKLAEVQKQINDFASFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SE+LK++L+LNLPKGS KK+V+L +SDKNLGPSIKEEFPYVDCISN
Sbjct: 61  EALENANDISEGLVSENLKSLLELNLPKGSEKKTVILGISDKNLGPSIKEEFPYVDCISN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QDLLRG+R HG KL K LQ+GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELVQDLLRGIRQHGEKLFKGLQQGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASLN+ESLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNEESLHDLTAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGIAERVI NARISMGQDLSE DMENV VFA+RVV++ +YR+QLY+YLCEKMHTVAP
Sbjct: 241 NDDAGIAERVIDNARISMGQDLSETDMENVCVFAKRVVSIADYRKQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFISKASAKNKGRISRYLANKCSMASRIDNYSD+P++VFG V+KKQVEQRLEFY+TG PT
Sbjct: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDEPSSVFGAVMKKQVEQRLEFYSTGKPT 420

Query: 421 LKNEIAIQEAIALFNKDKP 439
           LKNE+AI EA+ L+NKDKP
Sbjct: 421 LKNEVAIHEAMELYNKDKP 439

>KAFR0L01510 Chr12 complement(276894..278396) [1503 bp, 500 aa] {ON}
           Anc_7.354 YLR197W
          Length = 500

 Score =  807 bits (2085), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/441 (87%), Positives = 414/441 (93%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPIEYLLFEEPTGY +FKVKLQQDDI SRL EVQ+QIN+FGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIEYLLFEEPTGYAVFKVKLQQDDIASRLAEVQQQINEFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGLLS+ LK++L+LNLPK S  K+V L +SDKNLGPSIKE+FPYVDCISN
Sbjct: 61  DALENANDISEGLLSDSLKSILELNLPKASKSKTVTLGISDKNLGPSIKEQFPYVDCISN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDLLRGVR HG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELAQDLLRGVRQHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNY FAKLVLFI+DKASLNDESLH+L+  L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDESLHELAGHL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            EDAGIA+RVI NARISMGQDLSE+DM+NV VFAERVV+LV+YRR LY+YLCEKMHTVAP
Sbjct: 241 NEDAGIAQRVIDNARISMGQDLSEIDMQNVCVFAERVVSLVDYRRGLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KASAKNKGRISRYLANKCS+ASRIDNYSD+P+NVFG VLKKQVEQRLEFY  G PT
Sbjct: 361 GFIAKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGSVLKKQVEQRLEFYNIGKPT 420

Query: 421 LKNEIAIQEAIALFNKDKPQE 441
           LKNE+AIQEA+ L+NKDKP+E
Sbjct: 421 LKNELAIQEAMELYNKDKPEE 441

>TDEL0C01940 Chr3 (340658..342190) [1533 bp, 510 aa] {ON} Anc_7.354
           YLR197W
          Length = 510

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/436 (88%), Positives = 413/436 (94%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MAPI+YLLFEEPTGY IFKVKLQQD+IGSRL EVQ+QINDFGSFTKLVELVSFAPFKGAA
Sbjct: 1   MAPIQYLLFEEPTGYAIFKVKLQQDNIGSRLGEVQEQINDFGSFTKLVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENANDISEGL+SE LKA+LDLNLPKGS K++V L +SD+NLGPSIKEEFPYVD +SN
Sbjct: 61  EALENANDISEGLVSESLKAILDLNLPKGSKKETVTLGISDRNLGPSIKEEFPYVDSVSN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           ELAQDL+RGVRLHG KL K LQ GDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL
Sbjct: 121 ELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLF++DKASLNDESLHDL+AIL
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFVKDKASLNDESLHDLAAIL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DA IA+RVI NARISMGQDLSE DMENV VFAERV +L +YRRQLYEYLCEKMHTVAP
Sbjct: 241 NDDAAIAQRVIDNARISMGQDLSETDMENVCVFAERVASLADYRRQLYEYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KA+ KNKGRISRYLANKCSMASRIDNYSD+PTNVFG VL+KQVEQRLEFY+TG PT
Sbjct: 361 GFIAKAATKNKGRISRYLANKCSMASRIDNYSDEPTNVFGTVLRKQVEQRLEFYSTGQPT 420

Query: 421 LKNEIAIQEAIALFNK 436
           LKNE+AI+EA+ L+N+
Sbjct: 421 LKNELAIKEAMDLYNE 436

>KNAG0B02590 Chr2 (503498..504997) [1500 bp, 499 aa] {ON} Anc_7.354
           YLR197W
          Length = 499

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/439 (86%), Positives = 411/439 (93%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAA 60
           MA IEYLLFEEPTGY +FKVKLQQDDIGSRL EVQ+QINDFGSFTK+VELVSFAPFKGAA
Sbjct: 1   MAAIEYLLFEEPTGYAVFKVKLQQDDIGSRLAEVQEQINDFGSFTKMVELVSFAPFKGAA 60

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALENAN+ISEGL+SE LK+VLDLNLPK S KKS+ L +SDKNLGPSIKE FPYVD +SN
Sbjct: 61  EALENANEISEGLVSESLKSVLDLNLPKPSKKKSIALGISDKNLGPSIKETFPYVDSVSN 120

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           EL QD+LRG+RLHG KL K LQ GDL+RA LGLGHAYSRAKVKFSVQKNDNHIIQAIAL+
Sbjct: 121 ELVQDMLRGIRLHGEKLFKGLQSGDLDRAHLGLGHAYSRAKVKFSVQKNDNHIIQAIALV 180

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFA+LVLFI+DKASLNDESLHDL+A+L
Sbjct: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAQLVLFIKDKASLNDESLHDLAALL 240

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            +DAGIA+RVI NARISMGQDLSE DMENV VFA+RVV+LVEYRRQLY+YLCEKMHTVAP
Sbjct: 241 NDDAGIAQRVIDNARISMGQDLSETDMENVGVFAQRVVSLVEYRRQLYDYLCEKMHTVAP 300

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS
Sbjct: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRLEFYATGSPT 420
           GFI+KA+AKNKGRISRYLANKCS+ASRIDNYSD+P+NVFG VLKKQVEQRLEFYATG PT
Sbjct: 361 GFIAKAAAKNKGRISRYLANKCSIASRIDNYSDEPSNVFGTVLKKQVEQRLEFYATGKPT 420

Query: 421 LKNEIAIQEAIALFNKDKP 439
           LKNE+AI EA+ L+  + P
Sbjct: 421 LKNELAIHEAMELYKSENP 439

>KNAG0J00650 Chr10 (110685..112259) [1575 bp, 524 aa] {ON} Anc_8.787
           YOR310C
          Length = 524

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/417 (43%), Positives = 267/417 (64%), Gaps = 28/417 (6%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          +L +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKLYKSATLIQDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN + EG +S  L+ +LD ++ K    K   L VS+  L  SI +     + +S+
Sbjct: 55  NALEEANSVIEGKVSPQLQKLLD-DIKKD---KKATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ H  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLH--DL 236
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   +R KA       H  D+
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKA-------HEIDM 223

Query: 237 SAILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMH 296
           S IL E+  I ERV + A +SMG ++++ D++N+   A+++V+   YR QL  YL  +M 
Sbjct: 224 SEILPEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMK 281

Query: 297 TVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGL 356
            +APNL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL
Sbjct: 282 AIAPNLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGL 341

Query: 357 IYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           +YH+  + +A+ KNKG+I+R LA K +++ R D +++D  +    G  ++ +VE RL
Sbjct: 342 LYHASLVGQATGKNKGKIARVLAAKAAVSLRYDAFAEDRDDSGDVGLDVRAKVENRL 398

>ZYRO0F12518g Chr6 complement(1017206..1018765) [1560 bp, 519 aa]
           {ON} similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 519

 Score =  330 bits (846), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 265/415 (63%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  K I D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIHKSPKLIQDLDSSEKVLDEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I+EG ++  L+++LD    +    K   L VS+  L  SI +     + +S+
Sbjct: 55  NALEEANSITEGKVTPQLQSLLD----EVKKDKKSTLIVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLTDNDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK+INT++MR KEWYGWHFPELAK+V D   +A+++L   +R KA+  D     +SA
Sbjct: 171 DDLDKEINTYSMRCKEWYGWHFPELAKIVTDLVAYARIILTMGVRSKAAETD-----MSA 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++ D++N+   A+++V+   YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKAAAEVSMGTEITKTDLDNIGALAQQIVDFATYREQLSNYLTARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLISHAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLISHAGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRSKVENRL 398

>KNAG0G03190 Chr7 complement(687362..688933) [1572 bp, 523 aa] {ON}
           Anc_8.787 YOR310C
          Length = 523

 Score =  330 bits (846), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 266/415 (64%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  +  KL++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKAS------DKKIYKSPSLIEDLNTSEKLLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN + EG +S  L+ +L+ ++ K    K   L VS+  L  SI +     + +S+
Sbjct: 55  NALEEANSVIEGKVSPQLEKLLE-DIKKD---KKATLVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ H  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   +R KA   D     +S 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSKAHETD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++ D++N+   A+++V+   YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKAAAEVSMGTEITQTDLDNIKALADQIVDFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+HAGSLT+L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHAGSLTSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D +S+D  +    G  ++ +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDAFSEDRDDSGDVGLDVRVKVENRL 398

>KLTH0H15334g Chr8 complement(1329504..1331039) [1536 bp, 511 aa]
           {ON} highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310C NOP58 Protein involved in pre-rRNA
           processing 18S rRNA synthesis and snoRNA synthesis
           component of the small subunit processome complex which
           is required for processing of pre-18S rRNA
          Length = 511

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 179/410 (43%), Positives = 257/410 (62%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAAHAL 63
           + Y+L E   GY + K   ++    S L +    +N      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSLIQ---DLNTSDKVLKQFKVAAFSKFGSAAEAL 57

Query: 64  ENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISNELA 123
           E AN I EG +S  L+ +LD    +  A K   L VS+  L  +I +     + +S+ + 
Sbjct: 58  EEANSIVEGKVSSQLQKLLD----ESKADKKATLVVSETKLANAINKLGLNFNVVSDAVT 113

Query: 124 QDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ H  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIFRAVKEHLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGED 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  +    DLS IL E+
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEILPEE 230

Query: 244 AGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLS 303
             I ERV + A ISMG +++  D+EN+   A ++     YR QL  YL  +M  +APNL+
Sbjct: 231 --IEERVKAAAEISMGTEITPTDLENIKALATQITEFAAYREQLSNYLSARMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLEARSKVESRL 398

>TDEL0B01110 Chr2 (204471..205985) [1515 bp, 504 aa] {ON} Anc_8.787
           YOR310C
          Length = 504

 Score =  328 bits (840), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/415 (44%), Positives = 270/415 (65%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +  K I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSTKLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE A+ I EG +S  L+ +L+ ++ K   KKS ++ VS+  L  +I +     + IS+
Sbjct: 55  NALEEASAIIEGKVSPQLQNLLE-DIKKD--KKSTLI-VSETKLANAINKLGLNFNVISD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +   LL  L +GDL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFI--RDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L I  R KAS  D     +S+
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILSIGVRSKASETD-----MSS 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++VD++N+   AE++V+   YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQVDLDNIKCLAEQIVDFASYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLDSRAKVENRL 398

>SAKL0B05874g Chr2 complement(499332..500873) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 513

 Score =  327 bits (839), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/410 (43%), Positives = 261/410 (63%), Gaps = 14/410 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGAAHAL 63
           + Y+L E   GY + K   ++    S L    K +N      K  ++ +F+ F  AA AL
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSTL---IKDLNSSEKVLKEFKIAAFSKFSSAADAL 57

Query: 64  ENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISNELA 123
           E AN I EG +S  L+ +L     +  A K   L VS+  L  +I +     + IS+ + 
Sbjct: 58  EEANSIIEGKVSTQLENLL----KEAKADKKATLVVSETKLANAINKLNLNFNVISDAVT 113

Query: 124 QDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQL 183
            D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALLD L
Sbjct: 114 LDIYRAVKEYLPELLPGLSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDL 173

Query: 184 DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGED 243
           DK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  +++  D    D+S IL E+
Sbjct: 174 DKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGVRSNAADT---DMSEILPEE 230

Query: 244 AGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLS 303
             I ERV S + +SMG ++++VD++N+   A+++V+   YR QL  YL  +M  +APNL+
Sbjct: 231 --IEERVKSASEVSMGTEITQVDLDNIKCLADQIVDFAAYREQLSNYLSSRMKAIAPNLT 288

Query: 304 ELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFI 363
           +L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  +
Sbjct: 289 QLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASLV 348

Query: 364 SKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
            +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 349 GQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDVGLESRAKVENRL 398

>TBLA0B02830 Chr2 (653081..654634) [1554 bp, 517 aa] {ON} Anc_8.787
           YOR310C
          Length = 517

 Score =  325 bits (832), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/415 (42%), Positives = 260/415 (62%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E P GY + K          ++ +    + D  +  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETPAGYALLKAS------DKKIYKSSSLLQDLDTTDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE +  I EG +S  L+ +LD    +    K   L VS+  L  +I +    ++ +S+
Sbjct: 55  NALEESTAIIEGKVSPQLEKLLD----EIKKDKKTTLIVSETKLANAINKLGLNLNIVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +   LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLSDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L   IR KAS  D     +S 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGIRSKASETD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG +++  D++N+   AE++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITPTDLDNIKALAEQIVEFASYREQLSNYLSSRMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDAGDVGLEARTKVENRL 398

>KAFR0D01580 Chr4 complement(313631..315136) [1506 bp, 501 aa] {ON}
           Anc_8.787 YOR310C
          Length = 501

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/416 (42%), Positives = 261/416 (62%), Gaps = 26/416 (6%)

Query: 4   IEYLLFEEPTGYGIFKVK----LQQDDIGSRLKEVQKQINDFGSFTKLVELVSFAPFKGA 59
           + Y+L E   GY + K       +   + S L   +K + +F       ++ +F+ F  A
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSTTLLSDLDSSEKVLKEF-------KIAAFSKFSSA 53

Query: 60  AHALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCIS 119
           A+ALE AN I EG +S  L+ +L+    +    K   L VS+  L  +I +     + +S
Sbjct: 54  ANALEEANSIIEGKVSSQLEKILE----QIKKDKKSTLIVSETKLANAINKLGLNFNVVS 109

Query: 120 NELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIAL 179
           + +  D+ R V+ H  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIAL
Sbjct: 110 DAVTLDIYRAVKEHLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIAL 169

Query: 180 LDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLS 237
           LD LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KA+  D     +S
Sbjct: 170 LDDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAETD-----MS 224

Query: 238 AILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHT 297
            IL E+  + ERV + A +SMG ++++ D++N+   AE++V    YR QL  YL  +M  
Sbjct: 225 EILPEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKA 282

Query: 298 VAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLI 357
           +APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+
Sbjct: 283 IAPNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLL 342

Query: 358 YHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           YH+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 343 YHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>TPHA0G01160 Chr7 (234712..236256) [1545 bp, 514 aa] {ON} Anc_8.787
           YOR310C
          Length = 514

 Score =  324 bits (831), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/415 (43%), Positives = 266/415 (64%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  +  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSTSLIQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE +N I EG +S  L+ +L+ ++ K   KKS  L VS+  L  SI +     + +S+
Sbjct: 55  NALEESNAIIEGKVSSQLQKLLE-DIKKD--KKST-LVVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L   IR KAS  D     +S 
Sbjct: 171 DDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASETD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG +++ VD++N+   A+++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>Smik_15.491 Chr15 complement(846605..848155) [1551 bp, 516 aa] {ON}
           YOR310C (REAL)
          Length = 516

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/413 (44%), Positives = 266/413 (64%), Gaps = 24/413 (5%)

Query: 6   YLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAAHA 62
           Y+L E   GY + K   ++    S L      I D  S  K+++   + +F+ F  AA+A
Sbjct: 3   YVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAANA 56

Query: 63  LENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISNEL 122
           LE AN I EG +S  L+ +L+  + K   KKS ++ VS+  L  +I +     + +S+ +
Sbjct: 57  LEEANSIIEGKVSSQLEKLLE-EIKKD--KKSTLI-VSETKLANAINKLGLNFNVVSDAV 112

Query: 123 AQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
             D+ R V+ +  +LL  + + DL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSAIL 240
           LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KAS  D     LS IL
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETD-----LSEIL 227

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            E+  I ERV + A +SMG ++++ D++N++  AE++V    YR QL  YL  +M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Skud_15.478 Chr15 complement(836937..837160,837194..838505) [1536
           bp, 512 aa] {ON} YOR310C (REAL)
          Length = 512

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/415 (43%), Positives = 268/415 (64%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I EG +S  L+ +L+  + K   KKS ++ VS+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE-EIKKD--KKSTLI-VSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  + + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KAS  D     LS 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETD-----LSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++ D++N++  AE++V+   YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>KAFR0B03540 Chr2 complement(735790..737289) [1500 bp, 499 aa] {ON}
           Anc_8.787 YOR310C
          Length = 499

 Score =  323 bits (828), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/415 (43%), Positives = 265/415 (63%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLV---ELVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      + D  S  K++   ++ +F+ F  AA
Sbjct: 1   MSYILTETSAGYALLKASDKKIYKSSTL------LQDLDSSEKVLRQFKIAAFSKFSSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I EG +S  L+ +LD  + K   KKS  L VS+  L  +I +    +  +S+
Sbjct: 55  NALEEANSIVEGKVSTQLEKLLD-EIKKD--KKST-LVVSETKLANAINKLGLNLSVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLDDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KA+  D     +S 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAAETD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  + ERV + A +SMG ++++ D++N+   AE++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--VEERVKTAAEVSMGTEITQSDLDNIKSLAEQIVEFAAYREQLSNYLSNRMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLVSLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVENRL 398

>Suva_8.361 Chr8 complement(637602..637804,637835..639149) [1518 bp,
           505 aa] {ON} YOR310C (REAL)
          Length = 505

 Score =  323 bits (828), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 267/415 (64%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I +G +S  L+ +L+  + K   KKS ++ VS+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIDGKVSSQLEKLLE-EIKKD--KKSTLI-VSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  + + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KAS  D     LS 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETD-----LSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++ D++N++  AE++V+   YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVDFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>Kpol_1010.5 s1010 (13325..14869) [1545 bp, 514 aa] {ON}
           (13325..14869) [1545 nt, 515 aa]
          Length = 514

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/413 (42%), Positives = 260/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKAS------DKKIYKSSSLIQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I EG +S  L+ +L+    +    K   L VS+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSPQLQKLLE----EAKKDKKSTLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +   LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGLNDTDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  ++   D    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILAMGVRSKCADT---DLSEIL 227

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            E+  + ERV + A +SMG +++E D++N+   A+++V+   YR QL  YL  +M  +AP
Sbjct: 228 PEE--VEERVKTAAEVSMGTEITETDLDNIKALADQIVDFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>YOR310C Chr15 complement(896825..898360) [1536 bp, 511 aa] {ON}
           NOP58Protein involved in pre-rRNA processing, 18S rRNA
           synthesis, and snoRNA synthesis; component of the small
           subunit processome complex, which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  323 bits (828), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 181/415 (43%), Positives = 267/415 (64%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLDSSDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I EG +S  L+ +L+  + K   KKS ++ VS+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSSQLEKLLE-EIKKD--KKSTLI-VSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R ++ +  +LL  + + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAIKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KAS  D     LS 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKASETD-----LSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++ D++N++  AE++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQTDLDNINALAEQIVEFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVENRL 398

>TPHA0I00650 Chr9 (135050..136672) [1623 bp, 540 aa] {ON} Anc_8.787
           YOR310C
          Length = 540

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/418 (43%), Positives = 268/418 (64%), Gaps = 24/418 (5%)

Query: 1   MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFK 57
           +  + Y+L E   GY + K   ++    S L      I D  +  K+++   + +F+ F 
Sbjct: 30  LCKMAYVLTETSAGYALLKASDKKIYKSSTL------IQDLDTSDKVLKEFKIAAFSKFS 83

Query: 58  GAAHALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDC 117
            AA+ALE +N I EG +S  L+ +L+ ++ K   KKS  L VS+  L  SI +     + 
Sbjct: 84  SAANALEESNAIIEGKVSSQLQKLLE-DIKKD--KKST-LVVSETKLANSINKLGLNFNV 139

Query: 118 ISNELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAI 177
           +S+ +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAI
Sbjct: 140 VSDAVTLDIYRAVKEYLPELLPGLTDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAI 199

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHD 235
           ALLD LDK++NT+AMRVKEWYGWHFPELAK+V D+  +A+++L   IR KAS  D     
Sbjct: 200 ALLDDLDKELNTYAMRVKEWYGWHFPELAKIVVDSVAYARIILTMGIRSKASETD----- 254

Query: 236 LSAILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKM 295
           +S IL E+  I ERV + A +SMG +++ VD++N+   A+++V    YR QL  YL  +M
Sbjct: 255 MSEILPEE--IEERVKTAAEVSMGTEITPVDLDNIKALADQIVEFAAYREQLSNYLSARM 312

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYG 355
             +APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYG
Sbjct: 313 KAIAPNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYG 372

Query: 356 LIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           L+YH+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 373 LLYHASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 430

>NDAI0E00550 Chr5 (108986..110557) [1572 bp, 523 aa] {ON} Anc_8.787
          Length = 523

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/415 (42%), Positives = 263/415 (63%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  +  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IQDLDTSDKVLKEFKIAAFSKFSSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE +N I EG +S  L+ +L+    +    K   L VS+  L  SI +     + +S+
Sbjct: 55  NALEESNSIIEGKVSPQLEKLLE----EIKKDKKSTLIVSETKLANSINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDSDLNKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+L+L   +R KAS  D     +S 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKASETD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG +++++D++N+   A+++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQIDLDNIKCLADQIVEFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVENRL 398

>NCAS0B00870 Chr2 complement(133660..135207) [1548 bp, 515 aa] {ON}
           Anc_8.787
          Length = 515

 Score =  321 bits (823), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 267/415 (64%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  +  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IQDLDTSDKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN I EG +S  L+ +L+  + K   KKS ++ VS+  L  +I +     + +S+
Sbjct: 55  NALEEANSIIEGKVSPQLEKLLE-EIKKD--KKSTLI-VSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L   IR KA+  D     +S 
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRSKAADTD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG +++++D+EN+   A+++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKTAAEVSMGTEITQLDLENIKCLADQIVEFAAYREQLSNYLSARMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 344 HASLVGQATGKNKGKIARVLAAKAAVSIRYDALAEDRDDAGDIGLESRAKVENRL 398

>KLLA0F08613g Chr6 complement(801623..803158) [1536 bp, 511 aa] {ON}
           similar to uniprot|Q12499 Saccharomyces cerevisiae
           YOR310C NOP58 Protein involved in pre-rRNA processing
           18S rRNA synthesis and snoRNA synthesis component of the
           small subunit processome complex which is required for
           processing of pre-18S rRNA
          Length = 511

 Score =  319 bits (817), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 175/413 (42%), Positives = 260/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLV---ELVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  S  K++   ++ +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLNSSDKVLNQFKIAAFSKFSSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN + +G +S  L+ +L+    +    K   L VS+  L  +I +     + +S+
Sbjct: 55  NALEEANSVIDGKVSSQLEKLLE----ECKTDKKATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLNDQDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  +A+++L +  + +  +    D+S IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAET---DMSEIL 227

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            E+  I ERV + A +SMG +++ VD+ N+   AE++V    YR QL  YL  +M  +AP
Sbjct: 228 PEE--IEERVKTAAEVSMGTEITPVDLINIKCLAEQIVEFAAYREQLSNYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+H+GSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHSGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
             + +AS KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 346 SLVGQASGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRAKVESRL 398

>Ecym_1489 Chr1 complement(1006523..1008067) [1545 bp, 514 aa] {ON}
           similar to Ashbya gossypii AFR328C
          Length = 514

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/413 (42%), Positives = 259/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGS---FTKLVELVSFAPFKGAA 60
           + Y+L E   GY + K          ++ +    IND  S     K  ++ +F+ F  AA
Sbjct: 1   MAYVLTETAAGYALLKAS------DKKIYKSATLINDLKSSESVLKQFKIAAFSKFSSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE AN + EG +S  L+ +LD    +    K   L VS+  LG +I +     + + +
Sbjct: 55  NALEEANAVIEGKVSSQLQKLLD----EAKTDKKATLVVSETKLGNAINKLGLNFNVVCD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  L   DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPELLPGLSGDDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  D    DLS +L
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAADT---DLSEVL 227

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            E+  + ERV + A +SMG +++ +D++N+   AE++V    YR QL  YL  +M  +AP
Sbjct: 228 PEE--VEERVKAAAEVSMGTEITPIDLDNIKCLAEQIVEFAAYREQLSSYLSSRMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL+ L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTNLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSD--DPTNVFGQVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++  D +  FG   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGEFGLESRAKVENRL 398

>AFR328C Chr6 complement(1032025..1033566) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR310C
           (NOP58)
          Length = 513

 Score =  312 bits (799), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/411 (42%), Positives = 263/411 (63%), Gaps = 16/411 (3%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRL-KEVQKQINDFGSFTKLVELVSFAPFKGAAHA 62
           + Y+L E   GY + K   ++    S L ++++   N    F    ++ +F+ F  AA+A
Sbjct: 1   MAYVLTETAAGYALLKASDKKIYKSSSLVQDLKSSENVLKQF----KVAAFSKFASAANA 56

Query: 63  LENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISNEL 122
           LE AN + EG +S  L+ +L     +  + K   L VS+  L  +I +     + + + +
Sbjct: 57  LEEANSVIEGKVSSQLEKLL----AEAKSDKKSTLVVSETKLANAINKLGLNFNVVCDAV 112

Query: 123 AQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
             D+ R V+ +  +LL  + +GDL +  LGL H+  R K+KFS  K D  IIQAIALLD 
Sbjct: 113 TLDIYRAVKEYLPELLPGMTDGDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDD 172

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGE 242
           LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  +    D+S IL E
Sbjct: 173 LDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DMSEILPE 229

Query: 243 DAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNL 302
           +  I ERV S A +SMG ++++VD++N+   AE++V    YR QL  YL  +M  +APNL
Sbjct: 230 E--IEERVKSAAEVSMGTEITQVDLDNIKSLAEQIVEFAAYREQLSNYLSSRMKAIAPNL 287

Query: 303 SELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGF 362
           ++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+  
Sbjct: 288 TQLVGELVGARLIAHAGSLVSLAKAPASTIQILGAEKALFRALKTKHDTPKYGLLYHASL 347

Query: 363 ISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 348 VGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLEARAKVESRL 398

>Kwal_34.15894 s34 (102368..103906) [1539 bp, 512 aa] {ON} YOR310C
           (NOP58) - 57 kDa nucleolar protein [contig 272] FULL
          Length = 512

 Score =  309 bits (791), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 179/413 (43%), Positives = 259/413 (62%), Gaps = 20/413 (4%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  S  K+++   + +F+ F  AA
Sbjct: 1   MAYVLTETSAGYALLKASDKKIYKSSSL------IQDLNSSDKVLKQFKIAAFSKFGSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
            ALE AN I EG +S  L+ +L     +  A K   L VS+  L  +I +     + +S+
Sbjct: 55  EALEEANAIVEGKVSNQLQKLL----SESKADKKATLVVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +  +LL  + + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIFRAVKEYLPELLPGMSDNDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAIL 240
           D LDK++NT+AMR KEWYGWHFPELAK+V D+  FA+++L +  +++  +    DLS IL
Sbjct: 171 DDLDKELNTYAMRCKEWYGWHFPELAKIVTDSVAFARIILTMGVRSNAAET---DLSEIL 227

Query: 241 GEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAP 300
            E+  I ERV S A ISMG +++ VD++N+   A ++     YR QL  YL  +M  +AP
Sbjct: 228 PEE--IEERVKSAAEISMGTEITSVDLDNIKSLATQITEFAAYREQLSNYLSARMKAIAP 285

Query: 301 NLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHS 360
           NL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+YH+
Sbjct: 286 NLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLYHA 345

Query: 361 GFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
             + +A+ KNKG+I+R LA K +++ R D  ++D  +    G   + +VE RL
Sbjct: 346 SLVGQATGKNKGKIARVLAAKAAVSLRYDALAEDRDDSGDIGLESRSKVESRL 398

>CAGL0I09790g Chr9 complement(935016..936557) [1542 bp, 513 aa] {ON}
           highly similar to uniprot|Q12499 Saccharomyces
           cerevisiae YOR310c
          Length = 513

 Score =  306 bits (784), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 179/415 (43%), Positives = 263/415 (63%), Gaps = 24/415 (5%)

Query: 4   IEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQKQINDFGSFTKLVE---LVSFAPFKGAA 60
           + Y+L E   GY + K   ++    S L      I D  S  K+++   + +F+ F  AA
Sbjct: 1   MSYVLTETSAGYALLKASDKKIYKSSSL------IMDLDSSEKVLKEFKIAAFSKFNSAA 54

Query: 61  HALENANDISEGLLSEHLKAVLDLNLPKGSAKKSVVLAVSDKNLGPSIKEEFPYVDCISN 120
           +ALE A+ I EG +S  L+ +LD    +   +K   L VS+  L  +I +     + +S+
Sbjct: 55  NALEEASAIIEGKVSPQLEKLLD----EIKKEKKATLIVSETKLANAINKLGLNFNVVSD 110

Query: 121 ELAQDLLRGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
            +  D+ R V+ +   LL  + + DL +  LGL H+  R K+KFS  K D  IIQAIALL
Sbjct: 111 AVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALL 170

Query: 181 DQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLF--IRDKASLNDESLHDLSA 238
           D LDK++NT++MR KEWYGWHFPELAK+V D+  +A+L+L   +R KA+  D     +S 
Sbjct: 171 DDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKAAETD-----MSE 225

Query: 239 ILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTV 298
           IL E+  I ERV + A +SMG ++++VD+ N+   A+++V    YR QL  YL  +M  +
Sbjct: 226 ILPEE--IEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYLSSRMKAI 283

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIY 358
           APNL++L+GE++GARLI+HAGSL +L+K  AST+QILGAEKALFRALKTK +TPKYGL+Y
Sbjct: 284 APNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKHDTPKYGLLY 343

Query: 359 HSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNV--FGQVLKKQVEQRL 411
           H+  + +AS +NKG+I+R LA K ++A R D  ++D  +    G  ++ +VE RL
Sbjct: 344 HASLVGQASGRNKGKIARVLAAKAAVALRYDALAEDRDDSGDIGLEVRAKVENRL 398

>KNAG0B01140 Chr2 complement(210529..212007) [1479 bp, 492 aa] {ON}
           Anc_3.429 YGR091W
          Length = 492

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 104/212 (49%), Gaps = 10/212 (4%)

Query: 185 KDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDA 244
           +DI      +   Y   F EL  L+P+   +A +V  +    ++ D + ++L+ I   + 
Sbjct: 132 RDIENLHTFMIMQYRKKFLELDSLLPNPVNYADVVFVLE---TMQDRNSNELATIFESEL 188

Query: 245 GIAER----VISNARISMGQDLSEVDMENVSVFAERVV--NLVEYRRQLYEYLCEKMHTV 298
            + +     +  + + S+ QD++   +  + +F  R +   L ++R ++ + +  K+H +
Sbjct: 189 LLKKEQTLVLTLSIKTSLRQDVTLEKLIQIRLFRARAMIRQLSDHRERIVKLVESKIHII 248

Query: 299 APNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLI 357
           APNL+ L+G    + L+ HAGS+  LS   +  +  +G ++ L   L T      + G I
Sbjct: 249 APNLTALVGAETCSYLVGHAGSVVALSLIPSCNLSSIGKKRHLSHELHTNISGVRQEGAI 308

Query: 358 YHSGFISKASAKNKGRISRYLANKCSMASRID 389
           YH   + +    ++ ++ R +  K S+A+R+D
Sbjct: 309 YHCALVREQPVTHRKQMLRMVCAKVSLAARVD 340

>TPHA0D03930 Chr4 (823320..824735) [1416 bp, 471 aa] {ON} Anc_3.429
           YGR091W
          Length = 471

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 116/235 (49%), Gaps = 19/235 (8%)

Query: 170 DNHIIQAIALLDQLDKDI-----NTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRD 224
           +N I++  ++L++  K I     N FA  +K  Y   FPEL  L+ +   F +++  + +
Sbjct: 90  ENGIVEVASILNKYSKIIQEESSNVFAY-IKILYKPRFPELETLLTNPIDFIEVLKLLEE 148

Query: 225 KAS--LNDESLHDLSAILGEDAGIA--ERVISNARISMGQDLSEVDMEN----VSVFAER 276
             +   ND+ +   + +L  ++ I+  +R++    I    + S +  E+    +S   E 
Sbjct: 149 NITEISNDDYI---ATLLENESNISSEKRLVVIMSIKTCFNSSFIFTEDARGKLSSVLEL 205

Query: 277 VVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILG 336
           +  L+  + +  +YL  K+ T+APNLS LIG  I + LISH GS+  LSK  +  +  +G
Sbjct: 206 LNILMNSKTEAVQYLSSKIGTIAPNLSTLIGTSIASLLISHTGSILELSKVPSCNLASIG 265

Query: 337 AEKALFRA--LKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
            +K    A  + +     + G IY+S  I         ++ R L  K S+A+R+D
Sbjct: 266 KKKYSSSAQHITSVSGVRQEGYIYNSELIQNMPISTHKQLLRMLCAKVSLAARVD 320

>TDEL0F03110 Chr6 (568933..570237) [1305 bp, 434 aa] {ON} Anc_3.429
           YGR091W
          Length = 434

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 111/243 (45%), Gaps = 9/243 (3%)

Query: 175 QAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLH 234
           Q  AL   L  +I       K  Y   F EL  LVPD  K+ +++  I +    + E   
Sbjct: 73  QLNALSSILQGEIRLLHDYTKILYRQRFAELESLVPDPVKYVEVISIIEEDEQASSERFE 132

Query: 235 DLSAILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAER--VVNLVEYRRQLYEYLC 292
             + +  E   +   ++ + + S+ Q+    D E   +   R  ++ +V  R ++  Y+ 
Sbjct: 133 RDAKLSKEQILV---LMMSMKTSIRQERQITDGERAVLLRARSYMLAIVSVRDKVNGYVV 189

Query: 293 EKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNT 351
           +++  +APNL  LIG  I + L+SH G +  LS+  +  +  +G  K L   L T     
Sbjct: 190 QRVSHIAPNLCALIGPEITSLLLSHFGGILELSQAPSCNLASIGKNKHLTHELHTSLTGV 249

Query: 352 PKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID---NYSDDPTNVFGQVLKKQVE 408
            + G IY S  +     +   ++ R +  K S+A+R+D   N S +  ++ G   ++++ 
Sbjct: 250 RQEGYIYRSQLVQDQPPQYHKQMLRMVCAKISLAARVDAGINSSQESDSLLGDKWRREIM 309

Query: 409 QRL 411
           +++
Sbjct: 310 EKV 312

>ZYRO0C12386g Chr3 (978158..979492) [1335 bp, 444 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 444

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 104/226 (46%), Gaps = 13/226 (5%)

Query: 169 NDNHIIQAIALLDQL----DKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRD 224
           ND  + Q + +L+ L      +I      +K  YG  F EL  LVP   +FA ++  I  
Sbjct: 73  NDEDLAQTLTILNSLTYIAQNEITVLHNLLKLIYGVKFGELESLVPQPQQFADVIRIIE- 131

Query: 225 KASLNDESLHDLSAILGEDAGIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYR 284
                +E   +  A L ++  +   V++ +  S  Q    VD + V    + ++ +   R
Sbjct: 132 ----TNEGNFETDAQLSKEQVL---VLNMSMKSSFQAHVNVDKDKVLQLRDLLMTVSRIR 184

Query: 285 RQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRA 344
            ++  ++  K   VAPNL  LIG  + + L+SH+G +  LS+  +  +  +G  K L   
Sbjct: 185 NEINSFILSKASLVAPNLCLLIGPEVTSLLLSHSGGVLELSQVPSCNLASIGKNKHLSHE 244

Query: 345 LKTK-GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
           L T      + G IY S  + +   + + ++ R +  K ++A+R+D
Sbjct: 245 LHTNLTGVRQEGYIYRSSLVQEQPLEFRKQMLRMVCAKVALAARVD 290

>Kpol_1018.138 s1018 complement(368322..369803) [1482 bp, 493 aa]
           {ON} complement(368322..369803) [1482 nt, 494 aa]
          Length = 493

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 114/243 (46%), Gaps = 17/243 (6%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDL--SAIL 240
           + ++I+ F    K  Y + F EL  L P   +FAK +  I    +++D S HDL  S + 
Sbjct: 124 IQEEISCFYEYSKHIYKFKFFELETLAPTAVQFAKTIQLIE---TMDDFSQHDLLSSKLE 180

Query: 241 GEDAGIAERV---ISNARISMGQDLS-EVDME-NVSVFAERVVNLVEYRRQLYEYLCEKM 295
            E     E+V   I   + S+ ++ S E  M+ ++  F + ++     ++++  ++   +
Sbjct: 181 TEILLTKEQVLVLIIAMKTSLNKEYSFEGSMKTSLKQFTDIIIQHDLLKKEITTFIESNI 240

Query: 296 HTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKY 354
            T+APNL  L+G  I + LI HAG +  LS+  +  +  +G  K      +T      + 
Sbjct: 241 ITIAPNLCALVGSEITSLLIGHAGGILELSQIPSCNLASVGKNKYFSHERQTNLSGVRQE 300

Query: 355 GLIYHSGFISKASAKNKGRISRYLANKCSMASRID------NYSDDPTNVFGQVLKKQVE 408
           G IY+S  I         ++ R L  K S+A+R+D        S +P    GQ  ++++ 
Sbjct: 301 GYIYNSELIQSQPVDYHKQLLRMLCAKISLAARVDTSVKISTSSTEPAAFLGQKWREEIV 360

Query: 409 QRL 411
            ++
Sbjct: 361 TKI 363

>YGR091W Chr7 (666341..667825) [1485 bp, 494 aa] {ON}  PRP31Splicing
           factor, component of the U4/U6-U5 snRNP complex
          Length = 494

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 95/199 (47%), Gaps = 8/199 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257
           Y   FPEL+ L+P   +++K++  + ++    +ES  +L   L   A +    I    +S
Sbjct: 120 YSRRFPELSSLIPSPLQYSKVISILENENYSKNES-DELFFHLENKAKLTREQILVLTMS 178

Query: 258 MGQDLSE---VDMENVSVFAER---VVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIG 311
           M         +D++  +   E    + NL + +  + +Y+  K+  +APN+  L+G  I 
Sbjct: 179 MKTSFKNKEPLDIKTRTQILEANSILENLWKLQEDIGQYIASKISIIAPNVCFLVGPEIA 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 370
           A+LI+HAG +   S+  +  +  +G  K L   L T +    + G ++ S  I K     
Sbjct: 239 AQLIAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFASDMIQKFPVSV 298

Query: 371 KGRISRYLANKCSMASRID 389
             ++ R L  K S+A+R+D
Sbjct: 299 HKQMLRMLCAKVSLAARVD 317

>KAFR0K01530 Chr11 (319205..320725) [1521 bp, 506 aa] {ON} Anc_3.429
           YGR091W
          Length = 506

 Score = 66.6 bits (161), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 110/224 (49%), Gaps = 14/224 (6%)

Query: 177 IALLDQLDKDINTFAMRVKEW----YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDES 232
           +  L+Q+  ++ T    + E+    Y   F EL  L+    +++  V+++ + +  + E 
Sbjct: 107 LPYLNQISLNLRTETANLHEYLKLSYSARFSELESLIATATQYSN-VIYVLETSEKDTEG 165

Query: 233 LHDLSAILGEDAGIAERVISNARISMGQDLSE-----VDMENVSVFA-ERVVNLVEYRRQ 286
              L   L + A +++  I    +SM    +E     ++++   + A E ++ L E R  
Sbjct: 166 --SLVTSLEQVAQLSKEQILVLMMSMKTSFNESTPLPLEIKQRLLRAREMIITLDELRHT 223

Query: 287 LYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK 346
           +  Y+  K++ +APNL  L+G  I A L+SHAG +  LS+     +  +G +K L   L 
Sbjct: 224 IASYISSKVYHIAPNLCALLGSEITALLVSHAGDILQLSQVPNCNLASIGKKKHLSHELH 283

Query: 347 TKGN-TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
           T  +   + G IY+S  + +    ++ ++ R L  K ++A+R+D
Sbjct: 284 TTASGVRQEGYIYNSELVQETPVGSRKQMLRMLCAKVALAARVD 327

>Kwal_23.3995 s23 complement(517426..518850) [1425 bp, 474 aa] {ON}
           YGR091W (PRP31) - pre-mRNA splicing protein [contig 255]
           FULL
          Length = 474

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 98/215 (45%), Gaps = 2/215 (0%)

Query: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257
           Y   FPEL  L+     +A++V  + + + +N+ +L  L  I+ ++  +   +  +    
Sbjct: 111 YERRFPELQSLMTSPKGYAQVVKHL-ETSDINEGNLRGLEDIISKEHFLVLSMAMHTGFK 169

Query: 258 MGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISH 317
               L+  D   V   A+ ++ L + R ++  Y+   +  VAPNL  L+G  I A LI+ 
Sbjct: 170 QDVPLTAEDSRLVIQTADVLLELCDIRDKIERYVASLVSDVAPNLCILVGSQIAASLIAV 229

Query: 318 AGSLTNLSKQAASTVQILGAEKALFRALKTKGN-TPKYGLIYHSGFISKASAKNKGRISR 376
           AG L+ LS+  +  +  +G  K       T  +   + G IY S  +S      + +  R
Sbjct: 230 AGGLSELSEIPSCNLSSIGKTKNSSHTSDTDASGVRQKGYIYQSDLVSGQPVSFQKQALR 289

Query: 377 YLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRL 411
            +  K S+ +R D     P+   G   K+QV ++L
Sbjct: 290 MVCAKVSLCARADRSKSCPSGTLGAKWKEQVLEKL 324

>Skud_7.390 Chr7 (650643..652130) [1488 bp, 495 aa] {ON} YGR091W
           (REAL)
          Length = 495

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 108/239 (45%), Gaps = 10/239 (4%)

Query: 178 ALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLS 237
           A++  +  DI +    +   YG  FPEL+ L+P + +++K+   +  +    +ES   LS
Sbjct: 101 AIIPLIKSDIKSLHNFLILLYGKRFPELSSLIPSSLQYSKVASILESEHWSKNES-DKLS 159

Query: 238 AILGEDAGIAERVISNARISMGQDLSEVD------MENVSVFAERVVNLVEYRRQLYEYL 291
            +L  +A + +  +    +SM    +  +       + +S     + NL   +  +  Y+
Sbjct: 160 PLLENEANLTKEQVLVLTMSMKTSFNNKEPLDIGTRKQISEATAMLKNLWVLQEDVGRYV 219

Query: 292 CEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGN 350
             K+  +APN+  L+G  + A+L+++AG +   S+  +  +  +G  K L   L T    
Sbjct: 220 ASKISVIAPNMCLLVGPEVAAQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLASG 279

Query: 351 TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID--NYSDDPTNVFGQVLKKQV 407
             + G I+ +  I         ++ R +  K ++A+R+D    S D   V  Q  K ++
Sbjct: 280 VRQEGYIFSTDLIQNFPLAIHKQMLRMICAKVTLAARVDASQQSGDRNTVLAQKWKAEL 338

>TBLA0C02320 Chr3 complement(549057..550592) [1536 bp, 511 aa] {ON}
           Anc_3.429 YGR091W
          Length = 511

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 115/251 (45%), Gaps = 11/251 (4%)

Query: 183 LDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGE 242
           +++DI      VK  Y   FPEL  L+ +  +F  ++  +    + N      L   L +
Sbjct: 133 INEDIKLLHSYVKANYQKRFPELESLITNPIQFIDVIRLLESLNNPNKNEESQLEIRLEK 192

Query: 243 DAGIAER----VISNARISMGQD--LSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMH 296
           +  + +     +I + + S  ++   S     N+   +  +  L +++ ++  ++ +K+ 
Sbjct: 193 ETTLQKEQILVIIMSVKTSFNKEYQFSNTLRNNLIKASNLISQLWQFKEEINSFVTKKIS 252

Query: 297 TVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYG 355
            +APNL  LIG  I + L++++G L NL    +  +  +G  K L   L +      + G
Sbjct: 253 DIAPNLCALIGPYITSLLVAYSGGLANLCSVPSCNLASIGKNKHLSHELHSNLSGVRQNG 312

Query: 356 LIYHSGFISKASAKNKGRISRYLANKCSMASRID---NYSDDPTNVFGQVLKKQVEQRLE 412
            +Y+S  I    A    ++ R L  K ++ASR+D   + ++  T+  G   K ++ +++ 
Sbjct: 313 YLYNSELIQSQPANLHKQLLRILCAKVALASRVDAGQSGNNKKTDELGNTWKLEILEKIN 372

Query: 413 FYATGSPTLKN 423
                SP++ N
Sbjct: 373 -KLNESPSITN 382

>NCAS0E01160 Chr5 complement(219669..221108) [1440 bp, 479 aa] {ON}
           Anc_3.429 YGR091W
          Length = 479

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 116/258 (44%), Gaps = 21/258 (8%)

Query: 179 LLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSA 238
           L  Q+ ++I+      K  Y   F EL  +    Y++AK+   I   +   D+    L  
Sbjct: 118 LSHQIRREIDILYQYSKNIYSTRFTELDTIAATPYQYAKVTSLIEGTS---DDKAGQLPI 174

Query: 239 ILGEDAGIAERVISNARISMG----------QDLSEVDMENVSVFAERVVNLVEYRRQLY 288
            +  +A +++  +   R+SM           + +  + +E  S+    ++ L + +  + 
Sbjct: 175 NIEIEAKLSKEQVLVLRMSMQTSFLKNKPLEKKVKHLLLEACSM----IIQLTDLQNVIL 230

Query: 289 EYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK 348
           +Y+   +  +APNL  L+G  + + LI+H G +  L++  +  +  +G  + L   L T 
Sbjct: 231 QYISSNVSDIAPNLCVLVGPEVASLLIAHTGGILQLAEIPSCNLASIGKNRHLSHELHTT 290

Query: 349 -GNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID--NYSDDPTNVFGQVLKK 405
                + G IY S  +     +N  ++ R +  K ++A+R+D         ++ GQ  ++
Sbjct: 291 LSGVRQEGYIYSSELVQNQPIQNHKQMLRMVCAKVALAARVDAGQRGAAKNDLLGQRWRE 350

Query: 406 QVEQRLEFYATGSPTLKN 423
           ++E +++   T SP + N
Sbjct: 351 ELETKIQ-KVTESPNISN 367

>Suva_7.374 Chr7 (641967..643508) [1542 bp, 513 aa] {ON} YGR091W
           (REAL)
          Length = 513

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 104/219 (47%), Gaps = 10/219 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257
           Y   FPEL+ L+P   +++K+V  + ++    +ES   LS  L   A + +  +    +S
Sbjct: 139 YKERFPELSSLIPSPLQYSKVVTILENENWSGNES-DKLSIHLENKANLTKEQLLVLTMS 197

Query: 258 MGQDLSEV-----DMENVSVFAERVVN-LVEYRRQLYEYLCEKMHTVAPNLSELIGEVIG 311
           +    +       D + +   A  ++N L E ++ + +Y+  K+  +APN+  L+G  + 
Sbjct: 198 LKTSFNNQKPLVGDTKKLVFEAGSMLNNLWELQKDVGQYITSKISLIAPNMCFLVGSEVT 257

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 370
           A+L++HAG +   S+  +  +  +G  K L   L T +    + G ++++  I       
Sbjct: 258 AQLLAHAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFNTELIQDFPIAI 317

Query: 371 KGRISRYLANKCSMASRID--NYSDDPTNVFGQVLKKQV 407
             ++ R L  K ++A+R+D    S D   +  Q  K ++
Sbjct: 318 HRQMLRILCAKVTLAARVDAGQRSGDKNAILAQKWKAEL 356

>NDAI0G01290 Chr7 complement(284145..285635) [1491 bp, 496 aa] {ON}
           Anc_3.429 YGR091W
          Length = 496

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 85/196 (43%), Gaps = 4/196 (2%)

Query: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDL---SAILGEDAGIAERVISNA 254
           Y   F EL  +     ++A++V        L+   L++L    A L ++  I   +   +
Sbjct: 131 YSKKFNELDTITSSQLQYARIVKIFESHQDLSSGELNNLFENEAKLTKEQIIVLNISMKS 190

Query: 255 RISMGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARL 314
              +   L     + +    + +  L   +  +  Y+   +  +APNL  LIG  I A L
Sbjct: 191 SFDISFKLDHQKQKEILKSTDMITTLSALQELITHYITSNISHIAPNLCALIGSQIAALL 250

Query: 315 ISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASAKNKGR 373
           ISHAGS+ +LS+  +  +  +G  K     L T      + G IY    I    ++N  +
Sbjct: 251 ISHAGSILDLSQIPSCNLASIGKSKHQSHELHTSLSGVRQEGYIYDCDLIQDQPSENHKQ 310

Query: 374 ISRYLANKCSMASRID 389
           + R +  K S+A+R+D
Sbjct: 311 MLRMVCAKASLAARVD 326

>ADR032W Chr4 (763161..764480) [1320 bp, 439 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR091W (PRP31)
          Length = 439

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 91/196 (46%), Gaps = 12/196 (6%)

Query: 202 FPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARISMGQD 261
           FPELA+LVP    + +++  +   A L DE L    A+L          ++  R    + 
Sbjct: 93  FPELAELVPSQRTYVRVLRALETGAPL-DELLTREQAML----------VAMTRPQAPRA 141

Query: 262 LSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSL 321
                   ++  A+R   L      +  ++  + H +AP ++ L+G V+ A L+SHAGS+
Sbjct: 142 DPARWPRELAPHADRHEQLHTAVDAIDAHIVRQAHRLAPTVTALVGPVVAAALLSHAGSV 201

Query: 322 TNLSKQAASTVQILGAEKALFRALKTKGNTPKY-GLIYHSGFISKASAKNKGRISRYLAN 380
             L++  A  +  +GA +    A +T  +  +  G ++ +  + +     + +  R L  
Sbjct: 202 RELAQVPACNLAAIGAPRHAAHARRTDASGVRLRGHVWDTPLVQEQPPALQRQALRMLCA 261

Query: 381 KCSMASRIDNYSDDPT 396
           + ++A+R+D  + DP 
Sbjct: 262 RLALAARVDASAPDPA 277

>Smik_6.177 Chr6 (289760..291208) [1449 bp, 482 aa] {ON} YGR091W
           (REAL)
          Length = 482

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 98/219 (44%), Gaps = 10/219 (4%)

Query: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257
           Y   FPEL+ L+P   +++K+++ +  +     E +  L   L   A +++  +    +S
Sbjct: 120 YKERFPELSTLIPSPLQYSKVIILLEGEDWQKSE-IDKLFPQLENIAHLSKEQVLVLTMS 178

Query: 258 MGQDLSEVDMENVSVFAERVV------NLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIG 311
           M       +  N     + +       NL + +  L +Y+  K+  +APN+  L+G  + 
Sbjct: 179 MRTSFKSKEPLNFQTRTQILETNTILENLWQIQADLEQYIASKISLIAPNMCFLVGSEVT 238

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKT-KGNTPKYGLIYHSGFISKASAKN 370
           A+L+++AG +   S+  +  +  +G  K L   L T +    + G ++ +  I       
Sbjct: 239 AQLLAYAGGVLEFSRIPSCNIASIGKNKHLSHELHTLESGVRQEGYLFTTDLIQSFPVAI 298

Query: 371 KGRISRYLANKCSMASRID--NYSDDPTNVFGQVLKKQV 407
             ++ R L  K ++A+R+D     DD   V  Q  K ++
Sbjct: 299 HKQMLRMLCAKVTLAARVDAGQRYDDKNTVLAQKWKAEL 337

>Ecym_4449 Chr4 complement(919492..920880) [1389 bp, 462 aa] {ON}
           similar to Ashbya gossypii ADR032W
          Length = 462

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 101/218 (46%), Gaps = 13/218 (5%)

Query: 198 YGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISNARIS 257
           Y   FPEL  +V +  K+  +V  +  +  + +     L  +L ++  +   ++S    +
Sbjct: 101 YNKRFPELPNVVSEQEKYVSVVKELEARPDVPE-----LGKLLNKEQML---LVSMTMQT 152

Query: 258 MGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISH 317
                 +VD   ++   ++   L   +  +  Y+ +KMHT+APN+  L+G+ + A L+++
Sbjct: 153 GFHKEYKVDSPVIAELIDQYEVLHALKSDITTYISKKMHTIAPNVCALVGQEVAAALLTY 212

Query: 318 AGSLTNLSKQAASTVQILGAEKAL--FRALKTKGNTPKYGLIYHSGFISKASAKNKGRIS 375
            G +  LS+  +  +  +G  K L   + L T G   K G I+    +       + +  
Sbjct: 213 TGGMKELSEIPSCNLASIGKTKHLSHVQQLDTSGVRQK-GYIFDCELVQSQPEALQKQAL 271

Query: 376 RYLANKCSMASRID--NYSDDPTNVFGQVLKKQVEQRL 411
           R +  K ++ASR+D  ++ ++     G   K+++  +L
Sbjct: 272 RMICAKLALASRVDYLHHQENTHGSLGATWKEEILDKL 309

>SAKL0F06050g Chr6 (454404..455825) [1422 bp, 473 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091W PRP31
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 473

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 100/221 (45%), Gaps = 9/221 (4%)

Query: 194 VKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAILGEDAGIAERVISN 253
           +K  Y   F EL  LV     ++KL+ F+    + +   L  L  IL ++  +   V  +
Sbjct: 113 IKSLYSKKFSELDSLVNPPRSYSKLIKFLE---TSDARDLSTLEGILSKEQILI--VSMS 167

Query: 254 ARISMGQDLSEVDMENVSVFA--ERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGEVIG 311
            +    +DL+    E   +    + ++ L + + ++  ++  ++  +APN+  ++G  + 
Sbjct: 168 MKTGFKRDLALPSDEKTYLLTAIDMLIQLYDLQDEITSFIASQVINIAPNVCAIVGPQVA 227

Query: 312 ARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTK-GNTPKYGLIYHSGFISKASAKN 370
           ++++S AG L  LS+  +  +  +G ++ +   + T      + G +Y    I       
Sbjct: 228 SKILSAAGGLLELSQVPSCNLASIGKDRYMSHEINTDMSGVRQRGYVYSCSLIQDQPPHV 287

Query: 371 KGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQVEQRL 411
             +  R +  K S+A+R+D  S++  N  G     ++ ++L
Sbjct: 288 HKQALRMVCAKVSLAARVD-ISNNKDNSLGVKWANEISEKL 327

>KLLA0D14883g Chr4 (1254381..1255784) [1404 bp, 467 aa] {ON} weakly
           similar to uniprot|P49704 Saccharomyces cerevisiae
           YGR091W PRP31 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 467

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 16/222 (7%)

Query: 172 HIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDE 231
           ++I+   L+   D +++     + + Y   FP L  +VP+  ++  +V  ++      D 
Sbjct: 88  NVIKLGQLMPLFDTELSMVFQCIVDTYKAKFPGLETIVPERKQYVDVVKMLQ-----QDI 142

Query: 232 SLHDLSAILGEDAGIAERVISNARISMGQDLSE---VDMENVSVFAERVVNLVEYRRQLY 288
               L  +L ++  +   V+S   +S+  D  E   +D + +S        L   R  + 
Sbjct: 143 PNVQLDQVLSKEETL---VVS---MSLKTDFKEGARIDKDLLSKAIHWFDILYNLRDNVS 196

Query: 289 EYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALF-RALKT 347
            Y+  ++  VAPNL  L+G    A+L++H GS+  LS   +  +  +G +K L  ++L  
Sbjct: 197 HYVETRIQMVAPNLCALLGPDTAAKLVTHCGSVKELSVVPSCNLASIGQDKTLHGKSLDI 256

Query: 348 KGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRID 389
            G   K G ++++  +     + + +  R ++ K ++A+R D
Sbjct: 257 SGVRQK-GYLFYTDVVQTQPPEFQKQALRMVSAKVALAARAD 297

>KLTH0F12034g Chr6 complement(1015072..1016646) [1575 bp, 524 aa]
           {ON} weakly similar to uniprot|P49704 Saccharomyces
           cerevisiae YGR091W PRP31 Splicing factor component of
           the U4/U6-U5 snRNP complex
          Length = 524

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 115/274 (41%), Gaps = 26/274 (9%)

Query: 173 IIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDES 232
           I Q ++LL +L          +   Y   FPEL  L+     +AK+V  +  K     E 
Sbjct: 139 IQQEVSLLRKL----------IASIYDQKFPELESLIASANSYAKVVRLLETKGGGKLE- 187

Query: 233 LHDLSAILGEDA----GIAERVISNARISMGQDLSEVDMENVSVFAERVVNLVEYRRQLY 288
           L +L   +  +      +A         ++    SE+ M++++V  E    L + +  + 
Sbjct: 188 LQELQDTISREQLLVLSMAMHTGFRQETNLAPKDSELLMDSINVLLE----LCDLQDSIA 243

Query: 289 EYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALK-T 347
           +Y+   +  VAPNL  L+G    A LI+ AG L  LS+  +  +  +G  K +   L   
Sbjct: 244 QYVASLISQVAPNLCALVGPATSAALIAAAGGLLELSEMPSCNLASIGNSKRISSELDFH 303

Query: 348 KGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSDDPTNVFGQVLKKQV 407
           +    + G IYHS  +S      + +  R +  K S+  R+D   + P    G   ++ V
Sbjct: 304 ESGVRQRGHIYHSSLVSGQPVTIQKQALRMVCAKVSLCVRVDVSKNSPGGELGLKWRQDV 363

Query: 408 EQRLEFYATGSPTLKNEIAIQEAIALFNKDKPQE 441
            +RL       P L N  A+        +DKP++
Sbjct: 364 LKRLRGL-LDPPNLSNTKALP-----VPEDKPKK 391

>CAGL0G03025g Chr7 (280230..281669) [1440 bp, 479 aa] {ON} similar
           to uniprot|P49704 Saccharomyces cerevisiae YGR091w PRP31
           pre-mRNA splicing protein
          Length = 479

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 62/124 (50%), Gaps = 4/124 (3%)

Query: 291 LCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGN 350
           +  ++  +APNL  L+G    + L+SH G L  LSK  +  +  +G +      +    N
Sbjct: 229 IANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIGKKNTKDHNILNFSN 288

Query: 351 TPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDN--YSDDPTNVFGQVLKKQVE 408
               G I+ +  +     +N  ++ R L++K S+A+R+D    + D  N  G+  + ++E
Sbjct: 289 PG--GYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVDAGLKTGDKNNKLGKQWRVEIE 346

Query: 409 QRLE 412
           ++++
Sbjct: 347 EKIK 350

>TDEL0G02130 Chr7 (417378..420275) [2898 bp, 965 aa] {ON} Anc_1.174
           YKL173W
          Length = 965

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 92/218 (42%), Gaps = 47/218 (21%)

Query: 137 LLKDLQEGDLE--------------RAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQ 182
           LLKDL +G +E              R++ G     +R    F      N+++    L D+
Sbjct: 687 LLKDLMKGKIENSIIEDHKALAKLLRSEYGWDSLAARNVWSF----QGNNVLIDDTLPDE 742

Query: 183 LDKDI-NTFAMRVKEWYGWHFPE--LAKLVPDNYKFAKLVLFIRDKASLNDESLHDLSAI 239
            DKD+ N F  ++K+ +GW   E  LA+      +F KL         LN E    L  I
Sbjct: 743 TDKDLLNAFKQQIKQGFGWAIREGPLAEEPIHGVQF-KL---------LNAEGFQGL-GI 791

Query: 240 LGEDAGIAERVISNARIS----MGQDLSEVDMENVSVFAERVVNLVEYRRQLYEYLCEKM 295
            G+   I ++  S A ++    + + + EVD+   SV    +  L + RR    Y C+K+
Sbjct: 792 GGQLIPIVKKACSIAIMTASPILLEPIFEVDIIFQSVLLPIIEELFKKRRGGRIYRCDKI 851

Query: 296 HTVAPNLSEL---------IGEVIGARLISHAGSLTNL 324
             VA  LSE+         +G     RL +  G++  L
Sbjct: 852 --VATPLSEVRAQIPVIESVGFETDLRLATRGGAMCQL 887

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 11/112 (9%)

Query: 220 LFIRDKASLNDESLHDLSAILGEDAGIAERVISNARISM--------GQDLSEVDMENVS 271
           LF+    S++DE + DL  I   DA  + R IS  R           G+ +  V+++  S
Sbjct: 167 LFLETLNSMDDEHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQS 226

Query: 272 VFAERVVNLVEYRRQLYEYLCEKMHTVAPNLSELIGE---VIGARLISHAGS 320
            F    VN ++    +  +  E M  + PN  + + E   + G  +  H  +
Sbjct: 227 FFKSFYVNAIKKPLDIITFNSEPMKYIKPNEIDFMNEASALCGTTVFGHITT 278

>YCL014W Chr3 (96281..101191) [4911 bp, 1636 aa] {ON}  BUD3Protein
           involved in bud-site selection and required for axial
           budding pattern; localizes with septins to bud neck in
           mitosis and may constitute an axial landmark for next
           round of budding
          Length = 1636

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 159 RAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPD--NYKFA 216
           R K +   +K  N+II  I    +LD  +++++ RV    G    ELAK  P    YK+ 
Sbjct: 420 RPKNQEMAKKCYNNIIDVIDSFGKLDSPLHSYSTRVFTPSGKILTELAKCWPVELQYKWL 479

Query: 217 K-LVLFIRDKASLNDESLHDLSAILGE 242
           K  V+ + D   LNDE+  +L  I  +
Sbjct: 480 KRRVVGVYDVVDLNDENKRNLLVIFSD 506

>ADR389C Chr4 complement(1408968..1410146) [1179 bp, 392 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL042W
           (ERV46)
          Length = 392

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 58/133 (43%), Gaps = 11/133 (8%)

Query: 119 SNELAQDLLRGVRLHGAKLLKDLQEGDLE----RAQLGLGHAYSRAKVKFSVQKNDNHII 174
           +  L + +  G R+ G   L  +  G++      A +G GHA+  +  K     + NH+I
Sbjct: 190 TERLQEQINEGCRVAGTAQLNRVH-GNIHFAPGSAHVGKGHAHDDSFYKEHPHLSFNHVI 248

Query: 175 QAIALLDQLDKD---INTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFIRDKASLNDE 231
            +++   ++  +   +N  AM V   +   F   AK+VP  Y+   L   I + A  +  
Sbjct: 249 HSLSFGPEIAGNPGPLNGRAMEVPNGHSHFFSYFAKVVPIRYE--TLAGTITESAEFS-V 305

Query: 232 SLHDLSAILGEDA 244
           + HD     G DA
Sbjct: 306 TAHDRPVHGGRDA 318

>SAKL0F15202g Chr6 (1223198..1224565) [1368 bp, 455 aa] {ON} highly
           similar to uniprot|P47154 Saccharomyces cerevisiae
           YJR117W STE24 Highly conserved zinc metalloprotease that
           functions in two steps of a-factor maturation C-terminal
           CAAX proteolysis and the first step of N-terminal
           proteolytic processing contains multiple transmembrane
           spans
          Length = 455

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%)

Query: 128 RGVRLHGAKLLKDLQEGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALL 180
           R  +   +K L  + EG++++        YSRAK KFS+  N   +IQ +  +
Sbjct: 39  RQYKTLASKKLPPVLEGEIDKETFEKSEEYSRAKAKFSIFSNIYSLIQNLCFI 91

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 285 RQLYEYLCEKMHTVAPNLSELIGEVIGARLISHA 318
           ++LYEYL  K H      SEL  +++GA   +H+
Sbjct: 113 KELYEYLLAKKHIPLEECSELFSQIVGAVYYAHS 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,831,927
Number of extensions: 1874865
Number of successful extensions: 5875
Number of sequences better than 10.0: 78
Number of HSP's gapped: 6018
Number of HSP's successfully gapped: 78
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)