Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL020W6.46ON53952426630.0
Ecym_30496.46ON50150312601e-169
SAKL0E01980g6.46ON4654929561e-124
KLLA0C05852g6.46ON4824997752e-96
KLTH0C10582g6.46ON4814617663e-95
Kwal_56.225276.46ON4814387082e-86
ZYRO0C07172g6.46ON4504316964e-85
NCAS0H009006.46ON4954686794e-82
TDEL0G042406.46ON4444306467e-78
CAGL0J11792g6.46ON5104866431e-76
NDAI0D008906.46ON5394616337e-75
Smik_13.1066.46ON5065246185e-73
YML043C (RRN11)6.46ON5075276185e-73
Suva_13.1176.46ON5134855907e-69
Skud_13.1056.46ON5125155793e-67
KAFR0L004206.46ON4604315562e-64
KNAG0E009106.46ON4863215503e-63
TBLA0B005706.46ON5174654902e-54
TPHA0J005106.46ON4374454432e-48
Kpol_1037.116.46ON4013134132e-44
NCAS0B036308.331ON2447142850.13
Skud_10.1041.250ON54981689.0
TBLA0D00160singletonON41843689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL020W
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-synteni...  1030   0.0  
Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON} s...   489   e-169
SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {...   372   e-124
KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly...   303   2e-96
KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} simila...   299   3e-95
Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {...   277   2e-86
ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly...   272   4e-85
NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.4...   266   4e-82
TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.4...   253   7e-78
CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa...   252   1e-76
NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.4...   248   7e-75
Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {...   242   5e-73
YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON} ...   242   5e-73
Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {...   231   7e-69
Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {...   227   3e-67
KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46...   218   2e-64
KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {O...   216   3e-63
TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {O...   193   2e-54
TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {...   175   2e-48
Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON} (23974....   163   2e-44
NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8....    37   0.13 
Skud_10.104 Chr10 complement(177748..179397) [1650 bp, 549 aa] {...    31   9.0  
TBLA0D00160 Chr4 complement(36313..37569) [1257 bp, 418 aa] {ON}       31   9.3  

>ACL020W Chr3 (326268..327887) [1620 bp, 539 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML043C (RRN11)
          Length = 539

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/524 (94%), Positives = 495/524 (94%)

Query: 16  ASRCLISDNPKKPSLESSRLVLQPLWDALTMFESPIVSYSKRSKQQRALKYKYVSCVRRK 75
           ASRCLISDNPKKPSLESSRLVLQPLWDALTMFESPIVSYSKRSKQQRALKYKYVSCVRRK
Sbjct: 16  ASRCLISDNPKKPSLESSRLVLQPLWDALTMFESPIVSYSKRSKQQRALKYKYVSCVRRK 75

Query: 76  YEQLNGLSDSDKQAHIDSACFPTPDNSAAEASDGDALEGDVDTAAXXXXXXXXXXQSILG 135
           YEQLNGLSDSDKQAHIDSACFPTPDNSAAEASDGDALEGDVDTAA          QSILG
Sbjct: 76  YEQLNGLSDSDKQAHIDSACFPTPDNSAAEASDGDALEGDVDTAARRLKRKRLRLQSILG 135

Query: 136 HATXXXXXXXXXXXXXXXXXXXSTAKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKM 195
           HAT                   STAKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKM
Sbjct: 136 HATLDAEEGDLGSEEEDDLNGGSTAKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKM 195

Query: 196 LSYQAFKQIENYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVG 255
           LSYQAFKQIENYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVG
Sbjct: 196 LSYQAFKQIENYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVG 255

Query: 256 LLYSNIISENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFT 315
           LLYSNIISENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFT
Sbjct: 256 LLYSNIISENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFT 315

Query: 316 SHSVFSQNKVNLIDPVFRSGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVS 375
           SHSVFSQNKVNLIDPVFRSGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVS
Sbjct: 316 SHSVFSQNKVNLIDPVFRSGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVS 375

Query: 376 ELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSV 435
           ELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSV
Sbjct: 376 ELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSV 435

Query: 436 KNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPT 495
           KNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPT
Sbjct: 436 KNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPT 495

Query: 496 MVSETDFHDPNFRNFKPDVAEDDDTAFGELPTRFEVDSDYDSSE 539
           MVSETDFHDPNFRNFKPDVAEDDDTAFGELPTRFEVDSDYDSSE
Sbjct: 496 MVSETDFHDPNFRNFKPDVAEDDDTAFGELPTRFEVDSDYDSSE 539

>Ecym_3049 Chr3 complement(93199..94704) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ACL020W
          Length = 501

 Score =  489 bits (1260), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 252/503 (50%), Positives = 323/503 (64%), Gaps = 11/503 (2%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFESPI+SY+ + +++R LKYKY++ ++RKYE L G     K +  D++  PTP NSAAE
Sbjct: 1   MFESPIISYNSKDRKRRKLKYKYINSLKRKYEHLVGTQGGSKGSTKDTSGLPTPGNSAAE 60

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXS------T 159
           ASDGD  E D + +           QSILGHA                            
Sbjct: 61  ASDGDGREED-ELSRLRRRKRRIRLQSILGHAADEDEDEAEAEGAVGSEDDDGYEDGYLD 119

Query: 160 AKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLS 219
            KD EK F+++YY PE TYE+W TS  NR+PI+R+ +SY  F+ IE Y+++++ A+L+LS
Sbjct: 120 EKDPEKIFYSKYYVPEETYEVWTTSINNRIPIQRRSMSYHVFRTIEKYAHKKVAASLALS 179

Query: 220 TKKAAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRM 279
           +KK   + EV+R GYETCP+E +TNYQK+HL+HLV LLY NI+  ++ TAYRCF+LLIRM
Sbjct: 180 SKKLTGFFEVIRSGYETCPRERITNYQKVHLHHLVDLLYINILRGDFDTAYRCFSLLIRM 239

Query: 280 KSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAH 339
             VDLRS+WNLGS IL H N D  E+FLEWM TV TS+S F QN  N +DPVFRSGSR H
Sbjct: 240 NFVDLRSMWNLGSKILEHYNLDDQERFLEWMSTVLTSNSAFPQNSKNQLDPVFRSGSRTH 299

Query: 340 TPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFI 399
            PNF+L+WLWLVL  A  + V  S   + WLL+K+SELVLRPPYMDDAE+WF+YAMCYFI
Sbjct: 300 IPNFVLSWLWLVLENAVKERVFSSGHDINWLLDKISELVLRPPYMDDAEVWFIYAMCYFI 359

Query: 400 QADKLSAQLASHEGIK-LHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQ 458
           +ADKLS QL     +  L GS+LDIA+ QV + I  VKN L  C EKG F YP+R+I+ Q
Sbjct: 360 KADKLSLQLKQEGSLNGLKGSQLDIARNQVIENIHHVKNHLRICEEKGGFQYPKRVIEAQ 419

Query: 459 LLEFERRLY--AGTHKEQTDGNSFDTYESDTGEQNDNPTMVSETDFHDPNFRNFKPDVAE 516
           L+EFE+RLY  + TH       +F   ESDT E N       +  F     ++F      
Sbjct: 420 LVEFEKRLYPESSTHINYPGYETFPLEESDT-EDNLVSINFLQDRFDAQVIQDFNVQQPI 478

Query: 517 DDDTAFGELPTRFEVDSDYDSSE 539
           D+D  F E P  F + SDY  SE
Sbjct: 479 DEDGPFVEQPVHFGMGSDYSESE 501

>SAKL0E01980g Chr5 complement(150830..152227) [1398 bp, 465 aa] {ON}
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 465

 Score =  372 bits (956), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 195/492 (39%), Positives = 298/492 (60%), Gaps = 35/492 (7%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE P+V  +K+ + +R L+Y+Y++ + +K+EQLN      KQ    +   PTP++SAAE
Sbjct: 1   MFELPVVRTNKKIRSKRKLRYQYINTLNKKHEQLN----PKKQ----TVGLPTPESSAAE 52

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDYEK 165
            SD D LE   D+ +          QSILGHA                        DYEK
Sbjct: 53  TSDTDELE---DSQSKRTKRRKRRLQSILGHAVSSSDEDDISEEENDNDYEEC---DYEK 106

Query: 166 QFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAAA 225
               +YYKP+ TYELW T P+NRVP+    ++Y+ +K+I   +++R+  TLS S+K +AA
Sbjct: 107 HVKNKYYKPQETYELWTTGPENRVPLNTTSMTYKQYKKIHKAAHRRVTRTLSYSSKNSAA 166

Query: 226 YHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDLR 285
           +   +  GYE     ++ NYQ  H+ +L  LL+ N++ +NW  AYRCF++LIR+  VD+R
Sbjct: 167 FFSAIYNGYEPYETSQLENYQTTHIRNLTNLLHVNVMEQNWEIAYRCFSILIRLPGVDIR 226

Query: 286 SIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTPNFML 345
           SIW +G  IL  ++    E+FLEWM +VF++ + F+Q   + +DPVFRSGS+ HTP F+ 
Sbjct: 227 SIWGIGVRILKEIDRKRSEEFLEWMSSVFSTKNNFNQGTNHAMDPVFRSGSKTHTPKFVT 286

Query: 346 AWLWLVLRGATADEVLDSTR---SMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQAD 402
           +WLW  L G T+ +  +  R    + +L EK+SELVL PPYMDD +IWF+YA+C+ ++AD
Sbjct: 287 SWLWETLMGCTSKDENNGNRDVNKLQFLTEKISELVLTPPYMDDPKIWFIYALCHIVEAD 346

Query: 403 KLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQLLEF 462
            LS Q   +E IK +GS+ DIA+ QV Q+I + KN L++C+EKG F +P++ I++QL  F
Sbjct: 347 HLSQQFIENEHIK-NGSRRDIARNQVIQHITNAKNFLQTCQEKGGFQFPKQHIEKQLSNF 405

Query: 463 ERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPTMVSETDFHDPNFRNFKPDVAEDDDTAF 522
           E RLY  T       +  + ++SD+   N         +F+  +F++  P V E+++  F
Sbjct: 406 ENRLYQRTE------DLLNNFDSDSSASN---------EFNRQDFQDVNPIVYEEEN-VF 449

Query: 523 GEL-PTRFEVDS 533
           GEL   +F++D+
Sbjct: 450 GELGDAQFDIDT 461

>KLLA0C05852g Chr3 (518508..519956) [1449 bp, 482 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 482

 Score =  303 bits (775), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 278/499 (55%), Gaps = 27/499 (5%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLN-GLSDSDKQAHIDSAC--FPTPDNS 102
           MF+ P++  S R++++R ++Y+Y++ ++RKY+QLN   S++   +  D+      TP+NS
Sbjct: 1   MFQLPVIDRSSRNRKRRKIRYQYINSLKRKYDQLNYNQSEASVSSEADNVTNGILTPENS 60

Query: 103 AAEASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKD 162
            +  ++   LE                 QS+LG+A                    +   D
Sbjct: 61  ESSEAEAADLE--------KKHRRKRRLQSVLGNA------LDSSDEELDGDEDGTDEND 106

Query: 163 YEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKK 222
            E QF+  + KP++T+E+W  +   R PI+RK ++Y A K++E  + + +   L+  TKK
Sbjct: 107 PETQFYESHIKPQHTFEVWNVNTALRTPIQRKKITYNAVKKLEKAATKSVTKKLNYQTKK 166

Query: 223 AAAYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSV 282
              Y + ++ G++  PK +++  + +HL HL  LLY+N++++NW  AYRCF++LIR++ V
Sbjct: 167 LNMYFQALKFGFDVYPKPQLSKQKTMHLAHLNQLLYTNVLNQNWEIAYRCFSILIRLEDV 226

Query: 283 DLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTP 341
           D+RS+W++GS IL+ L +   +E +LEW+  VF S   F+Q     +DPVFR GSR HTP
Sbjct: 227 DVRSLWSIGSEILNSLGDTQSNEAYLEWLAHVFPSRVQFNQGTNYSLDPVFRCGSRTHTP 286

Query: 342 NFMLAWLWLVLRGATA-DEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQ 400
            F+L WLW  L  AT+    +D  + +  L++++ E+VL PPYMDD+EIW+++ + + + 
Sbjct: 287 TFVLTWLWTRLFIATSGSSAVDKEKFLQSLIDRLDEMVLSPPYMDDSEIWYIFGLTHLVM 346

Query: 401 ADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQEQLL 460
           A +LS++    + I L GS+ DIA+ QV Q+I + KNCL+ C+   N+ +PE +I+ QL+
Sbjct: 347 ASELSSKFRQSKDILL-GSRADIARNQVIQHINNAKNCLQMCKANSNYEFPENVIEHQLV 405

Query: 461 EFERRLY-----AGTHKEQTDGNSFDTYESDTGEQNDNPTMVSETDFHDPNFRNFKPDVA 515
           + ER LY          E    +  D  E     ++ N   V   D       N  P+V 
Sbjct: 406 QLERSLYTDELSVNCTDESAKSSDEDGIEHSYPNEDSNLPDVGPLDTQQYEIENLIPEVE 465

Query: 516 EDDDTAFGELPTRFEVDSD 534
             + T     P RF  +SD
Sbjct: 466 SAEFTVPA--PIRFGYESD 482

>KLTH0C10582g Chr3 (877398..878843) [1446 bp, 481 aa] {ON} similar
           to uniprot|Q04712 Saccharomyces cerevisiae YML043C RRN11
           rDNA transcription factor CF component which also
           contains Rrn6p and Rrn7p which is required for rDNA
           transcription by RNA polymerase I component of rDNA
           transcription factor
          Length = 481

 Score =  299 bits (766), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 169/461 (36%), Positives = 260/461 (56%), Gaps = 33/461 (7%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE P+V  +KR +  R L+Y+Y++ + ++Y ++   ++++       +  PTP+NSAAE
Sbjct: 1   MFELPLVRNTKRVRTVRKLRYQYINTLYQEYRKVQSFANAN-------STLPTPENSAAE 53

Query: 106 -ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDYE 164
            ASDGD    D   A            S+LGHA                    +   D E
Sbjct: 54  EASDGDHNSAD---ATSRRRRRKRRLLSVLGHAETDTELSDMEAEEGSHEADQA---DSE 107

Query: 165 KQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAA 224
           K+FF R+ KP+ T+E+W T  +  VP+    LSY   KQIE ++ +R+ A ++  +K A 
Sbjct: 108 KEFFTRHEKPQETFEVWNTDRQKAVPMNTATLSYDTCKQIEKHAQKRVSAGMAHISKNAN 167

Query: 225 AYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDL 284
            + + M+ GYET   E   ++  +H+  L  LL++NI+   W TAYRCF+LLIR+  +D+
Sbjct: 168 FHFQAMKDGYETV-AETPESHHLVHIAQLNELLHTNIMKGKWDTAYRCFSLLIRLPGIDI 226

Query: 285 RSIWNLGSHILSHL-----NFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAH 339
           RS+W  G+ IL  L          E+FL W+  +F+S S F+Q    L+DPVFR GS+ H
Sbjct: 227 RSVWGPGARILRELASNDKGLGTSEEFLGWLSGIFSSRSNFNQTMNFLMDPVFRCGSKTH 286

Query: 340 TPNFMLAWLWLVLRGATADEVLD------STRSMAWLLEKVSELVLRPPYMDDAEIWFLY 393
              F++AWLW +L  +  D          S R ++ LLE++SE+VL PPYM+D E+WF++
Sbjct: 287 AAKFVVAWLWELLFASCPDGTEHPSAEDASNRKLSHLLERLSEMVLIPPYMEDPEVWFIF 346

Query: 394 AMCYFIQADKLSAQLASHEGIKLHGSKL--DIAKTQVTQYICSVKNCLESCR-EKGNFTY 450
           A+C+ + AD+LS +  S    KL  S+L  DI++ QVTQ+I +   C+ +C  +K  F++
Sbjct: 347 AVCHLVSADQLSQRFIS---TKLRTSELERDISRNQVTQHITNAHMCIRTCEAKKEEFSF 403

Query: 451 PERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQN 491
           P RII+EQL  FE+RLY  +  E T  +    +E D   +N
Sbjct: 404 PRRIIEEQLACFEKRLYQNS-GESTASDLGSGFELDNSPEN 443

>Kwal_56.22527 s56 complement(168165..169610) [1446 bp, 481 aa] {ON}
           YML043C (RRN11) - component of rDNA transcription factor
           [contig 185] FULL
          Length = 481

 Score =  277 bits (708), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/438 (36%), Positives = 241/438 (55%), Gaps = 33/438 (7%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE P+   S R +  R L+Y+Y++ + +++ ++         AH   A  PTP+NSAAE
Sbjct: 1   MFELPLARNSNRVRTVRKLRYQYINSLSQEHRRIQ----DSAAAH---ATLPTPENSAAE 53

Query: 106 -ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDYE 164
            ASDGD    D + A            S+LGH                     S  ++ E
Sbjct: 54  DASDGDQ---DSEDAGSRRRRRKRRILSVLGHI---DSESELSDVDMSTESHHSELQESE 107

Query: 165 KQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAA 224
           K+FF+ + KP+ TYE W T  +  V +    LSY   K IE  + +R+   +   ++ A 
Sbjct: 108 KEFFSHHEKPQDTYETWNTDRRKAVSMTTATLSYAENKLIEARAQRRVIERIGHFSRIAR 167

Query: 225 AYHEVMRLGYETCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDL 284
           ++   ++ GYE   +     +Q  H+ HL  LL+ N++   W TA+RCF++LIR+  VD+
Sbjct: 168 SHFNSIKRGYEIYSRPSQV-HQTTHITHLNELLHINVMEGQWETAFRCFSILIRLPGVDI 226

Query: 285 RSIWNLGSHILSHL-----NFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAH 339
           RS+W LG  IL  L     N    ++FL W+  ++TS S F+     L+DPVFR+GS+ H
Sbjct: 227 RSMWGLGVRILRELSSTDKNVASSDEFLGWLSGIYTSRSNFNHTMNFLMDPVFRTGSKKH 286

Query: 340 TPNFMLAWLWLVLRGATADEVLD-------STRSMAWLLEKVSELVLRPPYMDDAEIWFL 392
           T  F+ AWLW +L  A  D++ +         R +  LLEK+SE+VL PPYM+D EIWF+
Sbjct: 287 TAKFVSAWLWEMLFAACPDKLEERQADNGSGNRKLIQLLEKLSEMVLIPPYMEDPEIWFI 346

Query: 393 YAMCYFIQADKLSAQ--LASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKG-NFT 449
           YA+C+ + AD+LS +      E  +L   + DI++ QVTQ+I +  NC+ +C  KG +F 
Sbjct: 347 YALCHLVSADELSQRFTFTYSESTEL---ERDISRNQVTQHITNAHNCIRTCEAKGDDFF 403

Query: 450 YPERIIQEQLLEFERRLY 467
           +P RII+EQL  FERRLY
Sbjct: 404 FPRRIIEEQLAFFERRLY 421

>ZYRO0C07172g Chr3 (541070..542422) [1353 bp, 450 aa] {ON} weakly
           similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043C RRN11 rDNA transcription factor CF component
           which also contains Rrn6p and Rrn7p which is required
           for rDNA transcription by RNA polymerase I component of
           rDNA transcription factor
          Length = 450

 Score =  272 bits (696), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 143/431 (33%), Positives = 232/431 (53%), Gaps = 33/431 (7%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE P+V  SKR++  R LKY+Y++ + +KY+ +NG+S+   +        PTP+NSA E
Sbjct: 1   MFELPLVITSKRTRTSRKLKYQYINNLSKKYDGINGISNGQTE-------LPTPENSATE 53

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDYEK 165
            S+ +      +             +SI+G +                        + E+
Sbjct: 54  TSENE------EVGQQKRRRIRKRLKSIIGES--------YSDLESDEEQPVEEVDNEER 99

Query: 166 QFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAAA 225
           +F+ +Y KP+ T+E W   P+ R PI+R  ++Y    +I+ +  +RM+ +L+++++    
Sbjct: 100 KFYRKYEKPQLTFEKWQCDPRKRTPIQRNRINYNRMNRIQRHGLRRMETSLAVASRTNKT 159

Query: 226 YHEVMRLGYETCPKE--EVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVD 283
           +      GY+           +Q  H+  L  LL+ N++   W  AY+CFALLIR+  VD
Sbjct: 160 FFHATTQGYQLFDPTYGRANTFQLKHIGTLTSLLHINVLKRKWELAYKCFALLIRIPGVD 219

Query: 284 LRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTPNF 343
           +R++W LG  IL+        +FL+WM +V+++   F+ +    + PVF  GS+ HTP +
Sbjct: 220 VRTLWGLGERILAERQPTRSLEFLQWMSSVYSTKLPFADDVNYRMAPVFTKGSKTHTPKY 279

Query: 344 MLAWLW-LVLRGATADEVLD-----STRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCY 397
              WLW  ++R A   E L+     +  +   L++++SE+VL PPYMDD E+WF+YA+C+
Sbjct: 280 TTTWLWECLIRYANGLEDLEMDSKSAAENFQSLMDRISEMVLGPPYMDDPEVWFIYALCH 339

Query: 398 FIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQE 457
            ++AD LS Q       +L GS  DIA  QV Q+I + K+ L+ C  KG FT+P+R I  
Sbjct: 340 MVKADTLSQQFDP----RLTGSARDIASNQVIQHIQNTKSHLQQCSSKGGFTFPKRYIAR 395

Query: 458 QLLEFERRLYA 468
           QL  FE RLY 
Sbjct: 396 QLAAFEARLYG 406

>NCAS0H00900 Chr8 (167875..169362) [1488 bp, 495 aa] {ON} Anc_6.46
           YML043C
          Length = 495

 Score =  266 bits (679), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 156/468 (33%), Positives = 248/468 (52%), Gaps = 37/468 (7%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MF+ P    +KR   +R ++Y Y++ + RKY + +           +S+  PTP+NSA+E
Sbjct: 1   MFDLPTQISNKRIANERKIRYTYINQLSRKYNRQDA----------ESSSLPTPENSASE 50

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDYEK 165
           + +    + +V              ++++G A                       ++ E+
Sbjct: 51  SHESTGEDEEVRRRRLKRRW-----KNVIGEAVSDTDEDEDGEEERED----EGPENQER 101

Query: 166 QFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAAA 225
           +FF  + KP+ +YE+W+T    R+P+++K +S+    +IE  + +RM+ +L  S+K    
Sbjct: 102 RFFKTHEKPQESYEIWSTDNNKRMPLQKKFISFSKLNKIEKSTKRRMQGSLLHSSKFNNI 161

Query: 226 YHEVMRLGYE-TCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVDL 284
             E +  G E   P     ++   H+ +L  LL+ N++   W  AY+ FAL++R+  VD+
Sbjct: 162 CFESISQGQELVTPLHTPESFTLKHIENLTNLLHINVMKGKWEVAYKIFALMVRIPKVDI 221

Query: 285 RSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTPNFM 344
           RSIW +G  ILS         FL WM +V++S   + Q   + +DPVFRSGS+ H+  F 
Sbjct: 222 RSIWGIGVKILSQRAATTTLDFLVWMNSVYSSRINYIQGMTHRVDPVFRSGSKTHSSKFT 281

Query: 345 LAWLWLVLRGAT---ADEVLDS------TRSMAWLLEKVSELVLRPPYMDDAEIWFLYAM 395
           + WLW  L   T    DE +DS         +  L+EKVSELVL PP+M+DAE+WF+YA+
Sbjct: 282 ITWLWKSLIYCTDTDNDEDIDSDYGGFGRDKLQILIEKVSELVLIPPFMEDAEVWFIYAL 341

Query: 396 CYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERII 455
           C+ ++AD+LS     ++    +GS  DIA+ +V Q I  VK  L++   KG+F YPER I
Sbjct: 342 CHMVKADQLSLNFNLNQS---NGSARDIARNEVIQNIQLVKTFLQTAMSKGHFEYPERFI 398

Query: 456 QEQLLEFERRLYAGTHKEQTDGNSFDTYESDTGEQNDNPT--MVSETD 501
             QL  FE RLY+   K++T+    D  ESD G   DN    +V ET+
Sbjct: 399 TRQLNTFEERLYS---KDETNSKDKDNNESDNGSSMDNGNIQLVPETN 443

>TDEL0G04240 Chr7 (770798..772132) [1335 bp, 444 aa] {ON} Anc_6.46
           YML043C
          Length = 444

 Score =  253 bits (646), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 137/430 (31%), Positives = 228/430 (53%), Gaps = 28/430 (6%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE P+   ++R +  + L+Y+YV+ +  K+ +L  +++++          PTP+NSAAE
Sbjct: 1   MFEQPVALTTRRLRNAKKLRYQYVNNLSAKFNRLERITNTN--------GLPTPENSAAE 52

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDYEK 165
           +S+ +        A                  +                      +D E+
Sbjct: 53  SSENEE-------ALQRKKKRIRRRLKSAAGESYSDSESDEVDNNHDNEVVEDEEEDQER 105

Query: 166 QFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAAA 225
           +F   Y  P+ ++E W   P  RVPI+R  +S+  ++++  ++ ++M  ++ L++K+   
Sbjct: 106 KFLNNYELPQESFEKWQDDPSKRVPIQRSKISFTKYQRLRRHAKRKMNTSIDLASKRNKI 165

Query: 226 YHEVMRLGYETC-PKE-EVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSVD 283
           Y + +  G+E   P + +   +Q  H++ L  LL+ ++    W  AY CFALLIR+  VD
Sbjct: 166 YMDTISEGFEMVDPVDGKPDTFQMKHISILTTLLHLHVSRREWDAAYTCFALLIRVPKVD 225

Query: 284 LRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTPNF 343
           +R+IW +G  IL         +FL WM +V++S S F+++  +   PVF  GS+ H P F
Sbjct: 226 IRNIWGIGDLILREREPIKSLEFLSWMSSVYSSRSAFAEDVNHRTPPVFTKGSKTHVPKF 285

Query: 344 MLAWLWLVLRGATAD-------EVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMC 396
              W+W  L   T +       E ++S   +  L+E++SE+VL PPYMD +E+WF+Y +C
Sbjct: 286 ATTWMWESLIQCTKNSLETGELEQIESNDGLQDLIERISEMVLAPPYMDASEVWFIYGLC 345

Query: 397 YFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPERIIQ 456
           + I+AD LS Q       +L GS  DIA  QV Q+I   K+CL++C  KG+F YP+R I+
Sbjct: 346 HLIKADILSNQFDG----RLAGSARDIASNQVIQHIQRTKSCLQTCLSKGDFKYPKRYIE 401

Query: 457 EQLLEFERRL 466
            QL EFE+RL
Sbjct: 402 RQLEEFEKRL 411

>CAGL0J11792g Chr10 complement(1150752..1152284) [1533 bp, 510 aa]
           {ON} similar to uniprot|Q04712 Saccharomyces cerevisiae
           YML043c RRN11 RNA polymerase I specific transcription
           initiation factor
          Length = 510

 Score =  252 bits (643), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 154/486 (31%), Positives = 244/486 (50%), Gaps = 46/486 (9%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE PI    +R   +R ++Y+Y++ + RKY      S   +QA+      PTP+NSA  
Sbjct: 1   MFEVPITYNCRRLNVERRVRYQYINILSRKY-HAKRRSKRRRQAN----SLPTPENSA-- 53

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKD--- 162
                 +E D   +           +  LG                        A D   
Sbjct: 54  ------VENDQSESQLPSREQIKEKKMKLGEDYSDSEAETSSEGEDTTKDDNEFANDMNK 107

Query: 163 YEKQFFARYYKPEYTYELW----ATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSL 218
           +EK F+ +Y KPE+++E+W    + + K +  +++  + Y    ++E  + +R++  +  
Sbjct: 108 FEKLFYRKYEKPEHSFEVWYDGNSVNTKKKHELKKTHIHYTRLNRVERIAKKRVEKNVVH 167

Query: 219 STKKAAAYHEVMRLGYETC-PKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLI 277
                  Y ++   GYE   P  ++ +Y   H+  L  +L+S++   NW  AYR F+LLI
Sbjct: 168 MPLVNKRYFDIKSEGYEVLEPLVDIDSYLLKHIEILTQILFSSVSQGNWDIAYRTFSLLI 227

Query: 278 RMKSVDLRSIWNLGSHILSHLNFDMHE-KFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGS 336
           R+  VD+R+IW LG+ IL          +FL+WM TV++S   F Q+  +   PVFRSGS
Sbjct: 228 RIPEVDIRNIWGLGTRILMERGQTTRSLEFLKWMSTVYSSKQNFVQSHCHRKAPVFRSGS 287

Query: 337 RAHTPNFMLAWLWLVL------------RGATADEVLDSTRS-------MAWLLEKVSEL 377
           R HTP + L WLW  L            +G   +E  +   S       +  L++K+SE+
Sbjct: 288 RTHTPKYALTWLWNCLIKVTELISIEEEKGVNTNEEENDNGSKQSAMDKLTELIDKISEM 347

Query: 378 VLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKN 437
           VL PPY+DD EIWF+Y+MC+ + AD LS +       +L GS+ DIA+ QVTQ+I  VK 
Sbjct: 348 VLVPPYLDDPEIWFIYSMCHMVHADYLSGKFNCQ---RLSGSRRDIARNQVTQHIHYVKT 404

Query: 438 CLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDG--NSFDTYESDTGEQNDNPT 495
            L++C +KGNF YP++ IQ +L EFE+R+Y    K +      S+D       +  +NP 
Sbjct: 405 YLQNCSQKGNFEYPKQFIQSRLEEFEKRMYEDESKPENMKLQESYDNTSYSNEDDEENPF 464

Query: 496 MVSETD 501
            + E++
Sbjct: 465 QIDESN 470

>NDAI0D00890 Chr4 (203085..204704) [1620 bp, 539 aa] {ON} Anc_6.46
           YML043C
          Length = 539

 Score =  248 bits (633), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 148/461 (32%), Positives = 235/461 (50%), Gaps = 45/461 (9%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE PI+  +KR+  +R ++Y Y++ + +KY   N   +     + ++   PTP++SA E
Sbjct: 1   MFELPIIYNNKRTATERKIRYTYINQLSKKY---NRTQNRHNNNNNNNGILPTPESSATE 57

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHA-------------TXXXXXXXXXXXXXX 152
           + D D                    +S++G A                            
Sbjct: 58  SHDDDDATTS--DDLIKRKRLRRRWKSVIGEAYSDTDLDDDDDDEEEEEDVDVEDEMSDH 115

Query: 153 XXXXXSTAKDYEKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRM 212
                   ++ E++FF +Y KP+ T+E+W T+   RVPI + M++Y   K+IE  + +++
Sbjct: 116 HESAHHIHENEERKFFKKYEKPQETFEIWQTNNLKRVPINKSMITYTKLKKIEKQAKRKI 175

Query: 213 KATLSLSTKKAAAYHEVMRLGYE-TCPKEEVTNYQKLHLNHLVGLLYSNIISENWGTAYR 271
              L  ++K      E M  G E   P   + N+   H+  L  LLY N+  ENW  AYR
Sbjct: 176 TVPLLHASKINKLCFEAMSEGLELVTPLVTIENFSLQHIEKLTTLLYLNVSRENWDIAYR 235

Query: 272 CFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPV 331
            F LLIR+K +D+RSIW +G  ILS  +      FL WM +V++S   F Q     +DPV
Sbjct: 236 IFTLLIRIKKLDIRSIWGIGVRILSEKSPTKTLDFLNWMNSVYSSRLNFIQGINYRMDPV 295

Query: 332 FRSGSRAHTPNFMLAWLW----------LVLRGATADEVLDSTRS-------------MA 368
           F+SGSR HTP + L WLW          ++     ++E L+   S             + 
Sbjct: 296 FKSGSRTHTPKYTLTWLWKSLIQYSTKKIISGNNNSNESLEDGSSSELDIDINIDRNNLL 355

Query: 369 WLLEKVSELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQV 428
            L+EK+SE+VL PP+M+D+E+WF+Y++C+ + AD LS++      +  +GS+ DI + QV
Sbjct: 356 DLIEKISEMVLIPPFMEDSEVWFIYSLCHMVLADDLSSKF---NPLISNGSRGDIERNQV 412

Query: 429 TQYICSVKNCLESCREKGNFTYPERIIQEQLLEFERRLYAG 469
            Q+I   K+ L++   KG+F YPE+ I +QL  +E+RLYA 
Sbjct: 413 IQHIQKTKSYLQTSMNKGDFEYPEKYILKQLSIYEQRLYAS 453

>Smik_13.106 Chr13 complement(183859..185379) [1521 bp, 506 aa] {ON}
           YML043C (REAL)
          Length = 506

 Score =  242 bits (618), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 266/524 (50%), Gaps = 48/524 (9%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE PI   +K+  Q+R LKY+Y++   R++E++   S +       +   PTP+NSAAE
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHTSRRFEKIVKKSTT-------ALSLPTPENSAAE 53

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXX-------QSILGHATXXXXXXXXXXXXXXXXXXXS 158
            ++ D  E + +  A                 +S++G                      +
Sbjct: 54  NNEEDDGERNGEGGAYRRLILQQRKRRRERHWKSVVGEIYSSTETESDSQEDAEEDEECN 113

Query: 159 TAK-----DYEKQFFARYYKPEYTYELWAT-SPKNRVPIRRKMLSYQAFKQIENYSNQRM 212
           T       D E++F+ +Y KPE ++E+W T S +N+ PI ++ ++Y  FK+IE  S ++M
Sbjct: 114 TEGKEEDIDEERKFWKKYEKPEESFEVWRTVSSQNKSPINKQKMTYHTFKKIEKNSLRKM 173

Query: 213 KATLSLSTKKAAAYHEVMRLGYETC--PKEEVTNYQKLHLNHLVGLLYSNIISENWGTAY 270
           +  L   TK++  + + +  G E       EV NY+  H+  L  LL+ N+   NW  AY
Sbjct: 174 EVPLLHCTKESKLHFQSLSKGLEPLQPSTSEVRNYRTKHIITLTNLLHLNVSRHNWSLAY 233

Query: 271 RCFALLIRMKSVDLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVFSQN-KVNLI 328
           + FA LIR+  V ++SIW +G  IL++  N      FL+WM  +++S   F Q+     I
Sbjct: 234 KIFATLIRIPGVQIKSIWGIGVEILNNSPNLSTSLDFLQWMCQIYSSKLRFVQSTNYRSI 293

Query: 329 DPVFRSGSRAHTPNFMLAWLWLVL----RGATADEVLDSTRSMAW-----LLEKVSELVL 379
            P F++GSR HT  F   +LW  L    +     ++ D    M       L++++SE VL
Sbjct: 294 VPPFQTGSRTHTSKFATTYLWSSLITCQKSMELPDINDKRYDMENDLLQDLIDRISEWVL 353

Query: 380 RPPYMDDAEIWFLYAMCYFIQADKLSAQLAS-HEGIKLHGSKLDIAKTQVTQYICSVKNC 438
            PP+M+DAE+WF+YA C+ ++AD LS Q A+ ++   L G   DI   QV ++I  VK  
Sbjct: 354 TPPFMEDAEVWFIYASCHLLKADILSRQFANDNKTSDLIGLDRDIKINQVIKHIHYVKVF 413

Query: 439 LESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYES-DTGEQNDNPTMV 497
           L++C +KG FT P R+I+ QL  FE RLY G  ++  +    D Y S D    N++   V
Sbjct: 414 LQTCSDKGGFTVPNRLIESQLKGFESRLY-GEAQDLREREMDDDYNSIDDNSVNNSFRDV 472

Query: 498 SET--DFHDPNFRNFKPDVAEDDDTAFGELPTRFEVDSDYDSSE 539
            ET  +F D    +  P     ++   GE+P      SD DSSE
Sbjct: 473 YETNAEFLDTQLMDLSP-----ENNQLGEIPY-----SDEDSSE 506

>YML043C Chr13 complement(190244..191767) [1524 bp, 507 aa] {ON}
           RRN11Component of the core factor (CF) rDNA
           transcription factor complex; CF is required for
           transcription of 35S rRNA genes by RNA polymerase I and
           is composed of Rrn6p, Rrn7p, and Rrn11p
          Length = 507

 Score =  242 bits (618), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 263/527 (49%), Gaps = 53/527 (10%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE PI   +++  Q+R LKY+Y++ + R+++++     S K    DS   PTP+NSAAE
Sbjct: 1   MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRI-----SKKSTTTDS--LPTPENSAAE 53

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQ--------SILGH---ATXXXXXXXXXXXXXXXX 154
            +D +  EG    A           +        S++G     T                
Sbjct: 54  NNDEE--EGQNSEAGTYRRSVLQQKKRRRERHWRSVVGEIYSTTESETDSQEEETEEGGE 111

Query: 155 XXXSTAK---DYEKQFFARYYKPEYTYELWAT-SPKNRVPIRRKMLSYQAFKQIENYSNQ 210
                 K   D E++F+ +Y KPE ++E+W T S +N+ PI ++ ++Y  FK+IE    +
Sbjct: 112 HDTGIDKEDSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKKIEKIPLR 171

Query: 211 RMKATLSLSTKKAAAYHEVMRLGYE--TCPKEEVTNYQKLHLNHLVGLLYSNIISENWGT 268
           +M+  L   TK+   Y + +  G E       EV NY+  H+  L  LL+ N+   NW  
Sbjct: 172 KMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSL 231

Query: 269 AYRCFALLIRMKSVDLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVFSQNKVNL 327
           AY+ FA LIR+  V ++S+W +G  IL +L N      FL+WM  +++S S F QN +N 
Sbjct: 232 AYKIFATLIRIPGVQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQN-INY 290

Query: 328 --IDPVFRSGSRAHTPNFMLAWLWLVL---------RGATADEVLDSTRSMAW-LLEKVS 375
             I P F++GSR HT  F + +LW  L              D+  D+   +   L++K+S
Sbjct: 291 RSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSMEPSSNIIDKPFDTENDLLQELIDKIS 350

Query: 376 ELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLAS-HEGIKLHGSKLDIAKTQVTQYICS 434
           E VL PP+M+DAE+WF+YA C+ ++AD LS Q  + ++   L G   DI   QV ++I  
Sbjct: 351 EWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVNDNKNNDLIGLDRDIKINQVIKHIHY 410

Query: 435 VKNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTH--KEQTDGNSFDTYESDTGEQND 492
           V+  L+ C +KG F  P R+I+ QL  FE RLY      +E+   N +D+ ++ + E + 
Sbjct: 411 VRTFLKICLDKGGFAVPSRLIENQLKSFESRLYGEAQDIQERDVANVYDSIDNSSVENSF 470

Query: 493 NPTMVSETDFHDPNFRNFKPDVAEDDDTAFGELPTRFEVDSDYDSSE 539
                +  +F D    +  P     +D    E+       SD DSSE
Sbjct: 471 GDVYETNAEFLDTQLMDLSP-----EDNGLDEMHY-----SDEDSSE 507

>Suva_13.117 Chr13 complement(186472..188013) [1542 bp, 513 aa] {ON}
           YML043C (REAL)
          Length = 513

 Score =  231 bits (590), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 246/485 (50%), Gaps = 48/485 (9%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE PI   +K+  Q+R LKY+Y++ + R+++++   S++       +   PTP+NSAAE
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHISRRFDRITKKSNT-------TDSLPTPENSAAE 53

Query: 106 AS-------------DGDALEGDVDTAAXXXXXXXXXXQSILGH---ATXXXXXXXXXXX 149
            +             + DA  G+               +S++G    +T           
Sbjct: 54  NNDEDYDDDEEERNYESDA--GESSIRQQTKRRRERHWKSVIGELYSSTETESDSQEEDD 111

Query: 150 XXXXXXXXSTA-----KDYEKQFFARYYKPEYTYELWAT-SPKNRVPIRRKMLSYQAFKQ 203
                    T       D E++F+ +Y KPE ++E+W T S  N+ PI ++ ++Y  +K+
Sbjct: 112 QEGDQVEHETRLKEEDTDEERKFWKKYEKPEKSFEVWQTVSSHNKSPINKQKITYHNYKK 171

Query: 204 IENYSNQRMKATLSLSTKKAAAYHEVMRLGYE--TCPKEEVTNYQKLHLNHLVGLLYSNI 261
           IE  S ++M+  L   TK+   Y +++  G E    P     NYQ  H+  L  LL+ N+
Sbjct: 172 IEKNSLRKMEIPLLHCTKENKLYFQLLAKGLEPLQSPTSAARNYQTRHIITLTNLLHLNV 231

Query: 262 ISENWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVF 320
              NW  AY+ FA LIR+ +V ++SIW +G  IL +  N      FL+WM  V++S S F
Sbjct: 232 SRHNWPLAYKIFATLIRIPNVQIKSIWGIGVKILDNSPNLSSSLDFLQWMCQVYSSKSRF 291

Query: 321 SQNKVNL--IDPVFRSGSRAHTPNFMLAWLWLVL---------RGATADEVLDSTRSMAW 369
            QN VN   + P F++GSR HT  F + +LW  L           AT ++       +  
Sbjct: 292 VQN-VNYRSVVPPFQTGSRTHTSKFAITYLWSCLISCQKSIESSNATDNQYDMENSRLEE 350

Query: 370 LLEKVSELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLAS-HEGIKLHGSKLDIAKTQV 428
           L++++SE VL PP+M+DAE++F+YA C+ ++AD LS Q  + +    L G   DI   QV
Sbjct: 351 LIDQISEWVLIPPFMEDAEVYFIYASCHLLKADLLSRQFVNDNRNNDLVGLNKDIKINQV 410

Query: 429 TQYICSVKNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTHKEQTDGNSFDTYESDTG 488
            + I  VK  L++C +KG FT P R+I+ QL  FE RLY G  ++  +    D Y++   
Sbjct: 411 IKNIHYVKVFLQTCLDKGGFTIPNRLIENQLKSFESRLY-GEAQDIHERRMVDDYDNTDN 469

Query: 489 EQNDN 493
              DN
Sbjct: 470 SSADN 474

>Skud_13.105 Chr13 complement(181845..183383) [1539 bp, 512 aa] {ON}
           YML043C (REAL)
          Length = 512

 Score =  227 bits (579), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 163/515 (31%), Positives = 257/515 (49%), Gaps = 53/515 (10%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE PI   +K+  Q+R LKY+Y++ + R+++++   +++       +   PTP+NSA E
Sbjct: 1   MFEVPITLTNKKFAQRRKLKYQYINHLSRRFDKVAKTTNT-------TDSLPTPENSAVE 53

Query: 106 ASDGDAL---------EGDV---DTAAXXXXXXXXXXQSILGHA-TXXXXXXXXXXXXXX 152
            +D D           E DV                 +S++G   +              
Sbjct: 54  NNDDDYDYDEDEEQIDEADVYRRSILQQTKRRRERHWKSVVGELYSSTETESDSQQEEIQ 113

Query: 153 XXXXXSTAK-----DYEKQFFARYYKPEYTYELWAT-SPKNRVPIRRKMLSYQAFKQIEN 206
                 T +     D E++F+ ++ KPE ++E+W T S +N+ PI R+ ++Y  F++I+ 
Sbjct: 114 ENDGRETGRKNGDTDEERKFWKKHEKPERSFEIWQTASLQNKGPINRRKMTYHKFQKIQK 173

Query: 207 YSNQRMKATLSLSTKKAAAYHEVMRLGYE--TCPKEEVTNYQKLHLNHLVGLLYSNIISE 264
            S ++++  L   TK+   Y   +  G E    P   + NYQ  H+  L  LL+ N+   
Sbjct: 174 NSLRKVQIPLLHCTKENRLYFRSLSKGLEPLQTPTSTIRNYQTRHIITLTNLLHINVSRH 233

Query: 265 NWGTAYRCFALLIRMKSVDLRSIWNLGSHILSHL-NFDMHEKFLEWMGTVFTSHSVFSQN 323
           NW  AYR FA LIR+  V ++SIW  G  IL +L +      FL+WM  +++S + F QN
Sbjct: 234 NWSLAYRIFATLIRIPEVQMKSIWGFGVKILDNLPDSSSSLDFLQWMCQIYSSKARFVQN 293

Query: 324 KVN--LIDPVFRSGSRAHTPNFMLAWLWLVL----RGATADEVLDSTRSM-----AWLLE 372
            +N   I P F++GSR HT  F   +LW  L    +      + D    M       L++
Sbjct: 294 -INHRSIVPPFQTGSRTHTAKFATTYLWASLINCQKSIEPSTINDKHYDMENDRLQELID 352

Query: 373 KVSELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIK--LHGSKLDIAKTQVTQ 430
           K+SE VL PP+M+DAE+WF+YA C+ ++AD LS Q  + +G K  L G   DI   QV +
Sbjct: 353 KISEWVLTPPFMEDAEVWFIYASCHLLKADILSRQFVN-DGTKGDLIGLDRDIKINQVIK 411

Query: 431 YICSVKNCLESCREKGNFTYPERIIQEQLLEFERRLYAGTH----KEQTDGNSFDTYESD 486
           +I  VK  L++C +KG FT P R+I+ QL  FE RLY  T     +E  DG  +D  +  
Sbjct: 412 HIHYVKVFLQTCLDKGGFTIPNRLIEIQLKNFELRLYGETQDVQEREIVDG--YDETDIS 469

Query: 487 TGEQNDNPTMVSETDFHDPNFRNFKPDVAEDDDTA 521
           + E +      +  +F D    +  P   ED++ A
Sbjct: 470 SVENSFGDVYETNAEFLDTQLMDLSP---EDNEMA 501

>KAFR0L00420 Chr12 (77468..78850) [1383 bp, 460 aa] {ON} Anc_6.46
           YML043C
          Length = 460

 Score =  218 bits (556), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/431 (32%), Positives = 212/431 (49%), Gaps = 41/431 (9%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAAE 105
           MFE P+   SK    +R L+Y+Y++   R++E+ +           D     TP+ S  E
Sbjct: 1   MFEIPVNVNSKTLSNERKLRYRYINQFTRRFERKD-----------DRNGMITPETSEDE 49

Query: 106 ASDGDALEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXSTAKDY-- 163
                  +                   ++G                         +DY  
Sbjct: 50  LQQRKKRDW----------------LHVIGEYGSDDDERSGGQQDDEEEEEEVIDEDYNL 93

Query: 164 ---EKQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLST 220
              E++FF +  KP+ TYE W  S + +  I+R +L+Y  + ++  Y  ++M  +L   +
Sbjct: 94  NNEERKFFKKIDKPQETYEHWP-SHRKKTRIQRDILTYHRYNKVSRYVERKMANSLVHVS 152

Query: 221 KKAAAYHEVMRLGYETCP--KEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIR 278
            K   + +    G E      +  TN+Q   +  L  LLY N+   NW  AY+ FA+LIR
Sbjct: 153 SKNRYHFKCKIDGMEIVEPLHKGATNFQLKQIETLTNLLYLNVNRGNWEIAYKIFAMLIR 212

Query: 279 MKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRA 338
           +  VD+RS+WN+G+ IL   +     +FLEWM +V+++   F Q      DPVFRSGS+ 
Sbjct: 213 IPKVDIRSVWNVGNRILYEKDKLRSLEFLEWMSSVYSTRVTFIQGINYRFDPVFRSGSKN 272

Query: 339 HTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYF 398
           HTP + L WLW  L   T     +   ++  L++K++E+VL PP+MDD EIWF+Y+MC+ 
Sbjct: 273 HTPKYTLQWLWNSLLEYTEQLFENDDENIDKLIDKIAEMVLIPPFMDDPEIWFIYSMCHM 332

Query: 399 IQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREK--GNFTYPERIIQ 456
           ++AD LS++  +H      GS  DI+  QV Q+I  VK  L  C+EK  G +   E II 
Sbjct: 333 VKADFLSSKFDTHSV----GSMRDISMNQVIQHINDVKRYLNVCKEKSQGQYESNEMIIT 388

Query: 457 EQLLEFERRLY 467
           +QL  FE RLY
Sbjct: 389 KQLKAFEVRLY 399

>KNAG0E00910 Chr5 complement(171075..172535) [1461 bp, 486 aa] {ON}
           Anc_6.46 YML043C
          Length = 486

 Score =  216 bits (550), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/321 (37%), Positives = 183/321 (57%), Gaps = 17/321 (5%)

Query: 165 KQFFARYYKPEYTYELWATSPKNR-VPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKA 223
           +++F  + KPE  YE+W  + + R VPI+R+ +SY   + IE  + ++M+  L   ++  
Sbjct: 110 RKYFKNHEKPEDLYEVWHVATERRKVPIQRQFVSYNRLQTIERRAKRKMEVPLLHVSRVR 169

Query: 224 AAYHEVMRLGYETCPK-EEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRMKSV 282
           ++       GY+   + +E T+++  H+  LV LL+ +I +ENW  AY+ FALLIRM  V
Sbjct: 170 SSEFSAEIDGYDVVSRGDETTHFENKHIQLLVTLLHRHISTENWNLAYKVFALLIRMPRV 229

Query: 283 DLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPVFRSGSRAHTPN 342
           D+R++WNLG  IL+  +      FLEWM +V+++   F QN  + + P FRSGSR HT  
Sbjct: 230 DIRAVWNLGVAILARRDSTTAIDFLEWMHSVYSNKHRFIQNVNHRLPPAFRSGSRTHTAQ 289

Query: 343 FMLAWLWLVLRGAT--ADEVLDST-RSMAWLLEKVSELVLRPPYMDDAEIWFLYAMCYFI 399
           +   WLWL LR AT  A E   +T   +  L +K SEL+L PPYMDD+E+WF+Y  CYF+
Sbjct: 290 YTTTWLWLSLRAATEQAQEGAPTTLEPLELLTDKTSELLLTPPYMDDSEVWFIYCSCYFV 349

Query: 400 QADKLSAQLASHEGIKLHG---SKLDIAKTQVTQYICSVKNCLESCREKGN--------- 447
           +AD LS  + S     +H    S +D+ + +V Q I   +  L +  EK +         
Sbjct: 350 KADILSRNIHSDLTHNVHAFSSSTMDLRRNEVVQSITRCQKTLHTAEEKSDQARHRAHAY 409

Query: 448 FTYPERIIQEQLLEFERRLYA 468
           +  P   I+ QL + E+RL A
Sbjct: 410 WELPTGYIKRQLQQIEKRLTA 430

>TBLA0B00570 Chr2 complement(113646..115199) [1554 bp, 517 aa] {ON}
           Anc_6.46 YML043C
          Length = 517

 Score =  193 bits (490), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/465 (26%), Positives = 234/465 (50%), Gaps = 63/465 (13%)

Query: 46  MFESPIVSYSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDS------ACFPTP 99
           MFE+P+  +SK    +R ++Y+Y++   ++Y QL G  D+   + ++S         PTP
Sbjct: 1   MFEAPLNIHSKVLANERKIRYQYINTFTKRYSQLYG--DTIPSSSLESNRSRTPITLPTP 58

Query: 100 DNSAAEASDGDA-LEGDVDTAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXS 158
           + SA E SD +     D D+ +           S                         +
Sbjct: 59  EASAHEHSDSNTNYNDDSDSISNTNTLSDDEYNS-----------------------DST 95

Query: 159 TAKDYEKQFFARYYKPEYTYELWATS-----------PKNRVPIRRKMLSYQAFKQIENY 207
              + E +FF RY +P+ ++E+W TS              R+PI R  +S+    +++ +
Sbjct: 96  GTTNEETKFFNRYDRPQESFEVWNTSIDTLNSKTKLKSNGRIPINRNKISFNRLNRVKKF 155

Query: 208 SNQRMKATLSLSTKKAAAYHEVMRLGYETCPKE-EVTNYQKLHLNHLVGLLYSNIISENW 266
           +N++++A L   TK+   + + +  GYET  ++ + T++  +H+ +L+ LLY NI  +N+
Sbjct: 156 TNKKLEARLQHCTKRLKTHIKAISEGYETSYRDKQTTSFNNIHIENLINLLYYNICEKNF 215

Query: 267 GTAYRCFALLIRMKSVDLRSIWNLGSHI-LSHLNFDMHEKFLEWMGTVFTSHSVFSQNKV 325
             AY  F+L+IR+ ++D+R+ WNLGS I L  ++      FL W+ ++++S+  ++ N +
Sbjct: 216 NQAYHIFSLIIRLPNIDIRNFWNLGSIILLKKVSIQESLNFLNWIHSIYSSNQKYN-NSI 274

Query: 326 NL-IDPVFRSGSRAHTPNFMLAWLWLVL-------RGATADEVLDSTRSMAW-------L 370
           N    P F   SR HT  F  ++LW+ L          T+  + +    + +        
Sbjct: 275 NYKTAPAFTQSSRNHTGKFTTSFLWMTLSLIHTKFSDLTSRNIKEIVEELNYLKKKLKKF 334

Query: 371 LEKVSELVLRPPYMDDAEIWFLYAMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQ 430
           +EK+SE+VL PP+++D+EIW++Y++ + I A  L  +  +++ I     + DI K ++  
Sbjct: 335 VEKLSEMVLAPPFIEDSEIWYIYSLSHLILARMLMFETRNND-ISQTSVEKDITKNEIIS 393

Query: 431 YICSVKNCLESCREKGN-FTYPERIIQEQLLEFERRLYAGTHKEQ 474
            I   K+ L+  RE  N + +  + I+ +L + E++LY  +  E+
Sbjct: 394 NIQHCKSHLQKVRENQNDYNFKFQKIEIELKDMEKKLYDTSSDEE 438

>TPHA0J00510 Chr10 complement(114098..115411) [1314 bp, 437 aa] {ON}
           Anc_6.46 YML043C
          Length = 437

 Score =  175 bits (443), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/445 (27%), Positives = 210/445 (47%), Gaps = 38/445 (8%)

Query: 46  MFESPIVS-YSKRSKQQRALKYKYVSCVRRKYEQLNGLSDSDKQAHIDSACFPTPDNSAA 104
           MFE P+ S  +  +   + L+Y+Y++ +  K+   N LS ++          PTP  S  
Sbjct: 1   MFELPVSSNITINAFNLKKLRYQYINDINAKH---NELSKNE---------LPTPVTSEN 48

Query: 105 EASDGDALEGDVD------TAAXXXXXXXXXXQSILGHATXXXXXXXXXXXXXXXXXXXS 158
           +   G+ L+GD +       A           +SI+G A                    +
Sbjct: 49  DTG-GEDLDGDSEHNLTSEDAEVAQERRIRRWKSIMGEAIDDDEDDNNHDDDVDNEFEDN 107

Query: 159 TAKDYEKQFFARYYKPEYTYELWATSP-KNRVPIRRKMLSYQAFKQIENYSNQRMKATLS 217
              D EK++F RY KP+ ++E W ++  K +  + +  ++Y  FK+     +++ K    
Sbjct: 108 GPTDEEKKYFLRYDKPQESFEKWESNNLKRQRHVNKNFITYYRFKKTRKQIDKKYKVKTM 167

Query: 218 LSTKKAAAYHEVMRLGYETCPKEEVT------NYQKLHLNHLVGLLYSNIISENWGTAYR 271
              K      E+M  G+E      ++      NY K HL+ L  L+YSNI  + W  AY+
Sbjct: 168 HLNKNVKNNFELMIDGFEPINDNNISRNRNLQNYNKHHLSLLTDLMYSNIFKQKWDIAYK 227

Query: 272 CFALLIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHSVFSQNKVNLIDPV 331
           CF  L+R+  VD+R +WNLGS IL +++      FL+W+  V+++ +      +N  +  
Sbjct: 228 CFTFLLRIPDVDIRRVWNLGSIILQNIDTTKLIDFLQWLSNVYSNKNRSFVQGINYRNDQ 287

Query: 332 --FRSGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEI 389
             F  GSR  TP +    LW  L  ++  E  +S   +  L+E+++E+V+ PPY +D EI
Sbjct: 288 TNFNGGSRRLTPLYTKTLLWHKLTLSSDSETCES--EIDSLIEQIAEMVVIPPYSEDNEI 345

Query: 390 WFLYAMCYFIQADKLSAQL-------ASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESC 442
           W+++A+C+ ++AD LS +L          + +  +    +I   ++T  I + K  L   
Sbjct: 346 WYIFALCHLVKADNLSEKLYFMSRRNPEVDEMDTYPYDTEIYNNKITICINNCKKYLRKA 405

Query: 443 REKGNFTYPERIIQEQLLEFERRLY 467
            +  NF YP R I+ +L   E R +
Sbjct: 406 TQDKNFDYPARTIETKLKTIETRTF 430

>Kpol_1037.11 s1037 (23974..25179) [1206 bp, 401 aa] {ON}
           (23974..25179) [1206 nt, 402 aa]
          Length = 401

 Score =  163 bits (413), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 166/313 (53%), Gaps = 21/313 (6%)

Query: 165 KQFFARYYKPEYTYELWATSPKNRVPIRRKMLSYQAFKQIENYSNQRMKATLSLSTKKAA 224
           K++F+RY KPE ++E WA++ K+R  I RKM+SY+ + ++  YS ++++  L  S +K  
Sbjct: 97  KKYFSRYDKPEDSFERWASNTKHRKSINRKMMSYKKYNKLTKYSRKKIQVPLIRSNRKLQ 156

Query: 225 AYHEVMRLGYETCP-----KEEVTNYQKLHLNHLVGLLYSNIISENWGTAYRCFALLIRM 279
                +  GYE        KE   N+  +++  L  L+Y +I  ENW  AYRCF LLIR+
Sbjct: 157 ENFLSVIDGYELIDDNINLKE---NFTMVNVKLLTDLMYESIFKENWKIAYRCFTLLIRL 213

Query: 280 KSVDLRSIWNLGSHILSHLNFDMHEKFLEWMGTVFTSHS-----VFSQNKVNLID-PVFR 333
               +R IWNLGS I+   N +   K +E++      HS     +F+Q  VN  + PVF 
Sbjct: 214 PKTSIRKIWNLGSMIIE--NLEGINKTIEFLKLFNNIHSRYKKKIFNQT-VNYREAPVFN 270

Query: 334 SGSRAHTPNFMLAWLWLVLRGATADEVLDSTRSMAWLLEKVSELVLRPPYMDDAEIWFLY 393
            GSR  TP ++   LW  +   +      S  +   L+E +SEL L PP+M+D+EIW++Y
Sbjct: 271 DGSRNKTPIYIKTLLWKEITTTSTSSRTSSNYNE--LIEYLSELTLIPPFMEDSEIWYIY 328

Query: 394 AMCYFIQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLESCREKGNFTYPER 453
            + +  +A++LS  L  +  I    S  DIA  +V Q I   +  L+  +E      PER
Sbjct: 329 GIVHLQRANELSMNLEHY--IDNSSSSKDIANNEVVQNIKLAQKFLKKAKELSKIEVPER 386

Query: 454 IIQEQLLEFERRL 466
            I   +   E R+
Sbjct: 387 QITLMIKNIEGRM 399

>NCAS0B03630 Chr2 (643499..650842) [7344 bp, 2447 aa] {ON} Anc_8.331
            YDR150W
          Length = 2447

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 66/142 (46%), Gaps = 10/142 (7%)

Query: 199  QAFKQIENYSNQRMKATLS------LSTKKAAAYHEVMRLGYETCPKEEVTNYQKLHLNH 252
            +  ++IEN +N  +++ L+      +ST+K A  HE +    E   +E+    Q L L  
Sbjct: 1025 ELLRRIENPTNNELESILAKENKTIISTQKLADLHESLNKPSEGYLREKA---QTLDLIL 1081

Query: 253  LVGLLYSNIISENWGTAYRCFAL-LIRMKSVDLRSIWNLGSHILSHLNFDMHEKFLEWMG 311
            L    Y+++  +N    +   +L  + + +VD+  + NL    +S+ N D   K L  +G
Sbjct: 1082 LSADDYTSLKEKNKDKNFLITSLSTMGLATVDINELSNLKEASVSNSNLDQLTKRLNDLG 1141

Query: 312  TVFTSHSVFSQNKVNLIDPVFR 333
             V  +   F +    L+D V +
Sbjct: 1142 YVPVTQEQFEEFSTPLVDKVNK 1163

>Skud_10.104 Chr10 complement(177748..179397) [1650 bp, 549 aa] {ON}
           YJL110C (REAL)
          Length = 549

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 192 RRKMLSYQAFKQIENYSNQRMKATLSLSTKKAAAYHEVMRLGYETCPKEEVTNY------ 245
           + K+L++ ++  I+ YSN         S+ K+A+  E+ + G  + P   V +       
Sbjct: 287 QEKLLTFPSYTDIKEYSN---------SSVKSASNKELPQFGASSLPPNAVASKTGADSP 337

Query: 246 QKLHLNHLVGLLYSNIISENW 266
           Q  HL+ L+G L S  IS N 
Sbjct: 338 QLPHLSMLLGSLNSTSISNNM 358

>TBLA0D00160 Chr4 complement(36313..37569) [1257 bp, 418 aa] {ON} 
          Length = 418

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 10/43 (23%), Positives = 22/43 (51%)

Query: 399 IQADKLSAQLASHEGIKLHGSKLDIAKTQVTQYICSVKNCLES 441
           +  + +  ++A    +K+HG   D  K  +  Y+ + KNC+ +
Sbjct: 142 VYGNDIHGEIAKENKVKIHGLTKDDMKQYIKDYVAAAKNCIAA 184

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,403,455
Number of extensions: 2344693
Number of successful extensions: 7202
Number of sequences better than 10.0: 32
Number of HSP's gapped: 7337
Number of HSP's successfully gapped: 39
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)