Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL005C6.30ON1221226368e-87
SAKL0E01562g6.30ON1221225664e-76
KLLA0C06160g6.30ON1211185631e-75
TDEL0G043906.30ON1221225603e-75
Kwal_56.224726.30ON1221225552e-74
Suva_15.1696.30ON1221225543e-74
Skud_15.1576.30ON1221225543e-74
ZYRO0C07502g6.30ON1221225501e-73
Smik_15.1656.30ON1201205491e-73
YOL005C (RPB11)6.30ON1201205491e-73
KAFR0A051106.30ON1221225456e-73
CAGL0E02453g6.30ON1201205447e-73
KLTH0C10934g6.30ON1221225431e-72
Kpol_1037.216.30ON1201205333e-71
NCAS0D021206.30ON1221225334e-71
KNAG0F029106.30ON1221205291e-70
TPHA0J004106.30ON1201205282e-70
TBLA0E031506.30ON1181185249e-70
NDAI0C026706.30ON1221225241e-69
TPHA0B029202.163ON130921229e-09
CAGL0L03872g2.163ON137921211e-08
Kpol_165.22.163ON128921211e-08
NCAS0G025502.163ON1501021184e-08
SAKL0E10692g2.163ON1311021141e-07
Suva_14.2252.163ON1421041141e-07
KAFR0B045702.163ON131911104e-07
TBLA0B012902.163ON102861085e-07
KNAG0I020602.163ON134901096e-07
Ecym_54232.163ON127901097e-07
TDEL0F011802.163ON1291021097e-07
YNL113W (RPC19)2.163ON1421021099e-07
Smik_14.2142.163ON1421021071e-06
ZYRO0B09878g2.163ON130621062e-06
KLLA0F23760g2.163ON127881018e-06
Skud_14.2182.163ON1561041038e-06
AFL220C2.163ON1351011011e-05
NDAI0F027502.163ON149901011e-05
KLTH0D09350g2.163ON146711002e-05
Kwal_26.84732.163ON15071958e-05
YHL030W (ECM29)4.15ON186868670.99
TBLA0H00730singletonON28535624.5
NDAI0G050601.423ON70862609.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL005C
         (122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON} Sy...   249   8e-87
SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly ...   222   4e-76
KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {O...   221   1e-75
TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON...   220   3e-75
Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C...   218   2e-74
Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {O...   218   3e-74
Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {O...   218   3e-74
ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {O...   216   1e-73
Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {O...   216   1e-73
YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}  ...   216   1e-73
KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {...   214   6e-73
CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {O...   214   7e-73
KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {O...   213   1e-72
Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON...   209   3e-71
NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON...   209   4e-71
KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON...   208   1e-70
TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30 ...   207   2e-70
TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON...   206   9e-70
NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30...   206   1e-69
TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.16...    52   9e-09
CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {...    51   1e-08
Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON} com...    51   1e-08
NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.16...    50   4e-08
SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {O...    49   1e-07
Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W...    49   1e-07
KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON...    47   4e-07
TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.16...    46   5e-07
KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON...    47   6e-07
Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON} ...    47   7e-07
TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.16...    47   7e-07
YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA p...    47   9e-07
Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W...    46   1e-06
ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa] {O...    45   2e-06
KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa] ...    44   8e-06
Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W...    44   8e-06
AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON} Synt...    44   1e-05
NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON...    44   1e-05
KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {O...    43   2e-05
Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON...    41   8e-05
YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffo...    30   0.99 
TBLA0H00730 Chr8 complement(163394..164251) [858 bp, 285 aa] {ON}      28   4.5  
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    28   9.2  

>ACL005C Chr3 complement(346569..346937) [369 bp, 122 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL005C
           (RPB11)
          Length = 122

 Score =  249 bits (636), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF
Sbjct: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120

Query: 121 RL 122
           RL
Sbjct: 121 RL 122

>SAKL0E01562g Chr5 (120177..120545) [369 bp, 122 aa] {ON} highly
           similar to uniprot|P38902 Saccharomyces cerevisiae
           YOL005C
          Length = 122

 Score =  222 bits (566), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 106/122 (86%), Positives = 115/122 (94%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLLPEGESKL IEPDTKA NAVIITFEKEDHTLGN+IRAELLED+RVLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLNIEPDTKAPNAVIITFEKEDHTLGNLIRAELLEDQRVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFARF+MRIQT EGYDPK+ALKNACN+II KLA L+SNFETEW+LQTLASE+ +
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNNIITKLAQLQSNFETEWSLQTLASEENY 120

Query: 121 RL 122
            L
Sbjct: 121 GL 122

>KLLA0C06160g Chr3 complement(543239..543604) [366 bp, 121 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 121

 Score =  221 bits (563), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (96%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLLPEGESKLK+E DTKA++A+I+TFEKEDHTLGN+IRAELLEDE VLFAA
Sbjct: 1   MNAPDRFELFLLPEGESKLKVEQDTKASSAIIVTFEKEDHTLGNLIRAELLEDEGVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASED 118
           YKVEHPLFA+F+MRIQT EGYDPK+ALKNACNSIINKLA L+SNFETEWNLQTLA+ED
Sbjct: 61  YKVEHPLFAKFKMRIQTVEGYDPKDALKNACNSIINKLAQLQSNFETEWNLQTLATED 118

>TDEL0G04390 Chr7 complement(794577..794945) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  220 bits (560), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 113/122 (92%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKIEPDTKA NAV+ITFEKEDHTLGN+IR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFARF+MRIQT EGYDPK+ALKNACN IINKLA LK+NFETEWNLQTLAS+D +
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALKNACNGIINKLAVLKTNFETEWNLQTLASDDNY 120

Query: 121 RL 122
            +
Sbjct: 121 GI 122

>Kwal_56.22472 s56 (144443..144811) [369 bp, 122 aa] {ON} YOL005C
           (RPB11) - RNA polymerase II subunit, homologous to S.
           pombe Rpb11p subunit [contig 185] FULL
          Length = 122

 Score =  218 bits (555), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 114/122 (93%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLLPEGE+KLKI+PDTKA NAVI+TFEKEDHTL N+IRAELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRAELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFA+F+MRIQTAEGYDPK+ALKNACN II+KL  L+SNFETEWNLQTLASED +
Sbjct: 61  YKVEHPLFAQFKMRIQTAEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 RL 122
            +
Sbjct: 121 AM 122

>Suva_15.169 Chr15 complement(289702..290070) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  218 bits (554), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKIEPDTKA NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSIINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 RL 122
            +
Sbjct: 121 NM 122

>Skud_15.157 Chr15 complement(275429..275797) [369 bp, 122 aa] {ON}
           YOL005C (REAL)
          Length = 122

 Score =  218 bits (554), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 102/122 (83%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKIEPDTKA NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIEPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSIINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

Query: 121 RL 122
            +
Sbjct: 121 NM 122

>ZYRO0C07502g Chr3 complement(567967..568335) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  216 bits (550), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKL+++PDTKA NA+++TFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLRVDPDTKAPNAIVVTFEKEDHTLGNLIRAELLNDPKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFARF+MRIQT EGYDPK+ALKNACN IINKL  LK+NFETEWNLQTLAS+D F
Sbjct: 61  YKVEHPLFARFKMRIQTMEGYDPKDALKNACNGIINKLGVLKTNFETEWNLQTLASDDNF 120

Query: 121 RL 122
            +
Sbjct: 121 GI 122

>Smik_15.165 Chr15 complement(283099..283461) [363 bp, 120 aa] {ON}
           YOL005C (REAL)
          Length = 120

 Score =  216 bits (549), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKI+PDTKA NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSIINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLATDDAF 120

>YOL005C Chr15 complement(315813..316175) [363 bp, 120 aa] {ON}
           RPB11RNA polymerase II subunit B12.5; part of central
           core; similar to Rpc19p and bacterial alpha subunit
          Length = 120

 Score =  216 bits (549), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKI+PDTKA NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSIINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF 120

>KAFR0A05110 Chr1 complement(1014087..1014455) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  214 bits (545), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 100/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKI+PDTK+ NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKSPNAVVITFEKEDHTLGNLIRAELLNDTKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++R+QT EGYDPKEALKNACNSIINKL  LK+NFETEWNLQTLAS++ F
Sbjct: 61  YKVEHPFFARFKLRVQTIEGYDPKEALKNACNSIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 RL 122
            +
Sbjct: 121 GI 122

>CAGL0E02453g Chr5 complement(233352..233714) [363 bp, 120 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005c RPB11 DNA-directed RNA polymerase II
          Length = 120

 Score =  214 bits (544), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 111/120 (92%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKLKI+PDTKA NAV+ITFEKEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDNKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+AL+NAC+SIINKL  LKSNFETEWNLQTLA++D F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALRNACSSIINKLGALKSNFETEWNLQTLAADDAF 120

>KLTH0C10934g Chr3 complement(900683..901051) [369 bp, 122 aa] {ON}
           highly similar to uniprot|P38902 Saccharomyces
           cerevisiae YOL005C
          Length = 122

 Score =  213 bits (543), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 112/122 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLLPEGE+KLKI+PDTKA NAVI+TFEKEDHTL N+IR ELLED+ VLFAA
Sbjct: 1   MNAPDRFELFLLPEGEAKLKIDPDTKAPNAVIVTFEKEDHTLANLIRGELLEDKGVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFA+F++RIQT EGYDPK+ALKNACN II+KL  L+SNFETEWNLQTLASED +
Sbjct: 61  YKVEHPLFAQFKLRIQTVEGYDPKDALKNACNGIISKLGQLQSNFETEWNLQTLASEDNY 120

Query: 121 RL 122
            +
Sbjct: 121 AM 122

>Kpol_1037.21 s1037 complement(44216..44578) [363 bp, 120 aa] {ON}
           complement(44216..44578) [363 nt, 121 aa]
          Length = 120

 Score =  209 bits (533), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 110/120 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPD+FELFLL EGESKL IEPDTKA NAV+ITFEKEDHTLGN+IR+ELL D +VLFAA
Sbjct: 1   MNAPDKFELFLLGEGESKLNIEPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFARF++RIQT E YDPK+ALKNACN+IINKL  LK+NFETEWNLQTLAS++ F
Sbjct: 61  YKVEHPLFARFKLRIQTVENYDPKDALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

>NCAS0D02120 Chr4 complement(393640..394008) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  209 bits (533), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 97/122 (79%), Positives = 110/122 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKL+I+PDTKA NAV+ITFEKEDHTLGN+IR+ELL D RVLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLQIDPDTKAPNAVVITFEKEDHTLGNLIRSELLNDSRVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACNSII+KL  LK NFETEWNLQTLA+++  
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNSIISKLGVLKGNFETEWNLQTLAADENM 120

Query: 121 RL 122
            +
Sbjct: 121 GI 122

>KNAG0F02910 Chr6 complement(551617..551985) [369 bp, 122 aa] {ON}
           Anc_6.30 YOL005C
          Length = 122

 Score =  208 bits (529), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL +GESKL I+PDTK+ NA++ITF KEDHTLGN+IRAELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGDGESKLVIDPDTKSPNAIVITFNKEDHTLGNLIRAELLNDSKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FARF++RIQT EGYDPK+ALKNACN IINKL  LK+NFETEWNLQTLA++D F
Sbjct: 61  YKVEHPFFARFKLRIQTVEGYDPKDALKNACNGIINKLGILKTNFETEWNLQTLATDDTF 120

>TPHA0J00410 Chr10 (95837..96199) [363 bp, 120 aa] {ON} Anc_6.30
           YOL005C
          Length = 120

 Score =  207 bits (528), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 98/120 (81%), Positives = 110/120 (91%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EG+SKL+IE DTKAANAV+ITFEKEDHTLGN+IR ELL DE+VLFAA
Sbjct: 1   MNAPDRFELFLLDEGQSKLQIEQDTKAANAVVITFEKEDHTLGNLIRNELLNDEKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHPLFARF++RIQT E YDPK+ALK ACN+IINKL  LK+NF+TEWNLQTLAS+D F
Sbjct: 61  YKVEHPLFARFKLRIQTEENYDPKDALKMACNNIINKLGILKTNFDTEWNLQTLASDDNF 120

>TBLA0E03150 Chr5 complement(788457..788813) [357 bp, 118 aa] {ON}
           Anc_6.30 YOL005C
          Length = 118

 Score =  206 bits (524), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 107/118 (90%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFE FLL EGESKL+IEPDTKA N V+ITFEKEDHTLGN+I++ELL D +VLFAA
Sbjct: 1   MNAPDRFESFLLGEGESKLQIEPDTKAPNTVVITFEKEDHTLGNLIKSELLHDPKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASED 118
           YKVEHPLFARF+MRIQT EGYDPK+AL+ ACNSII KL  LK+NFETEWNLQTLAS+D
Sbjct: 61  YKVEHPLFARFKMRIQTVEGYDPKDALRKACNSIIKKLGILKTNFETEWNLQTLASDD 118

>NDAI0C02670 Chr3 (621282..621650) [369 bp, 122 aa] {ON} Anc_6.30
           YOL005C
          Length = 122

 Score =  206 bits (524), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 96/122 (78%), Positives = 109/122 (89%)

Query: 1   MNAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAA 60
           MNAPDRFELFLL EGESKL I+PDTKA NAV+ITF+KEDHTLGN+IR+ELL D +VLFAA
Sbjct: 1   MNAPDRFELFLLGEGESKLTIDPDTKAPNAVVITFQKEDHTLGNLIRSELLNDGKVLFAA 60

Query: 61  YKVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNFETEWNLQTLASEDQF 120
           YKVEHP FA F++RIQT EGYDPK ALKNACN+IINKL  LK+NFETEWNLQTLAS++ F
Sbjct: 61  YKVEHPFFANFKLRIQTVEGYDPKLALKNACNNIINKLGILKTNFETEWNLQTLASDENF 120

Query: 121 RL 122
            +
Sbjct: 121 GI 122

>TPHA0B02920 Chr2 (666060..666452) [393 bp, 130 aa] {ON} Anc_2.163
           YNL113W
          Length = 130

 Score = 51.6 bits (122), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 47/92 (51%), Gaps = 2/92 (2%)

Query: 16  ESKLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRM 73
           E K+KI P+  + +    +F+  +EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 32  EDKIKILPNATSPDGTSASFQISEEDHTLGNALRHIIMKNPEVEFCGYSIPHPSETLLNL 91

Query: 74  RIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
           RIQT       EAL+     +++    ++  F
Sbjct: 92  RIQTYGNTTAVEALQKGLKDLMDMCDVVEEKF 123

>CAGL0L03872g Chr12 complement(447274..447687) [414 bp, 137 aa] {ON}
           similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113w RPC19 DNA-directed RNA polymerase I III
          Length = 137

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 2/92 (2%)

Query: 16  ESKLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRM 73
           ++K+K+ P   + +    +F+  +EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 40  KTKIKLLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNL 99

Query: 74  RIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
           RIQT       +AL+   + +I+    +K  F
Sbjct: 100 RIQTYGNITAVDALQKGLDDLIDLCDAVKDKF 131

>Kpol_165.2 s165 complement(2511..2897) [387 bp, 128 aa] {ON}
           complement(2511..2897) [387 nt, 129 aa]
          Length = 128

 Score = 51.2 bits (121), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 16  ESKLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRM 73
           E K+KI P   + +    +F+   EDHTLGN +R  ++++  V F  Y + HP      +
Sbjct: 30  EDKIKILPQATSEDGTCASFQIMDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENLLNL 89

Query: 74  RIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
           RIQT       EAL+     +++    ++  F
Sbjct: 90  RIQTYGSTTAVEALQKGLGDLMDMCDVVEEKF 121

>NCAS0G02550 Chr7 (456827..457279) [453 bp, 150 aa] {ON} Anc_2.163
           YNL113W
          Length = 150

 Score = 50.1 bits (118), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKV 63
           PDR ++ +LPEG S+     D   A+  I+    EDHTLGN +R  ++++  V F  Y +
Sbjct: 50  PDREKVKILPEGASE-----DGTCASFQIV---DEDHTLGNALRYIIMKNPNVEFCGYSI 101

Query: 64  EHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            HP      +RIQT       EA +     +++    ++  F
Sbjct: 102 PHPSENFLNVRIQTYGDITAVEAFQKGLQDLMDLCDVVEDKF 143

>SAKL0E10692g Chr5 complement(891637..892032) [396 bp, 131 aa] {ON}
           highly similar to uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 131

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKV 63
           PDR ++ LLP+  S      D  +A+  I    +EDHTLGN +R  ++++  V F  Y +
Sbjct: 31  PDREKIKLLPQATSD-----DGTSASFQI---SEEDHTLGNALRYIIMKNPEVEFCGYSI 82

Query: 64  EHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            HP      +RIQT       EAL+     +++    ++  F
Sbjct: 83  PHPSENLLNVRIQTYGKITAVEALQKGLQDLMDMCDAVEDKF 124

>Suva_14.225 Chr14 (409562..409990) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 48.5 bits (114), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAY 61
           + PDR ++ LL +  S+     D  +A+  I+   +EDHTLGN +R  ++++  V F  Y
Sbjct: 40  DEPDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPEVEFCGY 91

Query: 62  KVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            + HP      +RIQT       EAL+     +++    ++S F
Sbjct: 92  SIPHPSENLLNVRIQTYGAITAVEALQKGLKDLMDLCDVVESKF 135

>KAFR0B04570 Chr2 complement(949880..950275) [396 bp, 131 aa] {ON}
           Anc_2.163 YNL113W
          Length = 131

 Score = 47.0 bits (110), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 17  SKLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMR 74
           +K+KI P   + +    +F+  +EDHTLGN +R  ++++ +V F  Y + HP      +R
Sbjct: 34  NKIKILPQATSEDGTSASFQIVEEDHTLGNALRYIIMKNPQVEFCGYSIPHPSENLLNIR 93

Query: 75  IQTAEGYDPKEALKNACNSIINKLATLKSNF 105
           IQT       +ALK     +++    ++  F
Sbjct: 94  IQTYGEITAVDALKKGLADLMDLCDVVEETF 124

>TBLA0B01290 Chr2 (274238..274546) [309 bp, 102 aa] {ON} Anc_2.163
           YNL113W
          Length = 102

 Score = 46.2 bits (108), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%)

Query: 20  KIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRIQTAE 79
           ++ P T   +A       EDHTLGN +R  L+ +  V F  Y + HP      +R+QT  
Sbjct: 10  QLPPVTPDGSAASFQIRDEDHTLGNALRYLLMRNPAVEFCGYSIPHPSEPFLNLRVQTYG 69

Query: 80  GYDPKEALKNACNSIINKLATLKSNF 105
                +AL      +++    ++  F
Sbjct: 70  DITASDALAQGLQDLMDLCDVVEDTF 95

>KNAG0I02060 Chr9 complement(401412..401816) [405 bp, 134 aa] {ON}
           Anc_2.163 YNL113W
          Length = 134

 Score = 46.6 bits (109), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRI 75
           K+KI P+    +    +F+   EDHTLGN +R  ++++  V F  Y + HP      +RI
Sbjct: 38  KVKILPEATTEDGTCASFQILNEDHTLGNALRYVIMKNPEVEFCGYSIPHPSENWLNVRI 97

Query: 76  QTAEGYDPKEALKNACNSIINKLATLKSNF 105
           QT       +A K     +++    ++  F
Sbjct: 98  QTYGKITAVDAFKKGLGDLMDMCDVVEDVF 127

>Ecym_5423 Chr5 complement(871715..872098) [384 bp, 127 aa] {ON}
           similar to Ashbya gossypii AFL220C
          Length = 127

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRI 75
           K+++ P+  + +    +F+   EDHTLGN +R  ++++  V F  Y + HP      +RI
Sbjct: 31  KIRLLPEAASEDGTCASFQISDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSETVLNLRI 90

Query: 76  QTAEGYDPKEALKNACNSIINKLATLKSNF 105
           QT       EAL      +++    ++  F
Sbjct: 91  QTYGKMTAVEALHKGLKDLMDLCDVVEDKF 120

>TDEL0F01180 Chr6 (211106..211495) [390 bp, 129 aa] {ON} Anc_2.163
           YNL113W
          Length = 129

 Score = 46.6 bits (109), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKV 63
           PDR ++ LLP+  S+     D   A+  I    +EDHTLGN +R  +++++ V F  Y +
Sbjct: 29  PDREKIKLLPQASSE-----DGTCASFQIA---EEDHTLGNALRYVIMKNKDVEFCGYSI 80

Query: 64  EHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            HP      +RIQT       + L+     +++    ++  F
Sbjct: 81  PHPSENLLNLRIQTYGATTAVDVLQKGLTDLMDLCDAVEDRF 122

>YNL113W Chr14 (412771..413199) [429 bp, 142 aa] {ON}  RPC19RNA
           polymerase subunit AC19, common to RNA polymerases I and
           III
          Length = 142

 Score = 46.6 bits (109), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKV 63
           PDR ++ LL +  S+     D  +A+  I+   +EDHTLGN +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYVIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            HP      +RIQT       +AL+     +++    ++S F
Sbjct: 94  PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF 135

>Smik_14.214 Chr14 (392413..392841) [429 bp, 142 aa] {ON} YNL113W
           (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 8/102 (7%)

Query: 4   PDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKV 63
           PDR ++ LL +  S+     D  +A+  I+   +EDHTLGN +R  ++++  V F  Y +
Sbjct: 42  PDREKIKLLTQATSE-----DGTSASFQIV---EEDHTLGNALRYIIMKNPDVEFCGYSI 93

Query: 64  EHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            HP      +RIQT       +AL+     +++    ++S F
Sbjct: 94  PHPSENLLNIRIQTYGESTAVDALQKGLKDLMDLCDVVESKF 135

>ZYRO0B09878g Chr2 complement(771644..772036) [393 bp, 130 aa]
          {ON} highly similar to uniprot|Q755Q7 Ashbya gossypii
          AFL220C AFL220Cp and similar to YNL113W uniprot|P28000
          Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
          subunit common to RNA polymerases I and III
          Length = 130

 Score = 45.4 bits (106), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 18 KLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRI 75
          K+KI P   + +    +F+  +EDHTLGN +R  ++++  V F  Y + HP      +R+
Sbjct: 34 KIKILPQATSEDGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRV 93

Query: 76 QT 77
          QT
Sbjct: 94 QT 95

>KLLA0F23760g Chr6 complement(2218555..2218938) [384 bp, 127 aa]
           {ON} similar to uniprot|P28000 Saccharomyces cerevisiae
           YNL113W RPC19 RNA polymerase subunit common to RNA
           polymerases I and III
          Length = 127

 Score = 43.5 bits (101), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%)

Query: 18  KLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRIQT 77
           KL  E  ++   +       EDHTLGN +R  ++++  V F  Y + HP      +RIQT
Sbjct: 33  KLLTEATSEDGTSASFRITDEDHTLGNTLRYMIMKNPEVEFCGYSIPHPSENFLHIRIQT 92

Query: 78  AEGYDPKEALKNACNSIINKLATLKSNF 105
                  EAL      +++    ++  F
Sbjct: 93  YGKITAVEALHKGLGDLMDMCDAVEDRF 120

>Skud_14.218 Chr14 (402879..403349) [471 bp, 156 aa] {ON} YNL113W
           (REAL)
          Length = 156

 Score = 44.3 bits (103), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 8/104 (7%)

Query: 2   NAPDRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAY 61
           + PDR ++ LL +  S    E  T A+  ++    +EDHTLGN +R  ++++  V F  Y
Sbjct: 54  DEPDREKIKLLTQATS----EDGTNASFQIV----EEDHTLGNALRYIIMKNPDVEFCGY 105

Query: 62  KVEHPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
            + HP      +RIQT       +AL+     +++    +++ F
Sbjct: 106 SIPHPSENLLNIRIQTYGEITAVDALQKGLKDLMDLCDVVEAKF 149

>AFL220C Chr6 complement(25281..25688) [408 bp, 135 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL113W
           (RPC19)
          Length = 135

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 43/101 (42%), Gaps = 8/101 (7%)

Query: 5   DRFELFLLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRAELLEDERVLFAAYKVE 64
           DR ++ LLP+  S+                   EDHTLGN +R  ++++  V F  Y + 
Sbjct: 36  DRDKIRLLPQATSE--------DGTCAFFQITDEDHTLGNALRYIIMKNPEVEFCGYSIP 87

Query: 65  HPLFARFRMRIQTAEGYDPKEALKNACNSIINKLATLKSNF 105
           HP      +RIQT       +AL      +++    ++  F
Sbjct: 88  HPSENFLNIRIQTYGKVTAVDALHKGLQDLMDMCDVVEDKF 128

>NDAI0F02750 Chr6 complement(673843..674292) [450 bp, 149 aa] {ON}
           Anc_2.163 YNL113W
          Length = 149

 Score = 43.5 bits (101), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 18  KLKIEPDTKAANAVIITFE--KEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRI 75
           K+KI     + +    +F+  +EDHTLGN +R  ++++ +V F  Y + HP      +RI
Sbjct: 53  KIKILQQGASEDGCSASFQILQEDHTLGNALRYIIMKNPQVEFCGYSIPHPSEEFLNIRI 112

Query: 76  QTAEGYDPKEALKNACNSIINKLATLKSNF 105
           QT       EAL      +++    ++  F
Sbjct: 113 QTYGEITAVEALHKGLQDLMDLCDVVEEKF 142

>KLTH0D09350g Chr4 complement(776115..776555) [441 bp, 146 aa] {ON}
           some similarities with uniprot|P28000 Saccharomyces
           cerevisiae YNL113W RPC19 RNA polymerase subunit common
           to RNA polymerases I and III
          Length = 146

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRIQTAEGYDPKEALKNACNSI 94
             +EDHTLGN +R  ++++  V F  Y + HP      +RIQT   +   E L+     +
Sbjct: 69  ISEEDHTLGNALRYIIMKNPDVEFCGYSIPHPSETLLNLRIQTYGKFTAVEVLQKGLQDL 128

Query: 95  INKLATLKSNF 105
           ++    ++  F
Sbjct: 129 MDLCDAVEDKF 139

>Kwal_26.8473 s26 complement(800017..800469) [453 bp, 150 aa] {ON}
           YNL113W (RPC19) - subunit common to RNA polymerases I
           (A) and III (C) [contig 61] FULL
          Length = 150

 Score = 41.2 bits (95), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 35  FEKEDHTLGNIIRAELLEDERVLFAAYKVEHPLFARFRMRIQTAEGYDPKEALKNACNSI 94
             +EDHTLGN +R  ++++  V F  Y + HP      +RIQT   +   E L+     +
Sbjct: 73  ISEEDHTLGNSLRYIIMKNPDVEFCGYSIPHPSENLLNLRIQTYGKHTALEVLQKGLQDL 132

Query: 95  INKLATLKSNF 105
           ++    ++  F
Sbjct: 133 MDLCDAVEDKF 143

>YHL030W Chr8 (40084..45690) [5607 bp, 1868 aa] {ON}  ECM29Scaffold
           protein that assists in association of the proteasome
           core particle with the regulatory particle; degraded by
           the mature proteasome after assembly; contains HEAT-like
           repeats
          Length = 1868

 Score = 30.4 bits (67), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 8/68 (11%)

Query: 14  EGESKLKIEPDTKAANAVIITFEKEDHTLGNIIRA--ELLEDERV---LFAAYKVEHPLF 68
           EG  KL++ P T A N  I+  + +  TLG+I++   EL+ D      LF + K + P  
Sbjct: 400 EGWPKLQLGPQTPAFNTAILQRQLQYETLGDILKRDFELVSDLSYIEFLFESLKNDLP-- 457

Query: 69  ARFRMRIQ 76
            +FR  IQ
Sbjct: 458 -QFRSSIQ 464

>TBLA0H00730 Chr8 complement(163394..164251) [858 bp, 285 aa] {ON} 
          Length = 285

 Score = 28.5 bits (62), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%)

Query: 11  LLPEGESKLKIEPDTKAANAVIITFEKEDHTLGNI 45
           L P+G+ +L  +    A  AV+   + +DHTLG +
Sbjct: 187 LKPDGQYRLTTDASKSAVGAVLEEIDDKDHTLGVV 221

>NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa]
           {ON} Anc_1.423
          Length = 708

 Score = 27.7 bits (60), Expect = 9.2,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 9/62 (14%)

Query: 57  LFAAYKVEHPLFARFRMRIQTAEGYDPKEALKNA-CNSII--------NKLATLKSNFET 107
           L+   K E PL+ ++        GY+P E LK A C +++        N+  T K    +
Sbjct: 633 LWDVAKKEDPLYMKYIKDRTKKTGYEPIERLKRARCRNVVYSMLDPVSNRRLTAKQVLNS 692

Query: 108 EW 109
           EW
Sbjct: 693 EW 694

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,102,204
Number of extensions: 432134
Number of successful extensions: 1347
Number of sequences better than 10.0: 49
Number of HSP's gapped: 1346
Number of HSP's successfully gapped: 49
Length of query: 122
Length of database: 53,481,399
Length adjustment: 91
Effective length of query: 31
Effective length of database: 43,046,793
Effective search space: 1334450583
Effective search space used: 1334450583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)