Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL004W6.29ON1377137766520.0
Ecym_30336.29ON1474115342230.0
SAKL0E01540g6.29ON1415122539850.0
KLTH0C10956g6.29ON1433135237000.0
KAFR0A051206.29ON1479124635280.0
NCAS0D021306.29ON1434123934710.0
YOL004W (SIN3)6.29ON1536134534490.0
KNAG0F029206.29ON1492131434450.0
ZYRO0C07524g6.29ON1670118734180.0
CAGL0E02475g6.29ON1493131033520.0
KLLA0C06182g6.29ON1519109833350.0
TDEL0G044006.29ON1490107733350.0
Kpol_1037.226.29ON1496119432240.0
Kwal_56.224626.29ON154194731050.0
TPHA0J004006.29ON1512115630460.0
Suva_15.1716.29ON156196728300.0
Smik_15.1666.29ON156698828180.0
TBLA0E031606.29ON173987028130.0
NDAI0C026606.29ON165788526660.0
Skud_15.1586.29ON15552466791e-71
CAGL0J11594g6.29ON9373836146e-65
Kpol_1064.538.403ON48969801.2
Suva_7.4775.190ON1950168801.3
YDR097C (MSH6)8.235ON1242116782.3
CAGL0H09350g5.190ON1965119746.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL004W
         (1377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic h...  2566   0.0  
Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON} ...  1631   0.0  
SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] ...  1539   0.0  
KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} simil...  1429   0.0  
KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_...  1363   0.0  
NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6....  1341   0.0  
YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Comp...  1333   0.0  
KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6....  1331   0.0  
ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} simil...  1321   0.0  
CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} simil...  1295   0.0  
KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} simil...  1289   0.0  
TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6....  1289   0.0  
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...  1246   0.0  
Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] ...  1200   0.0  
TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {O...  1177   0.0  
Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL00...  1094   0.0  
Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL00...  1090   0.0  
TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6....  1088   0.0  
NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {...  1031   0.0  
Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL00...   266   1e-71
CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa...   241   6e-65
Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON} (95468....    35   1.2  
Suva_7.477 Chr7 complement(817323..823175) [5853 bp, 1950 aa] {O...    35   1.3  
YDR097C Chr4 complement(640109..643837) [3729 bp, 1242 aa] {ON} ...    35   2.3  
CAGL0H09350g Chr8 complement(912452..918349) [5898 bp, 1965 aa] ...    33   6.2  

>ACL004W Chr3 (347727..351860) [4134 bp, 1377 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOL004W (SIN3)
          Length = 1377

 Score = 2566 bits (6652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1274/1377 (92%), Positives = 1274/1377 (92%)

Query: 1    MSQSWSQHHQVDHAGSGRPVXXXXXXXXXXXXXXXXXXXXXXXXXXSEGLKTHYTLPSIS 60
            MSQSWSQHHQVDHAGSGRPV                          SEGLKTHYTLPSIS
Sbjct: 1    MSQSWSQHHQVDHAGSGRPVGQAGPGPAGGTPQMGGGAGLLPGRRGSEGLKTHYTLPSIS 60

Query: 61   AAGLPGAGEPHGGSRLPPMQNALGVGGGGPGSIANGFAVGRLEXXXXXXXXXXXXXXXXX 120
            AAGLPGAGEPHGGSRLPPMQNALGVGGGGPGSIANGFAVGRLE                 
Sbjct: 61   AAGLPGAGEPHGGSRLPPMQNALGVGGGGPGSIANGFAVGRLEGAVPVSGTGGPGSPGPQ 120

Query: 121  XXXXDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 180
                DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS
Sbjct: 121  VPAQDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVS 180

Query: 181  TLFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXT 240
            TLFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPIT           T
Sbjct: 181  TLFHGYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITGAGGNHAHGANT 240

Query: 241  EPRLQSTQNVPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRF 300
            EPRLQSTQNVPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRF
Sbjct: 241  EPRLQSTQNVPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRF 300

Query: 301  AEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQLQSH 360
            AEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA             SSAPQLQSH
Sbjct: 301  AEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSAPQLQSH 360

Query: 361  QQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHPMSLPSVQGPNV 420
            QQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHPMSLPSVQGPNV
Sbjct: 361  QQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHPMSLPSVQGPNV 420

Query: 421  GLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQYMEPTVRPEIDLDPS 480
            GLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQYMEPTVRPEIDLDPS
Sbjct: 421  GLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQYMEPTVRPEIDLDPS 480

Query: 481  LVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVE 540
            LVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVE
Sbjct: 481  LVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVE 540

Query: 541  DVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTF 600
            DVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTF
Sbjct: 541  DVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTF 600

Query: 601  MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEAN 660
            MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEAN
Sbjct: 601  MPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEAN 660

Query: 661  LRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALH 720
            LRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALH
Sbjct: 661  LRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALH 720

Query: 721  EHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLT 780
            EHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLT
Sbjct: 721  EHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLT 780

Query: 781  AKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSP 840
            AKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSP
Sbjct: 781  AKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSP 840

Query: 841  SDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSAR 900
            SDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSAR
Sbjct: 841  SDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSAR 900

Query: 901  KRVRDDTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXXXXXXXXXXXVRQEAKKPWLLGS 960
            KRVRDDTEHLLRDILYRNKQQKVNKGPQNDQ                VRQEAKKPWLLGS
Sbjct: 901  KRVRDDTEHLLRDILYRNKQQKVNKGPQNDQSSEEFEKESDIEEKEIVRQEAKKPWLLGS 960

Query: 961  IVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQ 1020
            IVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQ
Sbjct: 961  IVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQ 1020

Query: 1021 FAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKL 1080
            FAKDLNLISTQLTDMGLDFKGADAY                HQWFEESLRQAYKNKAFKL
Sbjct: 1021 FAKDLNLISTQLTDMGLDFKGADAYEELLRLSRSLISGELEHQWFEESLRQAYKNKAFKL 1080

Query: 1081 YTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIEN 1140
            YTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIEN
Sbjct: 1081 YTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIEN 1140

Query: 1141 MFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPF 1200
            MFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPF
Sbjct: 1141 MFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPF 1200

Query: 1201 LEKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPT 1260
            LEKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPT
Sbjct: 1201 LEKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPT 1260

Query: 1261 RVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEIST 1320
            RVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEIST
Sbjct: 1261 RVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEIST 1320

Query: 1321 DTKAALSTTTDTAGNVSTASFSSQTAANAAISASSPESALQSNNGNSEVTSPIANDI 1377
            DTKAALSTTTDTAGNVSTASFSSQTAANAAISASSPESALQSNNGNSEVTSPIANDI
Sbjct: 1321 DTKAALSTTTDTAGNVSTASFSSQTAANAAISASSPESALQSNNGNSEVTSPIANDI 1377

>Ecym_3033 Chr3 complement(64660..69084) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ACL004W
          Length = 1474

 Score = 1631 bits (4223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 816/1153 (70%), Positives = 919/1153 (79%), Gaps = 32/1153 (2%)

Query: 252  TVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFL 311
             VY+S +GSP         Q+Q+GTG KK GDVEFSHAISYVNKIKTRFA+QPDIYKHFL
Sbjct: 322  VVYQSTDGSPTM--PQRQPQDQFGTGGKKTGDVEFSHAISYVNKIKTRFADQPDIYKHFL 379

Query: 312  EILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQLQ------SHQQING 365
            EILQTYQREQKPINEVYAQVTVLFQNA             +SAPQ Q      SH Q+NG
Sbjct: 380  EILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDASAPQAQQQHLAQSHPQLNG 439

Query: 366  AMVAPGFGHAQSGLQQALPGTQPLMHQQ--------------------NLPPLGNFSTPG 405
            A+    F H+Q          Q                          NLPPLG+FSTPG
Sbjct: 440  ALTPSSFYHSQQQQGPQPQQDQSQSQHPVQQQQQQQQQQQQQTVIHQQNLPPLGSFSTPG 499

Query: 406  DHHPMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQVQDVQ 465
            DHHPM+LP VQ PN+ L+QG   HI+TQG+SNQ IP+SDLR   D S+R +EY+Q QD Q
Sbjct: 500  DHHPMNLPLVQAPNMNLNQGHPAHIITQGMSNQKIPISDLRTTADTSYRPAEYSQGQDTQ 559

Query: 466  YMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKIL 525
            YME   RPEIDLDPSLVPVIPEPIKPLEDELNLVEEA+FFDKAKK+IGNKQIYTEFLKIL
Sbjct: 560  YMETNARPEIDLDPSLVPVIPEPIKPLEDELNLVEEASFFDKAKKYIGNKQIYTEFLKIL 619

Query: 526  NLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCE 585
            NLYSQDLL+KE+LVE V HYLSG PELFDWFKSFVGYQE+PKHIEN++HEKHRLDLDLCE
Sbjct: 620  NLYSQDLLDKERLVEKVGHYLSGCPELFDWFKSFVGYQEKPKHIENIVHEKHRLDLDLCE 679

Query: 586  ACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK 645
            ACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK
Sbjct: 680  ACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFK 739

Query: 646  IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRK 705
            IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKA FKLPPGLGHTSVTIYKKVIRK
Sbjct: 740  IEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLPPGLGHTSVTIYKKVIRK 799

Query: 706  VYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLD 765
            VYDKDRG+EIIDALHE+PAITVP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+KSLD
Sbjct: 800  VYDKDRGYEIIDALHEYPAITVPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLD 859

Query: 766  HLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDIL 825
            HLGLTFKQADKKLLTAKQLISEISSIKVDQ+NKRIHPLTPKAKSQL +DF +PEVF DIL
Sbjct: 860  HLGLTFKQADKKLLTAKQLISEISSIKVDQNNKRIHPLTPKAKSQLDHDFTDPEVFYDIL 919

Query: 826  SLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSS--QNGTISHGD 883
            +L +VFL NNNTYS  D ERLKDFFKGFISLF SYP+ +IE+ L KR +   + + +   
Sbjct: 920  NLAIVFLENNNTYSAPDKERLKDFFKGFISLFCSYPVPQIEKALAKRDAASSSQSSNSNT 979

Query: 884  DTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXXXXXXX 943
            +T   K+    +    +KR R+D++ LLRD+L+RNKQQK  +                  
Sbjct: 980  ETYSEKQQEDGDMKLPKKRNREDSDRLLRDVLFRNKQQKGGRNSPRGDSSISAEKESDME 1039

Query: 944  XXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVK 1003
                +RQEAK PWLLGSIVDEADNHGHV +R TFN+FANTNIYVFFRHL T+YERLVEVK
Sbjct: 1040 EEEIIRQEAKNPWLLGSIVDEADNHGHVENRKTFNLFANTNIYVFFRHLATIYERLVEVK 1099

Query: 1004 KINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQ 1063
            K+N EVTKEI+NRKVVQFAKDLNLISTQLTDMGLDFKG DAY                HQ
Sbjct: 1100 KMNDEVTKEIANRKVVQFAKDLNLISTQLTDMGLDFKGEDAYEKLLQLSRSLIAGDLEHQ 1159

Query: 1064 WFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKD 1123
            WFEESLRQAYKNKAFK+YT+DKVIQALVKHAH I+ D+KTVEIM+LF+ DRTS STSTKD
Sbjct: 1160 WFEESLRQAYKNKAFKIYTVDKVIQALVKHAHAIITDNKTVEIMMLFEKDRTSLSTSTKD 1219

Query: 1124 QILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYS 1183
            QILYRLQVRSNMSNIENMFRIEYN  T+H  IQFVAV+DLTL+EPKSL+DKWQYYLTSYS
Sbjct: 1220 QILYRLQVRSNMSNIENMFRIEYNRLTAHVCIQFVAVDDLTLEEPKSLKDKWQYYLTSYS 1279

Query: 1184 LSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVE 1243
            LSHPTEGISHDNLR+PFLEKIIE +E  I+D DE+YSPEGVA+SN+KVKIDP+TYSMEVE
Sbjct: 1280 LSHPTEGISHDNLRSPFLEKIIESEEDIIEDKDEKYSPEGVATSNLKVKIDPITYSMEVE 1339

Query: 1244 PGCHDIFSRKSVNKFPTRVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLE 1303
             G HDIFSRK+VNKFP RVD++KKKS+ELKL LE FLN   GWK+ L+ K+ AE E+RLE
Sbjct: 1340 FGSHDIFSRKAVNKFPVRVDIRKKKSSELKLELERFLNSNSGWKKDLSAKQIAEVEKRLE 1399

Query: 1304 YVKNNGTLDDYAEEISTDTKAALSTTTDTAGNVSTASFSSQTAANAAISASSPESALQSN 1363
            +VK NG L++Y+++ +  + +A+S  +D A      S S  T  +A++ A+  +S L++ 
Sbjct: 1400 FVKLNGNLEEYSDDSAVASTSAVS-GSDLAKEDIARSQSESTVVSASM-ATCAQSTLKTE 1457

Query: 1364 NGNSEVTSPIAND 1376
                + T    N+
Sbjct: 1458 KDKPDSTFTATNN 1470

 Score =  252 bits (644), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/259 (54%), Positives = 154/259 (59%), Gaps = 33/259 (12%)

Query: 1   MSQSWSQHHQVDHAGSGRPVXXXXXXX--------XXXXXXXXXXXXXXXXXXXSEGLKT 52
           MSQSW+QHHQVDH G    V                                  S+G+K 
Sbjct: 1   MSQSWNQHHQVDHVGGSGSVSGAGGQQPQGKQHSDQGQQGQLAVGGGGLLGKRRSDGMKG 60

Query: 53  HYTLPSISAAGLPGAGE----PHGGSRLPPMQNALGVGGGGPGS--------IANGFAVG 100
           HYTLPSISA GLPG+GE     H GSRLPPMQN L      P          ++NGF++ 
Sbjct: 61  HYTLPSISA-GLPGSGEHQHQQHDGSRLPPMQNTLAAAASAPPGGGGGGGGGVSNGFSMS 119

Query: 101 RLEX------------XXXXXXXXXXXXXXXXXXXXDGSAYRPLNVKDALSYLEQVKFQF 148
            L+                                 DGS+YRPLNVKDALSYLEQVKFQF
Sbjct: 120 SLDNPLPQQEFQEQSQHQQQQHHHHQLDQLQSPAHQDGSSYRPLNVKDALSYLEQVKFQF 179

Query: 149 SSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTFLPHGYNIECPSD 208
           +SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF GYP LIQGFNTFLP GYNIEC SD
Sbjct: 180 NSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQGYPTLIQGFNTFLPQGYNIECSSD 239

Query: 209 PNDPIKVTTPFGTIGEIPI 227
           PNDPIKVTTPFGT GE+ I
Sbjct: 240 PNDPIKVTTPFGTTGEVAI 258

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 357 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 416

Query: 197 LP 198
           LP
Sbjct: 417 LP 418

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 32/48 (66%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LFQ
Sbjct: 168 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFQ 215

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 132 LNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQ 191
           LN+ +  S+ ++ K ++     +Y  FL I+  +    +D   ++E+V     G P L  
Sbjct: 590 LNLVEEASFFDKAK-KYIGNKQIYTEFLKILNLYSQDLLDKERLVEKVGHYLSGCPELFD 648

Query: 192 GFNTFLPHGY 201
            F +F+  GY
Sbjct: 649 WFKSFV--GY 656

>SAKL0E01540g Chr5 complement(114922..119169) [4248 bp, 1415 aa] {ON}
            similar to uniprot|Q75CF0 Ashbya gossypii ACL004W
            ACL004Wp and some similarites with YOL004W uniprot|P22579
            Saccharomyces cerevisiae YOL004W SIN3 DNA binding protein
            involved in transcriptional regulation
          Length = 1415

 Score = 1539 bits (3985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/1225 (64%), Positives = 921/1225 (75%), Gaps = 70/1225 (5%)

Query: 128  AYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYP 187
            +YRPLNVKDALSYLEQVKFQF++RPDVYNHFLDIMKDFKSQAIDTPGVIERVS LF GYP
Sbjct: 157  SYRPLNVKDALSYLEQVKFQFNNRPDVYNHFLDIMKDFKSQAIDTPGVIERVSNLFQGYP 216

Query: 188  ALIQGFNTFLPHGYNIECPSDPNDP--IKVTTPFGTIGEI-----PITXXXXXXXXXXXT 240
             LIQGFNTFLP GY IEC S+PNDP  IKVTTPFGT G +     P+            +
Sbjct: 217  NLIQGFNTFLPQGYKIECSSNPNDPHPIKVTTPFGTTGSVTLNTAPLEQRYPSNENVLLS 276

Query: 241  EPRLQSTQNVPTVYRSAEGSPAAIATPATT--------------------QEQYGTGPKK 280
               LQ  Q+   + +  +                                Q+Q+    KK
Sbjct: 277  PDHLQLQQHHSVLQQEQQQPQPQPQQQPQPQTQTQTQTQTQTQQQHYPDQQDQHYLA-KK 335

Query: 281  AGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXX 340
             GDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA  
Sbjct: 336  GGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPD 395

Query: 341  XXXXXXXXXXXSSAPQ-LQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLG 399
                       +SAPQ   +   +NG    P          QA P       QQNLPPLG
Sbjct: 396  LLDDFKKFLPDASAPQSTTTPAPVNGGTFYP----------QAAP-------QQNLPPLG 438

Query: 400  NF-------STPGDHHPMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDAS 452
            +F       +  G+H  + LP+VQ P++ +S     HI+TQG+SN  IP+S++R   D +
Sbjct: 439  SFSPPSSGSAREGEH--VGLPAVQPPSMDISGQPQQHIITQGMSNDDIPISEVRNTADGA 496

Query: 453  FRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFI 512
            +R S+     +VQYMEP  RPEIDLDPSLVPVIPEPI+P+E+E++LVEE +FFDKAKKFI
Sbjct: 497  YR-SDLRNSGEVQYMEPVARPEIDLDPSLVPVIPEPIEPMENEVSLVEETSFFDKAKKFI 555

Query: 513  GNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENV 572
            GNKQIYTEFLKILNLYSQDLL++++LVE V +YL G+ ELFDWFK+FVGY+++PKHIEN+
Sbjct: 556  GNKQIYTEFLKILNLYSQDLLDRDELVEKVEYYLGGNKELFDWFKNFVGYEKKPKHIENI 615

Query: 573  IHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 632
            +HEKHRLDLDLCEACGPSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI
Sbjct: 616  VHEKHRLDLDLCEACGPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFI 675

Query: 633  AHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLG 692
            AHRKNQYE+TLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKA FKL PGLG
Sbjct: 676  AHRKNQYEETLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKATFKLSPGLG 735

Query: 693  HTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVW 752
            HTSVTIYKKVIRKVYDKDRGFEIIDALHE P+I VP+VLKRLKQKDEEWRRAQREWNKVW
Sbjct: 736  HTSVTIYKKVIRKVYDKDRGFEIIDALHETPSIAVPIVLKRLKQKDEEWRRAQREWNKVW 795

Query: 753  RELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLS 812
            RELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEIS+IKVDQ+NKRIHPLTPK KSQL 
Sbjct: 796  RELEQKVYYKSLDHLGLTFKQADKKLLTTKQLVSEISTIKVDQANKRIHPLTPKPKSQLD 855

Query: 813  YDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKR 872
            Y FK+ EV  DIL+L  VF+  N TYS  D E++ DF K F+ LFFSYP++E+E    +R
Sbjct: 856  YHFKDREVLYDILNLAKVFIDCNTTYSNPDKEKMFDFLKSFLVLFFSYPMYEVETAFARR 915

Query: 873  SSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQK----VNKGPQ 928
                G     +++ +   D       +RKR R++ E+LL+D+L RNK QK      + P 
Sbjct: 916  RGDIGVQDGEENSGQENSD------LSRKRTREE-ENLLKDVLRRNKYQKGRNFAEEEPI 968

Query: 929  NDQXXXXXXXXXXXXXXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVF 988
             ++                +RQEAKKPWLLGSIVDEA+ HG V +R TFNMFANTNIYVF
Sbjct: 969  PEESEFAEKTVEEKEEEEIIRQEAKKPWLLGSIVDEANEHGFVENRKTFNMFANTNIYVF 1028

Query: 989  FRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXX 1048
            FRHL T+Y RL EVK IN  VT+EI NRKVVQFAKDLNLISTQL+DMGLDF+GADAY   
Sbjct: 1029 FRHLATLYTRLSEVKDINEAVTEEIKNRKVVQFAKDLNLISTQLSDMGLDFEGADAYGQV 1088

Query: 1049 XXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIML 1108
                         HQWFEESLRQAYKNKAFK+YTIDKV+Q+LVKHAHTI+ D KTVEIM+
Sbjct: 1089 LTLSKRLIEGDIEHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHTIITDPKTVEIMI 1148

Query: 1109 LFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEP 1168
            LF+ DRT  +TS K+QILYRLQVRS+M+  ENMFRIEYN  ++HASIQFVAV+DLTL+EP
Sbjct: 1149 LFEKDRTCLNTSAKEQILYRLQVRSHMTTAENMFRIEYNRQSTHASIQFVAVDDLTLEEP 1208

Query: 1169 KSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDERYSPEGVASSN 1228
            KSL D+W+YY+TSYSLSHPTEGISH+ L+ PFLEKI+E++E +  +  E YSPEGV+SSN
Sbjct: 1209 KSLEDRWKYYVTSYSLSHPTEGISHEELQPPFLEKILEKEEEFQCENGE-YSPEGVSSSN 1267

Query: 1229 MKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGW 1286
            +KVKI+P TYS++V+PG +D FSRKS+NKFP  +  D  K K  E    L  +LNG +GW
Sbjct: 1268 LKVKINPETYSLDVQPGSYDFFSRKSINKFPIEINNDTYKSKRGEKAKCLTSYLNGAKGW 1327

Query: 1287 KRGLTTKRTAEAERRLEYVKNNGTL 1311
            KRGL   +  +A+  +EYVK  GTL
Sbjct: 1328 KRGLVASKVLKAQTEIEYVKTKGTL 1352

>KLTH0C10956g Chr3 (901384..905685) [4302 bp, 1433 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1433

 Score = 1429 bits (3700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 758/1352 (56%), Positives = 918/1352 (67%), Gaps = 128/1352 (9%)

Query: 54   YTLPSISAAGLPGAGEPHGGS---RLPPMQNAL--GVGGGGPGSIANGFAVGRLEX---- 104
            + LPS+S  GL        GS   RLP +Q A    +  GG    + GF+V  L      
Sbjct: 60   FVLPSLS--GLDAGTRAEYGSEPQRLPSLQGAQPQSISSGG----SKGFSVASLNNPLPA 113

Query: 105  ----XXXXXXXXXXXXXXXXXXXXDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLD 160
                                       +YRPLN KDALSYLEQVKFQF++RPDVYNHFLD
Sbjct: 114  QQQMLHSQQQQQLLQQGVLPLEHVQDPSYRPLNFKDALSYLEQVKFQFNNRPDVYNHFLD 173

Query: 161  IMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTFLPHGYNIECPSDPNDP--IKVTTP 218
            IMKD+KSQAIDT GVIER+STLF GYP LIQG NTFLP GY IEC  +PNDP  IKVTTP
Sbjct: 174  IMKDYKSQAIDTLGVIERISTLFKGYPILIQGLNTFLPQGYKIECTLNPNDPHSIKVTTP 233

Query: 219  FGTIGEIPITXXXXXXXXXXXTEPRLQSTQNV----------PTVYRSAEGSPAAIATPA 268
            F    E+ +              P L  + +V            V    E +P  +  P 
Sbjct: 234  FDNARELNLATMATGNGIVE-GHPSLMPSDDVSPPKLVGHEPAAVQPKLENAPTNLPVPT 292

Query: 269  T----------TQEQYGT----------------GPKKAGDVEFSHAISYVNKIKTRFAE 302
            T            +Q+G+                G + +GDVEFSHAISYVNKIKTRFA+
Sbjct: 293  TFNQNLPQHEQQNQQHGSQSPAMPQQQRQDQQFMGNRPSGDVEFSHAISYVNKIKTRFAD 352

Query: 303  QPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQ------ 356
            QP+IYKHFLEILQTYQREQKPI+EVYAQVT LFQNA             ++A        
Sbjct: 353  QPEIYKHFLEILQTYQREQKPIHEVYAQVTSLFQNAPDLLDDFKKFLPDATAAHEQQQLL 412

Query: 357  ------------------LQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQ-QNLPP 397
                               QSH Q     +     H        +P  Q    + QNLPP
Sbjct: 413  LQQQQQQQQQLQQQQIQQHQSHYQNASQDLDQRQQHTHQPFGNTVPFYQTQQGRPQNLPP 472

Query: 398  LGNFSTP---GDHHP-MSLPSVQGPNVGLSQGQ----SGHIVTQGVSNQHIPVSDLRGAP 449
            LG+FS P    ++ P ++LP+VQ P +  +  Q      H+V Q +    +P+SDLRGA 
Sbjct: 473  LGSFSPPINGRENDPQLNLPAVQPPAMEFASQQVPHHPSHVVPQVIPGGTLPLSDLRGAM 532

Query: 450  DASFRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAK 509
            D +F A +  Q QDVQ++EPT RPEIDLDPSLVPVIPEPIKPLE++L L+EE +FFD+AK
Sbjct: 533  DGNF-APQPLQSQDVQFIEPTSRPEIDLDPSLVPVIPEPIKPLENDLTLIEETSFFDRAK 591

Query: 510  KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHI 569
            K++GNKQ+YTEFLKILNL+SQDL+  E+LV+ V HYL GSPELFDWFKSFV Y E+PKHI
Sbjct: 592  KYMGNKQVYTEFLKILNLFSQDLIGTEELVDKVEHYLGGSPELFDWFKSFVNYVEKPKHI 651

Query: 570  ENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS 629
            ENVIHEKHRLDLDLCEAC PSYK+LPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS
Sbjct: 652  ENVIHEKHRLDLDLCEACFPSYKKLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDS 711

Query: 630  GFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPP 689
            GFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMTPEEK AFKLPP
Sbjct: 712  GFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTPEEKQAFKLPP 771

Query: 690  GLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWN 749
            GLGHTS+TIYKKVIRKVYDKDRGFEIIDALHE+PA++VP++LKRLKQKDEEWRRAQREWN
Sbjct: 772  GLGHTSMTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIILKRLKQKDEEWRRAQREWN 831

Query: 750  KVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKS 809
            KVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQ+NKRI+P TPK KS
Sbjct: 832  KVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQTNKRIYPFTPKPKS 891

Query: 810  QLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGL 869
            QL YD K+  V  DIL LV  F+ +++TYS  D E+L  FFKGF+S+FFS    EIE   
Sbjct: 892  QLDYDLKDKGVLFDILCLVNNFIDHSSTYSNPDKEKLAAFFKGFLSVFFSISYQEIE--- 948

Query: 870  LKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDIL------YRNKQQKV 923
                  N T +  D    S         + RKR+  ++E  L+++L      ++ +    
Sbjct: 949  ------NSTPADSDAVSNS---------NPRKRLW-ESEQPLKELLRSKHKHHKKRDTSA 992

Query: 924  NKGPQNDQXXXXXXXXXXXXXXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANT 983
                 +D                 +RQEAKKPWLLG+I+DEA++HG+VS+R  FN+FANT
Sbjct: 993  EDDSISDDQNSPEKSPQEIEDEEVIRQEAKKPWLLGNILDEANDHGYVSNRKIFNLFANT 1052

Query: 984  NIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGAD 1043
            N+YVFFRHLTTMY+RL EVK +N EVT+EI++R VVQFAKDLNL+STQL+DMGLDFKG D
Sbjct: 1053 NVYVFFRHLTTMYQRLSEVKNMNEEVTREINSRNVVQFAKDLNLVSTQLSDMGLDFKGKD 1112

Query: 1044 AYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKT 1103
            AY                HQWFEESLRQAYKNKAFK+YT+DKVIQ+LVKHAH+I+ D K+
Sbjct: 1113 AYDQLLTLCKRLIRNDMDHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSIITDAKS 1172

Query: 1104 VEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDL 1163
             EIM+LF+ DR  T+TSTK+QILYRLQVRS M   ENMFR+E N  + H  IQ+VA++DL
Sbjct: 1173 AEIMILFEKDRRCTATSTKEQILYRLQVRSYMGLTENMFRVEINKDSCHVCIQYVAIDDL 1232

Query: 1164 TLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDERYSPEG 1223
            TL EP+SL+D+W YYLTSY+LSHPTEGI H+ ++ PFLEK ++ DE   D+G E  SP G
Sbjct: 1233 TLKEPESLKDRWHYYLTSYALSHPTEGIPHEEIKVPFLEKTLQDDEE-ADEGSEERSPSG 1291

Query: 1224 VASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKF------PTRVDVKKKKSAELKLVLE 1277
             + SN++++++P +Y +++EPG  DIF+R +VN+F       +  D+K++K    +  L 
Sbjct: 1292 HSLSNLRIQVNPESYELQIEPGSKDIFTRFAVNRFLNSSENNSNTDLKEEK----RKTLM 1347

Query: 1278 GFLNGERGWKRGLTTKRTAEAERRLEYVKNNG 1309
              L+G RGWK+G++ +   +    L YV+ +G
Sbjct: 1348 SQLDGSRGWKKGMSQELVDKTLTALNYVRLHG 1379

>KAFR0A05120 Chr1 (1015307..1019746) [4440 bp, 1479 aa] {ON} Anc_6.29
            YOL004W
          Length = 1479

 Score = 1363 bits (3528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/1246 (56%), Positives = 857/1246 (68%), Gaps = 93/1246 (7%)

Query: 125  DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184
            D ++YRPLNVKDALSYLEQVK QF+SRPD+YN FLDIMKDFKSQ IDTPGVIERVSTLF 
Sbjct: 206  DDASYRPLNVKDALSYLEQVKQQFNSRPDIYNQFLDIMKDFKSQTIDTPGVIERVSTLFR 265

Query: 185  GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXTEPRL 244
            GYP+LIQGFNTFLP GY I+CPS+PNDPIKVTTP G+     +T            +  L
Sbjct: 266  GYPSLIQGFNTFLPTGYRIDCPSNPNDPIKVTTPIGSSTLHEMTRSVQRANSNLQQQQAL 325

Query: 245  QST---QNVPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFA 301
                  Q       S   +    A   +  +Q     KK  DVEFS AI+YVNKIK RFA
Sbjct: 326  SQNNMMQQAQIPIGSISNNANLNAAVQSVDDQAKQANKKPADVEFSQAINYVNKIKNRFA 385

Query: 302  EQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQLQSHQ 361
            +QPDIYK+FLEILQTYQREQKPINEVYAQVT+LFQNA             SS       Q
Sbjct: 386  DQPDIYKNFLEILQTYQREQKPINEVYAQVTILFQNAPDLLDDFKKFLPDSS-----KEQ 440

Query: 362  QINGAMVAPGFGHAQSGLQQ-----ALPGTQPL--MHQQNLPPLGNFSTPGDH------- 407
            Q  G +  P     Q  L++     A P   PL  + QQ+LPP+G+FS P +        
Sbjct: 441  QYTGQL--PQQIPNQEQLEEFSGSYARPPNAPLDMVAQQSLPPIGSFSPPANTGISMHDQ 498

Query: 408  ----HPMSLPSV--QGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQ- 460
                H M+LPS+      + ++      + TQG+SN  IPVSD+R A   +    +Y Q 
Sbjct: 499  SQRPHMMALPSMLQHEQIIDMNNHPKPAVSTQGISNDEIPVSDVRMAQYPNGAVPDYGQY 558

Query: 461  ---------------------------------------VQDVQYMEPTVRPEIDLDPSL 481
                                                    Q  QY+E  VRPEIDLDPS+
Sbjct: 559  PTHPQMKPDLATQRHILQQQEIQQQQLMLQQQQEQELLEQQQQQYVEAPVRPEIDLDPSI 618

Query: 482  VPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVED 541
            VPV+PEP +P+E    L+EE +FFDKAKKFI NKQIYTEFLK+LNL+SQDL+  + LV  
Sbjct: 619  VPVVPEPTEPIESNFTLIEETSFFDKAKKFINNKQIYTEFLKVLNLFSQDLISVDDLVNK 678

Query: 542  VSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFM 601
            V +Y+  S ELF+WF++FVGYQ  PK IEN++HEKHRLDLDLCEACGPSYKRLPK+DTFM
Sbjct: 679  VEYYIGSSKELFEWFRNFVGYQGNPKIIENIVHEKHRLDLDLCEACGPSYKRLPKSDTFM 738

Query: 602  PCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANL 661
            PCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIE+NL
Sbjct: 739  PCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIESNL 798

Query: 662  RTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHE 721
            RTIQTLE I NKI+NM+ EEK  FKL PGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE
Sbjct: 799  RTIQTLEAIVNKISNMSEEEKKNFKLEPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHE 858

Query: 722  HPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTA 781
            HPAI  P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT 
Sbjct: 859  HPAIAAPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTI 918

Query: 782  KQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPS 841
            KQLISEISSIKVDQ+NKRIH LTPK KSQL++D K+ E+  DILSL   F+ +++TYS S
Sbjct: 919  KQLISEISSIKVDQNNKRIHWLTPKPKSQLNFDIKDFEILFDILSLSENFINHSSTYSTS 978

Query: 842  DNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARK 901
            D ERL DF K FISLFFS PL+EI   L KR++Q  +    D       +      + +K
Sbjct: 979  DKERLNDFLKSFISLFFSVPLNEINNALDKRNNQKNSEKVTDSALPDGTE------NQKK 1032

Query: 902  RVRDDTEHLLRDILYRNKQQKV---NKGPQN------DQXXXXXXXXXXXXXXXXVRQEA 952
            R   D E  + DIL+R K QK+   N+G  +      D                 +RQ+A
Sbjct: 1033 RSIHDIELSMSDILHRTKYQKMKLSNRGSDSQEENNIDTIIDEESDERLAEEADLIRQDA 1092

Query: 953  KKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKE 1012
            K+PWLLG I+D+ +  G ++DR  FN+FANTNIYVF RH TT+YERL+E+K++NGEVTKE
Sbjct: 1093 KRPWLLGDIIDKTNTQGIITDRKKFNLFANTNIYVFLRHWTTLYERLLELKEMNGEVTKE 1152

Query: 1013 ISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQA 1072
            I+NRK V+FA+DL L+STQL +MGLDF   D+Y                HQWFEESLRQA
Sbjct: 1153 INNRKSVKFAEDLGLVSTQLKNMGLDFVDKDSYEELLRLSKRLIENDIEHQWFEESLRQA 1212

Query: 1073 YKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVR 1132
            Y N+AFKLYT+DKV+QALVKH HT++ D+KT E+M LF+ DR S++TS KDQILYRLQ R
Sbjct: 1213 YNNRAFKLYTVDKVVQALVKHGHTLMTDYKTTEVMKLFEKDRLSSATSAKDQILYRLQAR 1272

Query: 1133 SNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGIS 1192
            S+MSN E MFRIEYN    +  IQ++A++DLTL E  +  +KW+YY+TSYSL HPTEGI 
Sbjct: 1273 SHMSNTEYMFRIEYNKDDRNICIQYIALDDLTLKEGNTEEEKWKYYVTSYSLPHPTEGID 1332

Query: 1193 HDNLRTPFLEKIIERDE------GYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGC 1246
            H++L+ PFL+KI+E D+         +  + +YSPEGV++S  K+KI P  Y+++++ G 
Sbjct: 1333 HESLQIPFLQKILEFDQEELENNDEENKSNGKYSPEGVSNSMYKIKIHPGNYALDIQTGS 1392

Query: 1247 HDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGL 1290
             DIFSRKS+NK+P +V  D +  K  + K +L  FL    GWK+ L
Sbjct: 1393 FDIFSRKSLNKYPVKVNEDHESLKLNKKKNILNTFLESNNGWKKHL 1438

>NCAS0D02130 Chr4 (394326..398630) [4305 bp, 1434 aa] {ON} Anc_6.29
            YOL004W
          Length = 1434

 Score = 1341 bits (3471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1239 (57%), Positives = 855/1239 (69%), Gaps = 94/1239 (7%)

Query: 128  AYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYP 187
            AYRPLNVKDALSYLEQVK+QFS RPD+YN FLDIMKDFKSQ+IDTPGVIERVS LF GYP
Sbjct: 206  AYRPLNVKDALSYLEQVKYQFSQRPDIYNQFLDIMKDFKSQSIDTPGVIERVSALFRGYP 265

Query: 188  ALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXTEPRLQST 247
             L+QGFNTFLP GY IEC +DP+ PI+VTTP GT                  +E  LQ  
Sbjct: 266  MLVQGFNTFLPQGYRIECTTDPDGPIRVTTPMGT----STLSGGPAMEAPSSSESNLQQQ 321

Query: 248  QN--VPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPD 305
            Q+   PT+   A  +        T Q +  +   K  +VEFS AI+YVNKIK RFA+QPD
Sbjct: 322  QHHQSPTIPSLAASTFQESNFQQTPQPEDQSA--KNAEVEFSQAINYVNKIKNRFADQPD 379

Query: 306  IYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSA-------PQLQ 358
            IYK FLEILQTYQREQKPINEVY+QVTVLFQ+A             SS        PQ  
Sbjct: 380  IYKRFLEILQTYQREQKPINEVYSQVTVLFQHAPDLLDDFKKFLPESSGTTSTSELPQNA 439

Query: 359  SHQQINGAMVAPGFGHAQSGLQQAL----PGTQPLMHQQNLPPLGNFS----------TP 404
              QQ   A+  P   H Q G          GTQ     QNLPP+G+F+           P
Sbjct: 440  GIQQ-RAAIPTPNPKHQQYGYPNNYYPNGTGTQ-----QNLPPIGSFAPPNGTASREYAP 493

Query: 405  GDHH--PMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLR---------------- 446
            G+    P  LPS+   +  L Q Q   +V  G +N+ IPVS+LR                
Sbjct: 494  GNQFVGPGGLPSMIPNDQALQQQQQPGLV-HGYTNEAIPVSNLRSPLTDQQYPNLLNMQN 552

Query: 447  ----GAPDASFRASEYNQVQDVQYM-EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEE 501
                G  D +   +   Q    QY  E  +RPEIDLDPS+VPVIPEP +PLE  ++LVEE
Sbjct: 553  QMTPGQMDINNATAPMAQ----QYTNEAPIRPEIDLDPSIVPVIPEPTEPLEYNVSLVEE 608

Query: 502  ATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVG 561
              FF+KAKKFIG KQ+YTEFLKILNLYSQDLL  ++L   V +YL  + ELF WFK+FVG
Sbjct: 609  TNFFEKAKKFIGTKQVYTEFLKILNLYSQDLLTTDELCVKVEYYLGSNEELFTWFKNFVG 668

Query: 562  YQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGH 621
            +QE+P  IEN++HEKH+LDLDLCEACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGH
Sbjct: 669  FQEKPLIIENIVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSGRDEMCWEVLNDEWVGH 728

Query: 622  PVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEE 681
            PVWASEDSGFIAHRKNQYE++LFK EEERHEYDF IE+NLRTIQTLETIANKI NMT EE
Sbjct: 729  PVWASEDSGFIAHRKNQYEESLFKTEEERHEYDFCIESNLRTIQTLETIANKIGNMTNEE 788

Query: 682  KAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEW 741
            K  FKLPPGLGHTS TIYKKVIRKVYDKDRGFEIID LHE PA+TVP+VLKRLKQKDEEW
Sbjct: 789  KKNFKLPPGLGHTSSTIYKKVIRKVYDKDRGFEIIDLLHEEPALTVPVVLKRLKQKDEEW 848

Query: 742  RRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIH 801
            RRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ+NKRIH
Sbjct: 849  RRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIH 908

Query: 802  PLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYP 861
             LTPK KSQL + F + ++F DIL L  VF+ +++TYS  + ER+KDF + F+SLFFS P
Sbjct: 909  WLTPKPKSQLEFQFDDNDIFVDILGLTSVFINHSSTYSNPEKERMKDFLRVFVSLFFSIP 968

Query: 862  LHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKT--------EKHSARKRVRDDTEHLLRD 913
            L ++ E L  RS         +  +K+KE  +            S  K+   + +  L D
Sbjct: 969  LDKVNEALSDRSHW-----LQEKEKKTKESSRNIDSTTSSSSSGSNSKKRPLNIDIPLAD 1023

Query: 914  ILYRNKQQKVNK-----GPQNDQXX-------XXXXXXXXXXXXXXVRQEAKKPWLLGSI 961
            IL ++K QK+ K       +N Q                       + +E K+PWLLG+I
Sbjct: 1024 ILRKHKYQKIRKQAKESNEENAQEEDDENIVGDSNEELNEQDENEIILEEIKRPWLLGNI 1083

Query: 962  VDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQF 1021
            ++ A NHG +S+R  FNMFANTNIYVFFR  T +YERL E+K+IN +VTKE+++R++ QF
Sbjct: 1084 IETASNHGTISNRKVFNMFANTNIYVFFRLWTVIYERLYEMKQINEKVTKEVNSRRISQF 1143

Query: 1022 AKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLY 1081
            AKDLNLISTQL DMGLDF G ++Y                HQWFEESLRQA+ NKAFKLY
Sbjct: 1144 AKDLNLISTQLKDMGLDFVGVNSYQELLVLSKRLIQNDIEHQWFEESLRQAFNNKAFKLY 1203

Query: 1082 TIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENM 1141
            T+DKVIQ+LVKHAHTIL D KT EIM+LF+ DR  +STS K+QILYRLQ R++M+N ENM
Sbjct: 1204 TVDKVIQSLVKHAHTILGDVKTSEIMVLFEKDRLCSSTSAKEQILYRLQTRAHMTNTENM 1263

Query: 1142 FRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFL 1201
            FRIE+N   +H  IQ++A+EDLT+ +PKS+   W+YY+TSYSL HPTEG+  D L+ PFL
Sbjct: 1264 FRIEFNEEKNHVCIQYIALEDLTIKQPKSMEKNWEYYVTSYSLPHPTEGVPQDELKIPFL 1323

Query: 1202 EKIIERDEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTR 1261
            EK +E +    ++GD + SPEGV+SS +K+KIDP +Y++E+EPG  D+FSRKS+N +PT 
Sbjct: 1324 EKTLELEVD--EEGDNKSSPEGVSSSKLKIKIDPKSYALEIEPGSFDLFSRKSMNVYPTY 1381

Query: 1262 VD-VKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAE 1299
             D  KK+KS +    +  FL+G+ GWK+ LTT  +   E
Sbjct: 1382 SDETKKRKSID---QMTKFLDGKNGWKKNLTTADSTNIE 1417

>YOL004W Chr15 (316938..321548) [4611 bp, 1536 aa] {ON}  SIN3Component
            of the Sin3p-Rpd3p histone deacetylase complex, involved
            in transcriptional repression and activation of diverse
            processes, including mating-type switching and meiosis;
            involved in the maintenance of chromosomal integrity
          Length = 1536

 Score = 1333 bits (3449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/1345 (53%), Positives = 881/1345 (65%), Gaps = 138/1345 (10%)

Query: 129  YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
            YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 216  YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 275

Query: 189  LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTI---GEIPITXXXXXXXXXXXTEPR-- 243
            LIQGFNTFLP GY IEC S+P+DPI+VTTP GT      I  +           + P   
Sbjct: 276  LIQGFNTFLPQGYRIECSSNPDDPIRVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESD 335

Query: 244  ---LQSTQNVPTVYRS-----------------AEGS----------PAAIATPATTQEQ 273
               +Q   NVP V  S                 A  S          PA    P +    
Sbjct: 336  GNGVQQPSNVPMVPSSVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLV 395

Query: 274  YGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 333
                 KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT 
Sbjct: 396  PQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 455

Query: 334  LFQNAXXXXXXXXXXXXXSSAP-------------------------------QLQSHQQ 362
            LFQNA             SSA                                     Q+
Sbjct: 456  LFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQAQAQAQAQAQVEQQK 515

Query: 363  INGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDH--------------- 407
                 + P  G+      + +P       QQNLPP+G+FS P +                
Sbjct: 516  QQQQFLYPASGYYGHPSNRGIP-------QQNLPPIGSFSPPTNGSTVHEAYQDQQHMQP 568

Query: 408  -HPMSLPSV--QGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRG------APDASFRASEY 458
             H M LPS+   GPN          +V QG++N++ P+SDLR       AP +     ++
Sbjct: 569  PHFMPLPSIVQHGPN----------MVHQGIANENPPLSDLRTSLTEQYAPSSIQHQQQH 618

Query: 459  NQ----VQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGN 514
             Q    + + QY +  VRPEIDLDPS+VPV+PEP +P+E+ ++L EE TFF+KAK++IGN
Sbjct: 619  PQSISPIANTQYGDIPVRPEIDLDPSIVPVVPEPTEPIENNISLNEEVTFFEKAKRYIGN 678

Query: 515  KQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIH 574
            K +YTEFLKILNLYSQD+L+ + LVE V  YL  + ELF WFK+FVGYQE+ K IEN++H
Sbjct: 679  KHLYTEFLKILNLYSQDILDLDDLVEKVDFYLGSNKELFTWFKNFVGYQEKTKCIENIVH 738

Query: 575  EKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAH 634
            EKHRLDLDLCEA GPSYKRLPK+DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAH
Sbjct: 739  EKHRLDLDLCEAFGPSYKRLPKSDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAH 798

Query: 635  RKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHT 694
            RKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ LETI NKI NMT  EKA FKLPPGLGHT
Sbjct: 799  RKNQYEETLFKIEEERHEYDFYIESNLRTIQCLETIVNKIENMTENEKANFKLPPGLGHT 858

Query: 695  SVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRE 754
            S+TIYKKVIRKVYDK+RGFEIIDALHEHPA+T P+VLKRLKQKDEEWRRAQREWNKVWRE
Sbjct: 859  SMTIYKKVIRKVYDKERGFEIIDALHEHPAVTAPVVLKRLKQKDEEWRRAQREWNKVWRE 918

Query: 755  LEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYD 814
            LEQKVF+KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ+NK+IH LTPK KSQL +D
Sbjct: 919  LEQKVFFKSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTNKKIHWLTPKPKSQLDFD 978

Query: 815  FKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSS 874
            F +  +F DIL L   F+ +   YS  D ERLKD  K FISLFFS    +IEE L     
Sbjct: 979  FPDKNIFYDILCLADTFITHTTAYSNPDKERLKDLLKYFISLFFSISFEKIEESLY---- 1034

Query: 875  QNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQ--- 931
                 SH  +  +S         ++RKR       LL DIL+R++ QK+ +    D    
Sbjct: 1035 -----SHKQNVSESSGSDDGSSIASRKRPYQQEMSLL-DILHRSRYQKLKRSNDEDGKVP 1088

Query: 932  --XXXXXXXXXXXXXXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFF 989
                              + +EAK PWL G++V+EA++ G + +R  FN+FANTNIY+FF
Sbjct: 1089 QLSEPPEEEPNTIEEEELIDEEAKNPWLTGNLVEEANSQGIIQNRSIFNLFANTNIYIFF 1148

Query: 990  RHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXX 1049
            RH TT+YERL+E+K++N  VTKEI+ R  V FAKDL+L+S+QL++MGLDF G DAY    
Sbjct: 1149 RHWTTIYERLLEIKQMNERVTKEINTRSTVTFAKDLDLLSSQLSEMGLDFVGEDAYKQVL 1208

Query: 1050 XXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLL 1109
                        HQWFEESLRQAY NKAFKLYTIDKV Q+LVKHAHT++ D KT EIM L
Sbjct: 1209 RLSRRLINGDLEHQWFEESLRQAYNNKAFKLYTIDKVTQSLVKHAHTLMTDAKTAEIMAL 1268

Query: 1110 FDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPK 1169
            F  DR +++TS KDQI+YRLQVRS+MSN ENMFRIE++  T H SIQ++A++DLTL EPK
Sbjct: 1269 FVKDRNASTTSAKDQIIYRLQVRSHMSNTENMFRIEFDKRTLHVSIQYIALDDLTLKEPK 1328

Query: 1170 SLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDG---DERYSPEGVAS 1226
            +  DKW+YY+TSY+L HPTEGI H+ L+ PFLE++IE   G   DG   DE +SPEG++ 
Sbjct: 1329 ADEDKWKYYVTSYALPHPTEGIPHEKLKIPFLERLIEF--GQDIDGTEVDEEFSPEGISV 1386

Query: 1227 SNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGER 1284
            S +K+KI P+TY + +E G +D+F+RK+ NK+PT    + +K   ++ K ++  FL+   
Sbjct: 1387 STLKIKIQPITYQLHIENGSYDVFTRKATNKYPTIANDNTQKGMVSQKKELISKFLDCAV 1446

Query: 1285 GWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEE-ISTDTKAALSTTTDTAGNVSTASFSS 1343
            G +  L   +    +++ E +K++        + I ++T+    T  + + N+ +++ S 
Sbjct: 1447 GLRNNLDEAQKLSMQKKWENLKDSIAKTSAGNQGIESETEKGKITKQEQSDNLDSSTASV 1506

Query: 1344 QTAANAAISASSPESALQSNNGNSE 1368
              A+   +    P+       GN+E
Sbjct: 1507 LPASITTV----PQDDNIETTGNTE 1527

>KNAG0F02920 Chr6 (552441..556919) [4479 bp, 1492 aa] {ON} Anc_6.29
            YOL004W
          Length = 1492

 Score = 1331 bits (3445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/1314 (53%), Positives = 868/1314 (66%), Gaps = 108/1314 (8%)

Query: 127  SAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGY 186
            S YRPLNVKDALSYLEQVK QF+SRP +YN FLDIMKDFKSQ IDTPGVIERVSTLF G+
Sbjct: 216  SPYRPLNVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVSTLFKGF 275

Query: 187  PALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXTEPRLQS 246
            PALIQGFNTFLP GY IEC S+PN+PIKVTTP G +  +  +             P  QS
Sbjct: 276  PALIQGFNTFLPQGYRIECSSNPNEPIKVTTPMGVLENVRGSDITADQQPAIGQLPTTQS 335

Query: 247  --TQNVPTVYRSAEGSPAAIATPATTQEQYGTG----PKKAGDVEFSHAISYVNKIKTRF 300
                ++P    +    P+ +A   T Q+         PKKA DVEFS AISYVNKIK RF
Sbjct: 336  PIQASLPPPQSAHLHLPSTVAAATTVQQSANVHAENEPKKANDVEFSQAISYVNKIKNRF 395

Query: 301  AEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQLQ-- 358
            ++QPDIYK+FLEILQTYQREQKPINEVYAQVTVLF NA             SSA   Q  
Sbjct: 396  SDQPDIYKNFLEILQTYQREQKPINEVYAQVTVLFHNAPDLLDDFKKFLPDSSASNEQQP 455

Query: 359  -----SHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHPMSLP 413
                 S Q  +GA +A G+ +  +G+       QP   Q NLPP+G+FS P +       
Sbjct: 456  KQSPYSPQVYSGADMARGYMYNNTGVYYPPQVNQP---QSNLPPIGSFSPPANG------ 506

Query: 414  SVQGPNVG--LSQGQSGHIVT--------------QGVSNQHIPVSDLRGAPDASFRASE 457
                P  G  +      H+V                 ++N  I +S++RG        ++
Sbjct: 507  --VAPTTGTAIPHADEQHVVAGVPAMAPHEQQHAPSMINNDGIQISNMRGGGTVP-ALNQ 563

Query: 458  YNQVQDVQYM-------------------------------EPTVRPEIDLDPSLVPVIP 486
            Y  +    Y                                +  VRPEIDLDPS+VPV+P
Sbjct: 564  YGMISPHDYTQQQAKQVQQFQEDQQQQQQQSMMMDEQYGSGDMQVRPEIDLDPSIVPVVP 623

Query: 487  EPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYL 546
            EP +P+E+ L+L EE +FF+K KK IGN+QIY EFLK+LNL+SQDL+  ++LV  V +YL
Sbjct: 624  EPTEPIENNLSLSEETSFFEKVKKNIGNRQIYIEFLKVLNLFSQDLIAVDELVTKVENYL 683

Query: 547  SGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGR 606
            +G PELF+WFK+FVGYQ++PK IENVIHEKHRLDLDLCEA GPSYK+LPK+DTFMPCSGR
Sbjct: 684  AGQPELFEWFKNFVGYQDKPKIIENVIHEKHRLDLDLCEAYGPSYKKLPKSDTFMPCSGR 743

Query: 607  DEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQT 666
            D+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQT
Sbjct: 744  DDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQT 803

Query: 667  LETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAIT 726
            LETIA+KIANMT EEK  FKLPPGLGHTS+TIYKK+IRKVYDK+RGFEIID LHEHPAIT
Sbjct: 804  LETIASKIANMTEEEKNMFKLPPGLGHTSLTIYKKIIRKVYDKERGFEIIDELHEHPAIT 863

Query: 727  VPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLIS 786
            VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQLIS
Sbjct: 864  VPIVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQLIS 923

Query: 787  EISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERL 846
            EISSIKVDQ+NKR+H LTPK K QL Y F + ++  DI+ L  VF+ + +TYS  D ERL
Sbjct: 924  EISSIKVDQNNKRMHWLTPKPKKQLDYQFNDMDIIFDIVGLTDVFVDHCSTYSNPDKERL 983

Query: 847  KDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDD 906
            KD F+ FISLFF  P   I   L  +S +  +     DT+  K D       ++KR R D
Sbjct: 984  KDLFRVFISLFFFIPRDLISAALDTKSDEGKST----DTKFEKAD------DSKKRPRPD 1033

Query: 907  TEHLLRDILYRNKQQKVNKGPQNDQXXXXXXXXXXXXXXXXVRQEAKKPWLLGSIVDEAD 966
             E  L DIL+R K QK+  G                       + A KPWL+G IV+ A+
Sbjct: 1034 VELSLSDILHRAKYQKLKNGEGLGMSEDDDEEKLAKEAEEMSEKNASKPWLVGDIVERAN 1093

Query: 967  NHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLN 1026
            +HG V+DR  +N+F NTN+Y+F RH +T+Y RL+E+K+++  VTKEI+NRKVVQFA+DLN
Sbjct: 1094 SHGLVTDRAVYNLFGNTNVYIFIRHWSTLYGRLLELKQMDERVTKEINNRKVVQFAEDLN 1153

Query: 1027 LISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKV 1086
            L+STQL DMGLDF G +AY                HQWFEESLRQAY NKAFKLYT+DKV
Sbjct: 1154 LLSTQLRDMGLDFDGKNAYQETLKLSKRLIRNELEHQWFEESLRQAYNNKAFKLYTVDKV 1213

Query: 1087 IQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEY 1146
            + +LVKHAHT++ D+K+ E+M LF+ DR  +ST  KDQILYRL  RS+MS+ ENMFR++Y
Sbjct: 1214 VHSLVKHAHTLMTDNKSSELMELFEKDRLQSSTCVKDQILYRLLTRSHMSSTENMFRVQY 1273

Query: 1147 NTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIE 1206
            N  T H SIQ++ ++D+TL++ K   ++W YY+TSY+L HPTEGI  D L  PFLE+I+E
Sbjct: 1274 NKDTRHVSIQYIGLDDVTLEDAKDDNERWNYYMTSYALPHPTEGIMQDKLVVPFLERILE 1333

Query: 1207 RDEGYID--DGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDV 1264
             +   +D   G +RY+P G + S +K+ IDP TY + ++ G +DIFSR S+N++P R D 
Sbjct: 1334 FENDMLDVEAGSDRYNPVGTSYSKLKINIDPKTYKLIIQDGSYDIFSRSSINEYPIRPDS 1393

Query: 1265 KK--KKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEISTDT 1322
            K   +   + K   + FL+G  GWK+ L+                    DD    +    
Sbjct: 1394 KGYVQMVEKRKETAQKFLDGRFGWKKDLS--------------------DDVINTVEPTK 1433

Query: 1323 KAA-LSTTTDTAGNVSTASFSSQTAANAAISASSPESALQSNNGNSEVTSPIAN 1375
            K A LS  T   G +ST   + + A N  +    P +  +++N ++  TS + +
Sbjct: 1434 KIALLSEETKDVGTLSTPVTTEKGAEN-TVHGLQPVALAENSNASTMGTSTVGD 1486

 Score = 33.9 bits (76), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 485 IPEPIKPLEDELNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVS 543
           I  P +PL    N+ +  ++ ++ K +F     IY +FL I+  +    ++   ++E VS
Sbjct: 214 IDSPYRPL----NVKDALSYLEQVKLQFNSRPYIYNQFLDIMKDFKSQNIDTPGVIERVS 269

Query: 544 HYLSGSPELFDWFKSFV--GYQ 563
               G P L   F +F+  GY+
Sbjct: 270 TLFKGFPALIQGFNTFLPQGYR 291

>ZYRO0C07524g Chr3 (569197..574209) [5013 bp, 1670 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004W SIN3 DNA
            binding protein involved in transcriptional regulation
          Length = 1670

 Score = 1321 bits (3418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/1187 (57%), Positives = 825/1187 (69%), Gaps = 102/1187 (8%)

Query: 251  PTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHF 310
            PT   S+   P     PA  Q Q     KKA DVEFS AISYVNKIK RF++QPDIYKHF
Sbjct: 487  PTSAVSSGTGPTQPEVPAPVQPQLADQTKKAADVEFSQAISYVNKIKNRFSDQPDIYKHF 546

Query: 311  LEILQTYQREQKPINEVYAQVTVLFQNA-----------XXXXXXXXXXXXXSSAPQLQS 359
            LEILQTYQREQKPINEVYAQVTVLFQNA                           P +Q 
Sbjct: 547  LEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKFLPDSSASAAQQQRQQLQPVMQ- 605

Query: 360  HQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGD-----------HH 408
            HQQ   A  A G+G+          G    + +QNLPPLG+FS P +             
Sbjct: 606  HQQ---AAAATGYGYY---------GENQPVARQNLPPLGSFSPPPNGTAPRDYYQEPSQ 653

Query: 409  PMSLPSVQGPNVGLSQGQSGH-IVTQGVSNQHIPVSDLR----GAPDAS----------- 452
             M+LP +       ++    H ++TQG+SN  IP+S++R    GAP A            
Sbjct: 654  GMALPPMTHLETQAAKVTPSHYVMTQGMSNDAIPLSNMRSPTVGAPGAQTPVETAPQHPQ 713

Query: 453  ---------------------------------FRASEYNQVQDVQYMEPTVRPEIDLDP 479
                                              + S+    Q+VQY++  VRPEIDLDP
Sbjct: 714  QYSPQQAPQPQLPQQQLPPQQQEQSLPPQTIPLTQPSQLGPQQEVQYVDIAVRPEIDLDP 773

Query: 480  SLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLV 539
            S+VPV+PEP +P+ED L+LVEE +FFDKAKKFIGNKQ+YTEFLKILNLYSQDLL+ + LV
Sbjct: 774  SIVPVVPEPTEPIEDSLSLVEETSFFDKAKKFIGNKQLYTEFLKILNLYSQDLLDIDGLV 833

Query: 540  EDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADT 599
            E V HYL GS ELF WFK+FVGYQ+RPK+IENVIHEKHRLDLD+CEA GPSYK+LPK+DT
Sbjct: 834  EKVEHYLGGSKELFTWFKNFVGYQDRPKNIENVIHEKHRLDLDMCEASGPSYKKLPKSDT 893

Query: 600  FMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEA 659
            FMPCSGRDEMCWEVLNDEW+GHPVWASEDSGFIAHRKNQYE+TLFK+EEERHEYDFYIE+
Sbjct: 894  FMPCSGRDEMCWEVLNDEWIGHPVWASEDSGFIAHRKNQYEETLFKVEEERHEYDFYIES 953

Query: 660  NLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDAL 719
            NLRTIQTLETIA+KIANMT EEKA FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDAL
Sbjct: 954  NLRTIQTLETIASKIANMTEEEKANFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDAL 1013

Query: 720  HEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLL 779
            HEHPA+ VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLL
Sbjct: 1014 HEHPAVAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLL 1073

Query: 780  TAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYS 839
            T KQLISEISSIKVDQ+NKRIH LTPK KSQL YDF + E+F DILSL  VFL +   YS
Sbjct: 1074 TTKQLISEISSIKVDQTNKRIHWLTPKPKSQLDYDFPDREIFCDILSLTEVFLNHTGNYS 1133

Query: 840  PSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSA 899
             SD ERLKDF K F+SLFFS P+ E+ +GL +RS  N      +     KE+     H  
Sbjct: 1134 NSDKERLKDFLKSFLSLFFSIPVSEVNDGLRRRSPSNKEEHEAN----KKENGTALAHGK 1189

Query: 900  RKRVRDDTEHLLRDILYRNKQQKVN------KGPQNDQXXXXXXXXXXXXXXXXVRQEAK 953
            R R   + E  LRDIL+RNK QK+       +G                     ++QEAK
Sbjct: 1190 RPR---EIELPLRDILHRNKYQKLKLRSDGEEGSIGQSEEGLDEQEEVDEEEEIIKQEAK 1246

Query: 954  KPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEI 1013
            KPWLLG+IV+EA+  G +S+R +FN+FANT+IYVFFRHLTT+YERL+EVK I+ EVT+EI
Sbjct: 1247 KPWLLGNIVEEANAQGIISNRKSFNLFANTSIYVFFRHLTTLYERLIEVKSIDQEVTQEI 1306

Query: 1014 SNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAY 1073
            ++RKV QFAKDLNLIS QL +MGLDF G DAY                HQWFEESLRQAY
Sbjct: 1307 NSRKVSQFAKDLNLISEQLKNMGLDFAGLDAYEQLLHLSKRLIEGDIEHQWFEESLRQAY 1366

Query: 1074 KNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRS 1133
             N+AFK YT+DKV+QALVKHAHTIL D K  EIM+LF+ DRT  +TS KDQILYR+Q RS
Sbjct: 1367 NNRAFKFYTVDKVVQALVKHAHTILTDIKCSEIMVLFEKDRTLATTSAKDQILYRMQARS 1426

Query: 1134 NMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISH 1193
            +MSN ENMFRIE+N  + H  IQ++A++DLTL E KSL DKW+YY+TSYSLSHPTEGISH
Sbjct: 1427 HMSNTENMFRIEFNRISKHVCIQYIAIDDLTLAEAKSLEDKWKYYVTSYSLSHPTEGISH 1486

Query: 1194 DNLRTPFLEKIIERDEGYIDD--GDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFS 1251
            ++L+ PFLEKIIE ++ Y +D  GD ++SPEGV+ S++++KIDP TY +EVEPG  D+FS
Sbjct: 1487 EDLQVPFLEKIIESEQEYDEDNGGDPKFSPEGVSKSSLRIKIDPETYFLEVEPGSCDVFS 1546

Query: 1252 RKSVNKFPTRVDVK--KKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNG 1309
            RK+VNKFP   + +  K K  +   ++ G+L+ E+GWK+ L  K     E +L +VKN G
Sbjct: 1547 RKAVNKFPLEKNSESHKTKVDKKNELIRGYLDSEKGWKKNLDAKSIQSVEEKLNFVKNYG 1606

Query: 1310 TLDDY-AEEISTDTKAALSTTTDTAGNVSTASFSSQTAANAAISASS 1355
            TL  Y A+E   ++    +  +D     + ++  +  AAN   S ++
Sbjct: 1607 TLQGYRAQENGLESTTKEAPFSDAVERKADSAAQADGAANGGPSNTA 1653

 Score =  178 bits (451), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 86/93 (92%)

Query: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
           YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 277 YRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFRGYPN 336

Query: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221
           LIQGFNTFLP GY I+C  +P++PIKVTTP G+
Sbjct: 337 LIQGFNTFLPQGYRIDCSQNPDEPIKVTTPMGS 369

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +FS +PD+Y HFL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 525 AISYVNKIKNRFSDQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 584

Query: 197 LP 198
           LP
Sbjct: 585 LP 586

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 285 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFR 332

>CAGL0E02475g Chr5 (236580..241061) [4482 bp, 1493 aa] {ON} similar to
            uniprot|P22579 Saccharomyces cerevisiae YOL004w SIN3
            transcription regulatory protein
          Length = 1493

 Score = 1295 bits (3352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1310 (52%), Positives = 864/1310 (65%), Gaps = 109/1310 (8%)

Query: 125  DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184
            D  +YRPLNVKDALSYLEQVKFQF +RPD+YN FLDIMKDFKSQ IDTPGVIERVS+LF 
Sbjct: 181  DPMSYRPLNVKDALSYLEQVKFQFHTRPDIYNLFLDIMKDFKSQTIDTPGVIERVSSLFK 240

Query: 185  GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXTEPRL 244
            GYP LIQGFNTFLP GY IEC ++PNDPIKVTTP G+      +             P  
Sbjct: 241  GYPNLIQGFNTFLPQGYRIECSNNPNDPIKVTTPMGS------STTVLNTAPQKSPSPSD 294

Query: 245  QSTQNVPTVYRSAEGSPAAIATPATTQEQYGTG---PKKAGDVEFSHAISYVNKIKTRFA 301
              T N  T   + E    + ATP  TQ   G      KK  DVEFS AI+YVNKIKTRFA
Sbjct: 295  IQTNNQQTQAIAQEAQLQSQATPIPTQHDVGQNFGSAKKPADVEFSQAITYVNKIKTRFA 354

Query: 302  EQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQLQS-- 359
            +QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQNA             SSA   +   
Sbjct: 355  DQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNAPDLLDDFKKFLPDSSASGSEETQ 414

Query: 360  ----------HQQINGAMVAPGFG----HAQSGLQQALPG------TQPLMHQQNLPPLG 399
                        ++ G   A  +     +AQ+G  + + G       Q    QQNLPP+G
Sbjct: 415  VQQQQHYQSLSDKMGGNAEAANYAASGMNAQTGYYEPVKGGVSYNTQQNQHQQQNLPPIG 474

Query: 400  NFSTPGD----------HHP------MSLPSVQG-----PNVGLSQGQS----------- 427
            +FS P +           +P      MSLPS+           + Q  S           
Sbjct: 475  SFSPPTNGPFVDQTQQSANPETQKGVMSLPSMMNNAEAVKEQAIKQAHSRLISDSHDHNS 534

Query: 428  -GHIVTQGV-SNQHIPVSDLRGA-------PDASFR--ASEYNQVQDVQYM----EPTVR 472
               +++Q + SN  IPVS+LR         P+  ++   +    + D  Y+    E  VR
Sbjct: 535  QQQVLSQNIHSNDDIPVSNLRTTVVEQNYHPETIYQQQGNAQQHMVDGGYVGTPSELVVR 594

Query: 473  PEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDL 532
            PEIDLDPSLVPV+PEP +P+E+ LNL+EE  FF++ KK IGNKQIY EFLKILNL+S DL
Sbjct: 595  PEIDLDPSLVPVVPEPTEPIENSLNLMEETNFFERVKKSIGNKQIYNEFLKILNLFSLDL 654

Query: 533  LEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYK 592
            L  ++LV+ V +Y+  + ELFDWFK FVGYQ++PK IEN++HEKH+LDLDLCEA GPSYK
Sbjct: 655  LTVDELVDKVEYYIGANKELFDWFKVFVGYQDKPKRIENIVHEKHKLDLDLCEAYGPSYK 714

Query: 593  RLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHE 652
            +LPK DTFMPCSGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHE
Sbjct: 715  KLPKTDTFMPCSGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHE 774

Query: 653  YDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRG 712
            YD+YIE+NLRTIQTLETIANKIANMT  EKA F+LPPGLGHTS+TIYKKVIRKVYDK+RG
Sbjct: 775  YDYYIESNLRTIQTLETIANKIANMTDAEKAQFRLPPGLGHTSMTIYKKVIRKVYDKERG 834

Query: 713  FEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFK 772
            FEIIDALH +PAI+VP++L+RLKQKDEEWRRAQREWNK+WR+LEQKV++KSLDHLGLTFK
Sbjct: 835  FEIIDALHNYPAISVPIILRRLKQKDEEWRRAQREWNKIWRDLEQKVYFKSLDHLGLTFK 894

Query: 773  QADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFL 832
            QADKKLLT KQLISEI+ IKVDQ++KRIH LTPK K+QL YDF + ++  DI++L  VF 
Sbjct: 895  QADKKLLTTKQLISEINGIKVDQNSKRIHWLTPKPKNQLDYDFPDYDILFDIIALGFVFT 954

Query: 833  ANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKR--SSQNGTIS---HGDDTRK 887
             N N YS  D ER+KD  + F+S FFS PL E+ + L +R  S  N   S    G   + 
Sbjct: 955  INTNLYSNPDKERIKDMLRVFVSQFFSIPLKEVSDALERRGFSDDNNNDSDKGSGKMDQI 1014

Query: 888  SKEDPKTEKHSARKRVRD-DTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXXXXXXXXXX 946
            ++E  +TE+ ++  + R  D +  + DIL++ KQQK     + D                
Sbjct: 1015 AEEIGETEQDTSSSKKRPFDNDLNMSDILHKTKQQKTKMNKEMDGSKSPSEDLGTDRNVG 1074

Query: 947  XVR-----QEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVE 1001
             +       E +K WL+G +VD A+    + +R  +N+FANTNIY+FFRHL T+YERL E
Sbjct: 1075 TIEDSGSLSEHRKQWLVGDVVDSANKETPMDNRNIYNLFANTNIYIFFRHLVTLYERLSE 1134

Query: 1002 VKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXX 1061
            VK+IN E+ KEI +R+V  FAKDL LISTQL+++GLDF  +DAY                
Sbjct: 1135 VKQINDEINKEIKSRRVTTFAKDLGLISTQLSELGLDFNSSDAYQQLLTLSKRLIEGDIE 1194

Query: 1062 HQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTST 1121
            HQWFEES+RQAY N+AFKLYTIDKV+Q+ VKHAHT++ D KT EIMLLF+N R +T T+T
Sbjct: 1195 HQWFEESIRQAYNNRAFKLYTIDKVVQSFVKHAHTLISDSKTSEIMLLFENQRNNTLTTT 1254

Query: 1122 KDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTS 1181
            KDQILYR+Q RS+MS+ ENMFRIEY     HASIQ++A++DLTL   KS  + W YY+TS
Sbjct: 1255 KDQILYRIQCRSHMSSTENMFRIEYKREKRHASIQYIALDDLTLKTAKSPEEAWNYYVTS 1314

Query: 1182 YSLSHPTEGISHDNLRTPFLEKIIERDEGYIDD--GDERYSPEGVASSNMKVKIDPLTYS 1239
            YSLS+PTEG+ H+NL  PFLEK+IE D+ Y  D   +  YS  G++ SN+ + ID   Y+
Sbjct: 1315 YSLSNPTEGVPHENLEVPFLEKVIEFDQEYSKDNGNNSTYSLAGISKSNLHIDIDREKYN 1374

Query: 1240 MEVEPGCHDIFSRKSVNKFP------TRVDVKKKKSAELKLVLEGFLNGERGWKRGLTTK 1293
            + ++ G  D++SR ++ K+P      +R     +K+ E++ VL  +              
Sbjct: 1375 LILQGGSSDVYSRATIQKYPIVASDESRAANISEKTQEIRKVLSHY-----------DGN 1423

Query: 1294 RTAEAERRLEYVKNNGTLDDYAEEISTDTKAALSTTTDTAGNVSTASFSS 1343
               +   +  Y+  NGT+D Y  + +   +    T  D +G  +T+S  S
Sbjct: 1424 SNDDVNEKFNYILANGTIDGYVRQSAAVVQETEKTYNDDSGR-NTSSIKS 1472

>KLLA0C06182g Chr3 (544281..548840) [4560 bp, 1519 aa] {ON} similar to
            uniprot|Q75CF0 Ashbya gossypii ACL004W ACL004Wp and
            weakly similar to YOL004W uniprot|P22579 Saccharomyces
            cerevisiae YOL004W SIN3 DNA binding protein involved in
            transcriptional regulation
          Length = 1519

 Score = 1289 bits (3335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/1098 (59%), Positives = 779/1098 (70%), Gaps = 86/1098 (7%)

Query: 277  GPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
            G +K G+VEFSHAISYVNKIKTRFA+QPDIYK FLEILQTYQREQKPI+EVYAQVT+LFQ
Sbjct: 418  GQQKTGEVEFSHAISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQ 477

Query: 337  NAXXXXXXXXXXXXXSSA--------------------------------------PQLQ 358
            N              SS                                       PQ Q
Sbjct: 478  NNPDLLDDFKKFLPDSSVSQQQQEQQQEPQQQQQDQQQEHQQDQEQQHHEQKQQPLPQDQ 537

Query: 359  SHQ---------QINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHHP 409
            + Q         Q N +M   GF + QSG+         LM   NLPPLGNFS  G   P
Sbjct: 538  NQQAMLPPQPYLQQNQSMQGQGF-YPQSGV---------LMQPTNLPPLGNFSASGQASP 587

Query: 410  MS----LPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDASFRASEYNQ----- 460
                  LPS+   ++        H+VTQG+SNQ IPVS++R   + ++   EY Q     
Sbjct: 588  AENSHMLPSMHQ-HIAGGHVIPQHVVTQGMSNQDIPVSEMRSTMNGTYNQVEYIQGAPGY 646

Query: 461  ---VQDVQYME-PTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQ 516
               ++ VQYME P  RPEIDLDPSLVPV+PEPI+P ED + L +E TFF++ K+FIGNKQ
Sbjct: 647  PQPLEGVQYMEAPMARPEIDLDPSLVPVVPEPIQPPEDAIALGDEVTFFERVKRFIGNKQ 706

Query: 517  IYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEK 576
            +Y EFLKILNLYSQDLL   +LV  V  YL  S ELFDWFKSFVGYQE+PKHIEN++HEK
Sbjct: 707  VYAEFLKILNLYSQDLLTTSELVSKVEFYLHSSKELFDWFKSFVGYQEKPKHIENIVHEK 766

Query: 577  HRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRK 636
            HRLDLDLCEACGPSYK+LPK DTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRK
Sbjct: 767  HRLDLDLCEACGPSYKKLPKDDTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRK 826

Query: 637  NQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSV 696
            NQYEDTLFK+EEERHEYDFYIE+NLRTIQTLETIANKIANMT EEK  FKLPPGLGHTS+
Sbjct: 827  NQYEDTLFKVEEERHEYDFYIESNLRTIQTLETIANKIANMTNEEKNNFKLPPGLGHTSL 886

Query: 697  TIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELE 756
            TIYKKV+RKVYDKDRGFEIIDALHEHPA+TVP+VLKRLKQKDEEWRRAQREWNKVWRELE
Sbjct: 887  TIYKKVVRKVYDKDRGFEIIDALHEHPAVTVPIVLKRLKQKDEEWRRAQREWNKVWRELE 946

Query: 757  QKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFK 816
            QKV+YKSLDHLGLTFKQADKKLLT KQL+SEISSIKVDQ+NKRIHPLTPK KSQL ++  
Sbjct: 947  QKVYYKSLDHLGLTFKQADKKLLTTKQLLSEISSIKVDQTNKRIHPLTPKPKSQLDFEIN 1006

Query: 817  EPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQN 876
            + EV  DIL LV  F+  N +YS SD  +L  FFK FISLFFSYP+ ++ E + +RSS  
Sbjct: 1007 DREVLYDILDLVFTFVKTNASYSNSDKIKLDHFFKAFISLFFSYPIKDVNEAVSERSSIT 1066

Query: 877  GTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQXXXXX 936
               +  +D+ KS  +      S ++ + D+  +L++DIL R K  K +   +N       
Sbjct: 1067 DQENGEEDSNKSDSE-----KSNKRTLSDEDSYLMKDILRRTKNAKTSNSEENQN--SSS 1119

Query: 937  XXXXXXXXXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMY 996
                       + +EA KPWLLGS++DEA+N G VSDR  FN+F NT IYVFFRHL T+Y
Sbjct: 1120 VKSNEEDETELLAKEAAKPWLLGSLIDEANNSGIVSDRHIFNLFTNTTIYVFFRHLNTLY 1179

Query: 997  ERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXX 1056
            ERL+EVKKI+ EVT EI NRK+VQFA DLNLISTQL DMGL FK   AY           
Sbjct: 1180 ERLLEVKKIDAEVTDEIKNRKIVQFASDLNLISTQLADMGLAFKDTKAYGELLRLSKRLI 1239

Query: 1057 XXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTS 1116
                 HQWFEESLRQAYKNKAFK+YTIDKV+Q+LVKHAH+I+ D K   +M+LF+ DR  
Sbjct: 1240 TGDLDHQWFEESLRQAYKNKAFKIYTIDKVVQSLVKHAHSIITDPKNAMVMVLFEQDRLK 1299

Query: 1117 TSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQ 1176
              T+ KDQILYRL+VR+ M   ENMFRIEYNT +SH SIQ+VAV+DLTL EP+++++KW 
Sbjct: 1300 RDTTAKDQILYRLKVRNTMGESENMFRIEYNTDSSHVSIQYVAVDDLTLKEPQNMKEKWD 1359

Query: 1177 YYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDD--GDERYSPEGVASSNMKVKID 1234
            YY+TSYSLSHPTEGI+ +++  PFL KIIE++  Y+DD   ++++SPEGV+ S +KV I 
Sbjct: 1360 YYVTSYSLSHPTEGITQEDISQPFLGKIIEKEAEYLDDEEQNDKFSPEGVSQSKLKVNIH 1419

Query: 1235 PLTYSMEVEPGCHDIFSRKSVNKFPTRVDVKKKKSAELKLVLEGFLNGERGWKRGLTTKR 1294
            P TY +  E G  D+F+RKSVNKFP+       +S +    ++ FLN  +GWK+ L+T+ 
Sbjct: 1420 PETYELTFECGSTDVFTRKSVNKFPS------SQSTQPASKMDKFLNSSKGWKKNLSTEI 1473

Query: 1295 TAEAERRLEYVKNNGTLD 1312
               AE +++ +K  G L+
Sbjct: 1474 IGRAESKMKILKEQGKLE 1491

 Score =  196 bits (498), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 87/99 (87%), Positives = 94/99 (94%)

Query: 127 SAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGY 186
           S+YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVI+RV+TLF G+
Sbjct: 199 SSYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQGF 258

Query: 187 PALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEI 225
           P LIQGFNTFLPHGY IEC ++PNDPIKVTTPFGT GE+
Sbjct: 259 PNLIQGFNTFLPHGYKIECSTNPNDPIKVTTPFGTTGEV 297

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y  FL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 430 AISYVNKIKTRFADQPDIYKQFLEILQTYQREQKPIHEVYAQVTILFQNNPDLLDDFKKF 489

Query: 197 LP 198
           LP
Sbjct: 490 LP 491

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 33/48 (68%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +VT LFQ
Sbjct: 209 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIQRVTTLFQ 256

>TDEL0G04400 Chr7 (795501..799973) [4473 bp, 1490 aa] {ON} Anc_6.29
            YOL004W
          Length = 1490

 Score = 1289 bits (3335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1077 (61%), Positives = 786/1077 (72%), Gaps = 48/1077 (4%)

Query: 279  KKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 338
            KK  DVEFS AI+YVNKIK RFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA
Sbjct: 375  KKTADVEFSQAINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 434

Query: 339  XXXXXXXXXXXXXSS-APQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPP 397
                         SS +   Q  Q       +P FG     L      T P   +QNLPP
Sbjct: 435  PDLLDDFKKFLPDSSPSANRQQQQPGVLQQQSPAFG-----LSAYYNETSPPTSRQNLPP 489

Query: 398  LGNFSTP----------GDHHP--MSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDL 445
            LG+FS P           D  P  + LP V      + Q    HI TQG++ + +PVS+L
Sbjct: 490  LGSFSPPPNGAVPHNYYRDQQPQTLGLPPVAQVENHIDQRSPPHIATQGIAGEPMPVSNL 549

Query: 446  RG---APDASFRASEYNQVQ----------DVQYMEPTVRPEIDLDPSLVPVIPEPIKPL 492
            R    A   S  A  + Q Q          D QY++  VRPEIDLDPS+VPV+PEP  P+
Sbjct: 550  RSQITAQSPSELAQLHQQQQIPSQPTANIPDGQYLDIAVRPEIDLDPSIVPVVPEPTAPI 609

Query: 493  EDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPEL 552
            ED L LVEE +FFD+AKKFIGNKQIYTEFLKILNL+SQDLL+ ++LV  V HYL G+ EL
Sbjct: 610  EDSLTLVEETSFFDRAKKFIGNKQIYTEFLKILNLFSQDLLDVDELVGRVEHYLGGNKEL 669

Query: 553  FDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWE 612
            F WFK+FVG+Q++PKHIEN++HEKHRLDLDLCEACGPSYK+LPK+DTFMPCSGRDEMCW 
Sbjct: 670  FVWFKNFVGFQDKPKHIENIVHEKHRLDLDLCEACGPSYKKLPKSDTFMPCSGRDEMCWA 729

Query: 613  VLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIAN 672
            VLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQTLETIA+
Sbjct: 730  VLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQTLETIAS 789

Query: 673  KIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLK 732
            KIANM+ EEKA FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHE+PAI VP+VLK
Sbjct: 790  KIANMSEEEKATFKLPPGLGHTSLTIYKKVIRKVYDKERGFEIIDALHEYPAIAVPVVLK 849

Query: 733  RLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK 792
            RLKQKDEEWRRAQREWNKVWRELEQKV+YKSLDHLGLTFKQADKKLLT KQLISEI SIK
Sbjct: 850  RLKQKDEEWRRAQREWNKVWRELEQKVYYKSLDHLGLTFKQADKKLLTTKQLISEIGSIK 909

Query: 793  VDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKG 852
             DQ+NKR+H LTPK K QL Y   +  VF DILSL   F+ +N++YS  D  RLKD FK 
Sbjct: 910  TDQTNKRMHWLTPKPKDQLDYYVPDKSVFFDILSLTDTFINHNSSYSNPDKIRLKDLFKI 969

Query: 853  FISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLR 912
            F+SLFFS P++E+ E + +R + +      DD   S +  +++  +  KR R+D E  L 
Sbjct: 970  FVSLFFSIPMYEVNEAVSRRGNLD------DDKEDSTQKMESDNLNNSKRPRED-EISLS 1022

Query: 913  DILYRNKQQ--KVNKGPQNDQXXXXXXXXXXXXXXXXVRQEAKKPWLLGSIVDEADNHGH 970
            ++L+R K Q  K     +  +                +RQEAKKPWLLG++V+E +  G 
Sbjct: 1023 EVLHRAKNQRFKSRAADETSEESAAEPEPELNEEEETIRQEAKKPWLLGNLVEEVNAQGL 1082

Query: 971  VSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLIST 1030
            +++R TFNMFANTNIYVFFRHLTT+YERL EVKK+N  VTKEI++RKVVQFAKDLNLIS 
Sbjct: 1083 INNRKTFNMFANTNIYVFFRHLTTLYERLEEVKKMNDAVTKEINSRKVVQFAKDLNLISQ 1142

Query: 1031 QLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQAL 1090
            QL +MGLDF+GADAY                HQWFEESLRQAY NKAFKLYT+DKVIQ+L
Sbjct: 1143 QLKEMGLDFEGADAYEQLRHLCKRLIEGDIEHQWFEESLRQAYNNKAFKLYTVDKVIQSL 1202

Query: 1091 VKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTT 1150
            VKHAHTIL D KT EIM  F+ DRT  +TS KDQILYRLQVRS MS+ ENMFRIEYN  +
Sbjct: 1203 VKHAHTILTDSKTSEIMTSFEKDRTQINTSAKDQILYRLQVRSYMSSTENMFRIEYNKQS 1262

Query: 1151 SHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEG 1210
             +  IQF+AV+DLTL EP+SL +KW+YY+TSYSLSHPTEGIS + L+ PFLEK++E +E 
Sbjct: 1263 KNVRIQFIAVDDLTLAEPRSLEEKWRYYVTSYSLSHPTEGISQEELQLPFLEKVLETEED 1322

Query: 1211 YIDDGD----ERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV---D 1263
            Y  D D    +++SPEGV+ S +K+KIDP TY +++E G +D+FSRKSVN+FP  V   D
Sbjct: 1323 YGSDVDNFSIDKFSPEGVSKSTLKIKIDPETYLLDIEAGSYDVFSRKSVNRFPVIVDSND 1382

Query: 1264 VKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEIST 1320
               KK  +  +V++ FL  ++GWK+ L   +    + +L  VK NG+LDD+ E   T
Sbjct: 1383 YTTKKEKKKNMVIQ-FLESKKGWKKNLDDDQVKAIQEKLARVKENGSLDDFNEASQT 1438

 Score =  177 bits (449), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 78/93 (83%), Positives = 87/93 (93%)

Query: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
           YRPLNVKDALSYLEQVK+QF+SRPDVYNHFLDIMKDFKSQAIDTPGVI+RVSTLF GYP 
Sbjct: 191 YRPLNVKDALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFKGYPG 250

Query: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221
           LIQGFNTFLP GY IEC ++P++PI+VTTP G+
Sbjct: 251 LIQGFNTFLPQGYRIECSANPDEPIRVTTPMGS 283

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A++Y+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 385 AINYVNKIKNRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAPDLLDDFKKF 444

Query: 197 LP 198
           LP
Sbjct: 445 LP 446

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V  +V+ LF+
Sbjct: 199 ALSYLEQVKYQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIDRVSTLFK 246

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
            (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 1246 bits (3224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1194 (54%), Positives = 820/1194 (68%), Gaps = 87/1194 (7%)

Query: 241  EPRLQSTQNVPTVYRSAEGSPAAIATPATTQE---QYGTGPKKAGDVEFSHAISYVNKIK 297
            +P +    N  T   S   +  A   P TT     Q  T  +K  DVEFS A+SYVNKIK
Sbjct: 315  KPAVLQVSNTNTGISSPSSTIPAGTVPGTTVANNIQGTTQIEKPADVEFSQAVSYVNKIK 374

Query: 298  TRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQL 357
             RFA+QPDIYKHFLEILQTYQREQKPI+EVYAQVTVLFQNA             SS P +
Sbjct: 375  NRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKFLPDSS-PSV 433

Query: 358  QSHQQINGA----------MVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGD- 406
             + Q +             M     G+ Q+G    +P        QNLPPLGNFS P + 
Sbjct: 434  TTQQPVQPQQQALPQQQQPMYGVNNGYYQAG---KIPSAN-----QNLPPLGNFSPPSNG 485

Query: 407  --------------HHPMSLPS-VQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRGAPDA 451
                          HH M+LPS +Q P          HI    ++N+ IP+SDLR     
Sbjct: 486  AVPGRPEEFSTEAQHHMMALPSMLQAPTEHAQLHAQQHIAP--MTNEAIPISDLRSQIID 543

Query: 452  SFRASEYNQVQ-------------------------DVQY-MEPTVRPEIDLDPSLVPVI 485
            +     Y  ++                         +  Y  E  VRPEIDLDPS+VPVI
Sbjct: 544  NNHVHNYTPIELAQLQQQQQQQQQQQQQQQQQQMQLEAAYATEGIVRPEIDLDPSIVPVI 603

Query: 486  PEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHY 545
            PEP +P+E+ L+LVEEA FFDKAKKFIGNKQ+Y EFLKILNLYSQD+L  + L+E V +Y
Sbjct: 604  PEPTEPIEESLSLVEEANFFDKAKKFIGNKQVYVEFLKILNLYSQDILSLDDLIEKVDYY 663

Query: 546  LSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSG 605
            L  + ELFDWFK+FVG+Q++PKHIENV+HEKH+LDLDLCEACGPSYK+LPK DTFMPCSG
Sbjct: 664  LGSNKELFDWFKNFVGFQDKPKHIENVVHEKHKLDLDLCEACGPSYKKLPKTDTFMPCSG 723

Query: 606  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQ 665
            RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTIQ
Sbjct: 724  RDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTIQ 783

Query: 666  TLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAI 725
            TLETIA+KIANMT EEK AFKLP GLGHTS TIY+KVIRKVYDK+RGFEIIDALHE+P++
Sbjct: 784  TLETIASKIANMTEEEKQAFKLPIGLGHTSTTIYQKVIRKVYDKERGFEIIDALHEYPSV 843

Query: 726  TVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLI 785
             VP+VLKRLKQKD+EWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQ+DKKLLT KQL+
Sbjct: 844  AVPVVLKRLKQKDKEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQSDKKLLTTKQLL 903

Query: 786  SEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNER 845
            +EISSIKVDQ+NKRIH LTPK KSQL Y+ K+  V  DIL L  VF+ + ++YS  D ER
Sbjct: 904  AEISSIKVDQTNKRIHWLTPKPKSQLDYEVKDKRVLFDILRLADVFINHTSSYSNPDKER 963

Query: 846  LKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRD 905
            L+DF + +I LFFS P+ EI++ +         I +G    +++++  + K ++ KR R 
Sbjct: 964  LRDFLQSYIGLFFSIPIREIKDAV------EAAIDNGKQLDENEQN--SSKKNSNKRPR- 1014

Query: 906  DTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXX---XXXXXXXXXVRQEAKKPWLLGSIV 962
            D E  L DIL R++ Q++     + +                   +RQEAKKPWLLGS+V
Sbjct: 1015 DVEICLSDILNRSRYQRLKHSLDSSEASLGAVSPGQNEQDDMDEMIRQEAKKPWLLGSLV 1074

Query: 963  DEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFA 1022
            +EA++ G + +R  +NMFAN N+YVF R+L T+Y+RL EVK IN  VTKEI+ RKVVQFA
Sbjct: 1075 EEANSQGLIQNRKIYNMFANVNMYVFMRNLITIYDRLHEVKDINDVVTKEINGRKVVQFA 1134

Query: 1023 KDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYT 1082
            KDLNLIS QL +MGLDF G D+Y                HQWFEESLRQAY+N+AFKLYT
Sbjct: 1135 KDLNLISAQLKNMGLDFSGGDSYTQLLLLSKRLIEGDLEHQWFEESLRQAYRNRAFKLYT 1194

Query: 1083 IDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMF 1142
            IDKVIQ+LVKHAH I+ D K+ ++M LF+ DR S+ST++KDQILYRLQ RS+MS  E+MF
Sbjct: 1195 IDKVIQSLVKHAHAIMTDSKSSDVMALFEKDRISSSTTSKDQILYRLQTRSHMSTTEHMF 1254

Query: 1143 RIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLE 1202
            RIEYNT  S  SIQ++A++DLTL+EPK+L DKW+YY+TSYSLSHPTEGI  + ++ PFL+
Sbjct: 1255 RIEYNTKKSSISIQYIALDDLTLEEPKTLEDKWKYYITSYSLSHPTEGIPQEEIKIPFLD 1314

Query: 1203 KIIERDEGYIDDGDE--RYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPT 1260
            K+IE ++ +++D D+  +YSPEGV+ SN+ +KIDP TY +EVEPG  DIFSRKSVNKFP 
Sbjct: 1315 KVIESEQVHMEDEDDNPKYSPEGVSKSNLMIKIDPETYRLEVEPGSFDIFSRKSVNKFPV 1374

Query: 1261 RV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEI 1318
             V  +  K K    +   + FLNG+ GWKR L++   ++ E++   +K NGT    +   
Sbjct: 1375 DVFSESYKVKKQTRRNRCKNFLNGKHGWKRQLSSDAISKIEQKFNDLK-NGTFQQRSRSA 1433

Query: 1319 STDTKAALSTTTDTAGNVSTASFSSQTAANA----AISASSPESALQSNNGNSE 1368
            +++T +     +D+      ++ +S+T+  A     I+++ P+   + N+  +E
Sbjct: 1434 TSETTSVPLNASDSTQKEQESTGTSETSQPALQKVPINSAEPDQEERGNDTTTE 1487

 Score =  185 bits (469), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 82/97 (84%), Positives = 89/97 (91%)

Query: 125 DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184
           DGS YRPLNVKDAL+YLEQVK QF+SRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF 
Sbjct: 117 DGSYYRPLNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

Query: 185 GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221
           GYP LIQGFNTFLP GY IEC S+P+DPIKVTTP G+
Sbjct: 177 GYPNLIQGFNTFLPQGYTIECSSNPDDPIKVTTPLGS 213

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 366 AVSYVNKIKNRFADQPDIYKHFLEILQTYQREQKPISEVYAQVTVLFQNAPDLLDDFKKF 425

Query: 197 LP 198
           LP
Sbjct: 426 LP 427

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 32/48 (66%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           A++Y+ ++K +F  +PDIY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 129 ALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 176

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 496 LNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFD 554
           LN+ +  T+ ++ K +F     IY  FL I+  +    ++   ++E VS    G P L  
Sbjct: 124 LNVKDALTYLEQVKLQFNSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPNLIQ 183

Query: 555 WFKSFV--GY 562
            F +F+  GY
Sbjct: 184 GFNTFLPQGY 193

>Kwal_56.22462 s56 complement(139779..144404) [4626 bp, 1541 aa] {ON}
            YOL004W (SIN3) - DNA binding protein involved in
            transcriptional regulation [contig 185] FULL
          Length = 1541

 Score = 1200 bits (3105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/947 (63%), Positives = 722/947 (76%), Gaps = 38/947 (4%)

Query: 393  QNLPPLGNFSTP----GDHHPMSLPSVQGPNVGL---SQGQS-GHIVTQGVSNQHIPVSD 444
            QNLPPLGNFS P     +   ++LP+VQ P +      Q QS  H+V QG++N  +PVSD
Sbjct: 578  QNLPPLGNFSPPINGRDNEAQVNLPAVQPPALDFPPQQQSQSHRHVVAQGMTNNSLPVSD 637

Query: 445  LRGAPDASFRASEYNQVQDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATF 504
            +RG  D  F A +    QDVQYMEPT RPEIDLDPSLVPVIPEPI+PLE++  L+EE +F
Sbjct: 638  MRGPVDGGF-APQPLYSQDVQYMEPTSRPEIDLDPSLVPVIPEPIRPLENDSTLIEETSF 696

Query: 505  FDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQE 564
            FDKAKK++GNKQ+YTEFLKILNL+SQDL++ ++LV+ V HYL G+ ELFDWFKSFV Y E
Sbjct: 697  FDKAKKYMGNKQVYTEFLKILNLFSQDLIDTDELVDKVEHYLGGNSELFDWFKSFVNYVE 756

Query: 565  RPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVW 624
            RPKHIENV+HEKHRLDLDLCEAC PSYK+LPKADTFMPC GRDEMCWEVLNDEWVGHPVW
Sbjct: 757  RPKHIENVVHEKHRLDLDLCEACCPSYKKLPKADTFMPCCGRDEMCWEVLNDEWVGHPVW 816

Query: 625  ASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAA 684
            ASEDSGFIAHRKNQYE+TLFKIEEERHEYD+YIEANLRTIQ LETIANKI+NMT EEK  
Sbjct: 817  ASEDSGFIAHRKNQYEETLFKIEEERHEYDYYIEANLRTIQLLETIANKISNMTVEEKKT 876

Query: 685  FKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRA 744
            FKLPPGLGHTS TIYKKVIRKVYDKDRGFEIIDALHE+PA++VP+VL+RLKQKDEEWRRA
Sbjct: 877  FKLPPGLGHTSTTIYKKVIRKVYDKDRGFEIIDALHENPAVSVPIVLRRLKQKDEEWRRA 936

Query: 745  QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLT 804
            QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIK+DQ+NKRI+P T
Sbjct: 937  QREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQLISEISSIKIDQANKRIYPFT 996

Query: 805  PKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHE 864
             K KSQL +D  +  V  DIL+LV  F+ ++ TYS  D E+L  FF+GF+S+FFS PL +
Sbjct: 997  SKPKSQLDFDISDKGVLFDILNLVDTFIDHSTTYSNPDKEKLSAFFRGFLSIFFSIPLTD 1056

Query: 865  IEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVN 924
                 L   S+   + +GD T              RKR RDD +   RD+L    +Q   
Sbjct: 1057 -----LDNPSEEHKVENGDST--------------RKRSRDD-DQFFRDLLKSKHKQAKK 1096

Query: 925  KGPQ------NDQXXXXXXXXXXXXXXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFN 978
            K  Q      +D                 VR +AKKPWLLG+I+DEA+NHG VS+R T+N
Sbjct: 1097 KTSQQEDESTSDDQDTAAKTSPDLEYEEAVRLDAKKPWLLGNILDEANNHGFVSNRKTYN 1156

Query: 979  MFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLD 1038
            MFANTNIYVFFRHLTTMY+RL E K IN EVTKEI++RKVVQFAKDLNL STQL+DMGLD
Sbjct: 1157 MFANTNIYVFFRHLTTMYQRLSEAKNINEEVTKEINSRKVVQFAKDLNLASTQLSDMGLD 1216

Query: 1039 FKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTIL 1098
            FKGADAY                HQWFEESLRQAYKNKAFK+YT+DKVIQ+LVKHAH+I+
Sbjct: 1217 FKGADAYEQLLALCKRLIQSDIEHQWFEESLRQAYKNKAFKIYTVDKVIQSLVKHAHSII 1276

Query: 1099 MDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFV 1158
             D KT EIM+LF+ DR + +TST++QILYRLQVRS M   ENMFRIE N+T++H SIQFV
Sbjct: 1277 TDAKTAEIMILFEKDRKAPTTSTREQILYRLQVRSCMGLTENMFRIELNSTSAHVSIQFV 1336

Query: 1159 AVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGDER 1218
            AV+DLTL++P SL+D+WQYYLTSYSLSHPTEG+ H+ ++ PFLEK + RD+G  D+  E 
Sbjct: 1337 AVDDLTLNQPNSLKDQWQYYLTSYSLSHPTEGVPHEEIKAPFLEKTL-RDDGDSDEDSEW 1395

Query: 1219 YSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDVKKKKSAE-LKLVLE 1277
            YSP G + S ++++I+P +Y++++EP   D+F+R +VNK PT++     + A+ ++  L 
Sbjct: 1396 YSPGGQSVSQLRIQINPESYALQIEPNSKDLFTRSTVNKHPTKIGEASGRDAKTMQKSLA 1455

Query: 1278 GFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEISTDTKA 1324
              +N E GWK+GL  +   +AE  + +VK  G L+  A  +S D K 
Sbjct: 1456 DMVNSEHGWKKGLQNESIGKAESIINFVKARGFLEK-ATTVSPDPKV 1501

 Score =  265 bits (676), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 164/336 (48%), Positives = 184/336 (54%), Gaps = 54/336 (16%)

Query: 53  HYTLPSISAAGLPGAGEPHGGS--RLPPMQNALGVGGGGPGSIANGFAVGRLEXXXXXXX 110
           H  LPS+S     G  E +G S  RLP MQ A        GS   GF+V  L        
Sbjct: 163 HVVLPSLSGLETGGRAE-YGASAQRLPFMQGAAPQSASSGGS--KGFSVASLNNPLPMQQ 219

Query: 111 XXXXXXXXXXXXX-----------XDGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFL 159
                                      ++YRPLN KDALSYLEQVKFQF++RPDVYNHFL
Sbjct: 220 QQQQQQQQQQQQQLLQQGVLPLEHVQDASYRPLNFKDALSYLEQVKFQFNNRPDVYNHFL 279

Query: 160 DIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTFLPHGYNIECPSDPNDP--IKVTT 217
           DIMKD+KSQAIDT GVIER+STLF GYP LIQG NTFLP GY IEC S+P+DP  IKVTT
Sbjct: 280 DIMKDYKSQAIDTLGVIERISTLFKGYPVLIQGLNTFLPQGYKIECTSNPHDPHSIKVTT 339

Query: 218 PFGTIGEIPITXXXXXXX--------XXXXTEPRLQSTQNVPTVYRSAEGSPAAI-ATPA 268
           PF T  E+ +                    T P     Q         E +P  + A+ A
Sbjct: 340 PFDTTRELSLDHNTGGSAVGGHLAGPATVSTSPSQIPRQETAVSETKQEETPVDLPASAA 399

Query: 269 TTQEQ--------------------------YGTGPKKAGDVEFSHAISYVNKIKTRFAE 302
             Q+Q                          Y T  +  GDVEFSHAISYVNKIKTRFA+
Sbjct: 400 FAQDQVHHAESDTQREIQKSAQLQQSQQDQQYATN-RPNGDVEFSHAISYVNKIKTRFAD 458

Query: 303 QPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNA 338
           QPDIYKHFLEILQTYQREQKPI+EVY QVT LFQNA
Sbjct: 459 QPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNA 494

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V++LF   P L+  F  F
Sbjct: 445 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPIHEVYTQVTSLFQNAPDLLDDFKKF 504

Query: 197 LP 198
           LP
Sbjct: 505 LP 506

>TPHA0J00400 Chr10 complement(89956..94494) [4539 bp, 1512 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1512

 Score = 1177 bits (3046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/1156 (52%), Positives = 779/1156 (67%), Gaps = 102/1156 (8%)

Query: 252  TVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFL 311
            +V +S+  +P        TQ+      K A DVEFS A+SYVNKIK RF ++PDIYK FL
Sbjct: 321  SVIQSSANAPIQPNMHNMTQDTMKITEKPA-DVEFSQAVSYVNKIKNRFVDEPDIYKTFL 379

Query: 312  EILQTYQREQKPINEVYAQVTVLFQNA--------------XXXXXXXXXXXXXSSAPQL 357
            EILQTYQ+EQKPI+EVY+QVT+LFQNA                           ++A Q 
Sbjct: 380  EILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKFLPDNNNSAGAETNQNIQANAMQY 439

Query: 358  QSHQQINGAMVAPGFGHAQSGLQQALPGTQP--------LMHQQNLPPLGNFSTPGDHHP 409
            Q   Q N   +        +  Q  +P            ++  Q+LPPLGNF  P + + 
Sbjct: 440  QQLHQ-NNVAIPQHIYENNTYYQNNVPTAAAAAANAAGNVVTIQSLPPLGNFLPPSNKNN 498

Query: 410  ---------MSLPSVQGPNVGLSQGQ------------SGHIVTQGVSNQHIPVSDLRGA 448
                     M + S+  P V   Q Q            +    T  ++N+ + +S+LRG+
Sbjct: 499  NTTAVNNNLMGISSIMHPKVDHIQSQQYIADQKQAYTPAQQQSTTQLTNEAMQISELRGS 558

Query: 449  P-----------DASFRASEYNQVQDVQYM------------------------------ 467
            P           + ++  +E NQ+Q  Q++                              
Sbjct: 559  PMMDGQTARNLANVNYSPAELNQLQAQQHISIQQQQQQQQQQQQQLQMQMQMQMDGGYPQ 618

Query: 468  EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNL 527
            + +VRPEIDLDPS+VPVIPEP++P+ED L+LVEE  FFDKAKKFI NKQIY EFLKILNL
Sbjct: 619  DISVRPEIDLDPSIVPVIPEPVEPIEDSLSLVEETNFFDKAKKFINNKQIYMEFLKILNL 678

Query: 528  YSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEAC 587
            YSQ++L   +LVE V +YL  + ELFDWFK FVGYQ++PKHIEN++HEKH+LDLDLCEA 
Sbjct: 679  YSQNILNVNELVEKVQYYLGSNKELFDWFKGFVGYQDKPKHIENIVHEKHKLDLDLCEAY 738

Query: 588  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 647
            GPSYK+LPK DTFMPCSGRDEMCWEVLND+WVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 739  GPSYKKLPKTDTFMPCSGRDEMCWEVLNDDWVGHPVWASEDSGFIAHRKNQYEETLFKIE 798

Query: 648  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVY 707
            EERHEYDFYIE+NLRTIQTLETIA+KIANMT EE+A FKLP GLGHTSVTIY+KVIRKVY
Sbjct: 799  EERHEYDFYIESNLRTIQTLETIASKIANMTEEERANFKLPIGLGHTSVTIYQKVIRKVY 858

Query: 708  DKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 767
             K+RGFE+IDALHE+PA+ VP++LKRLKQKDEEWRRAQREWNKVWREL+QKV+YKSLDHL
Sbjct: 859  GKERGFELIDALHEYPAVAVPIILKRLKQKDEEWRRAQREWNKVWRELQQKVYYKSLDHL 918

Query: 768  GLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSL 827
            GLTFKQADKKLLT KQLISEISSIKVDQ+NK++H LTPK KSQL Y   + ++  DIL L
Sbjct: 919  GLTFKQADKKLLTTKQLISEISSIKVDQTNKKLHWLTPKPKSQLDYKVADRQILYDILKL 978

Query: 828  VMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRK 887
              VF+ + + YS  D ERL+DF + FISLFF  PL +I+  +  RS         DDT+ 
Sbjct: 979  TDVFINHTSNYSNPDKERLRDFLQSFISLFFFIPLADIKAAIKIRSPL-------DDTKT 1031

Query: 888  SKEDPKTEKHS-ARKRVRDDTEHLLRDILYRNKQQKVNKG-PQNDQXXXXXXXXXXXXXX 945
              E+   +     +KR  +D +    DIL + K QKV +G  +N+               
Sbjct: 1032 DSEESSGDSDKFPKKRSIEDDDISFHDILDKVKYQKVKQGLDKNETFSNDISSATSVDDD 1091

Query: 946  XXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKI 1005
              +RQEA+KPWLLGSIVD+A++ G + +R  +N+F NTNIYVF RHL T+YERL E K++
Sbjct: 1092 ELIRQEAQKPWLLGSIVDDANSLGIIQNRSKYNIFGNTNIYVFIRHLITLYERLNEAKQM 1151

Query: 1006 NGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWF 1065
            N EVT+EI NR +V FAKDLNL+STQL +MGLDF+G D+Y                H WF
Sbjct: 1152 NAEVTEEIKNRSIVPFAKDLNLVSTQLKNMGLDFEGTDSYKQLLDLSTRLIEGNLEHHWF 1211

Query: 1066 EESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQI 1125
            EESLRQA++NKAFKLYTIDKV Q++VKHAHTI+ D KT EIM+L + DR+  +TS+KDQI
Sbjct: 1212 EESLRQAFRNKAFKLYTIDKVTQSIVKHAHTIMSDTKTAEIMMLMEKDRSCATTSSKDQI 1271

Query: 1126 LYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLS 1185
            LYRLQ RS+MS  +NMFRIE+N ++ + SIQ++ ++DLTL EPK+  +KW+YY+TSY+LS
Sbjct: 1272 LYRLQARSHMSTTDNMFRIEFNKSSDNISIQYIGMDDLTLGEPKTAEEKWKYYITSYALS 1331

Query: 1186 HPTEGISHDNLRTPFLEKIIERDEGYIDDG---DERYSPEGVASSNMKVKIDPLTYSMEV 1242
            HPTEG+  + ++ PFLEKI+E +E Y ++    +++YSP+GV+ S++K+KI P  Y++E+
Sbjct: 1332 HPTEGVPQEEIQIPFLEKILETEEAYAEEEEVINDKYSPKGVSQSDLKIKISPENYALEI 1391

Query: 1243 EPGCHDIFSRKSVNKFPTRV---DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAE 1299
            EPG  D FSR S+NK+P  V   D K KK   +  V   FLNG+ GWK+ L+        
Sbjct: 1392 EPGSFDTFSRLSMNKYPIDVTSDDYKNKKKLSIDRV-NAFLNGKFGWKQSLSEDEINNIN 1450

Query: 1300 RRLEYVKNNGTLDDYA 1315
             +  ++K  G+L +Y 
Sbjct: 1451 LKYSHIKKYGSLKNYV 1466

 Score =  182 bits (463), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 81/97 (83%), Positives = 88/97 (90%)

Query: 125 DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184
           D   YRPLNVKDAL+YLEQVK QFSSRPD+YNHFLDIMKDFKSQ+IDTPGVIERVSTLF 
Sbjct: 138 DEQFYRPLNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

Query: 185 GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221
           GYP+LIQGFNTFLP GY IEC ++PNDPIKVTTP G+
Sbjct: 198 GYPSLIQGFNTFLPQGYTIECTNNPNDPIKVTTPIGS 234

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F   PD+Y  FL+I++ ++ +      V  +V+ LF   P L+  F  F
Sbjct: 357 AVSYVNKIKNRFVDEPDIYKTFLEILQTYQKEQKPIHEVYSQVTILFQNAPDLLDDFKKF 416

Query: 197 LPHGYN 202
           LP   N
Sbjct: 417 LPDNNN 422

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 6/91 (6%)

Query: 246 STQNVPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPD 305
           S  NV T Y +  G+ A+      + EQ+   P    D     A++Y+ ++K +F+ +PD
Sbjct: 113 SIPNVNTTYSATAGTTASANDSKESDEQF-YRPLNVKD-----ALTYLEQVKLQFSSRPD 166

Query: 306 IYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           IY HFL+I++ ++ +      V  +V+ LF+
Sbjct: 167 IYNHFLDIMKDFKSQSIDTPGVIERVSTLFR 197

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 496 LNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFD 554
           LN+ +  T+ ++ K +F     IY  FL I+  +    ++   ++E VS    G P L  
Sbjct: 145 LNVKDALTYLEQVKLQFSSRPDIYNHFLDIMKDFKSQSIDTPGVIERVSTLFRGYPSLIQ 204

Query: 555 WFKSFV--GY 562
            F +F+  GY
Sbjct: 205 GFNTFLPQGY 214

>Suva_15.171 Chr15 (291325..296010) [4686 bp, 1561 aa] {ON} YOL004W
            (REAL)
          Length = 1561

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/967 (57%), Positives = 690/967 (71%), Gaps = 60/967 (6%)

Query: 392  QQNLPPLGNFSTPGDH----------------HPMSLPSV--QGPNVGLSQGQSGHIVTQ 433
            QQNLPP+G+FS P +                 H M LPS+  QGPN          +V Q
Sbjct: 562  QQNLPPIGSFSPPTNGSTTHEGFQDQQHMQPPHLMPLPSMVQQGPN----------MVHQ 611

Query: 434  GVSNQHIPVSDLRGAPDASFRASEY----------NQVQDVQYMEPTVRPEIDLDPSLVP 483
            G+ N++IP+SDLR +    +  S +          + + D QY +  VRPEIDLDPS+VP
Sbjct: 612  GIVNENIPLSDLRTSLTDQYAPSNFQQQQQQQPSISPIIDSQYGDVPVRPEIDLDPSIVP 671

Query: 484  VIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVS 543
            V+PEP +P+ED ++L EE TFF+KAK++IGNK +YTEFLKILNLYSQD+L+ + LVE V 
Sbjct: 672  VVPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVD 731

Query: 544  HYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPC 603
             YL  + ELF WFK+FVGYQE+ K IENV+HEKHRLDLDLCEA GPSYKRLPK+DTFMPC
Sbjct: 732  FYLGSNKELFSWFKNFVGYQEKIKSIENVVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPC 791

Query: 604  SGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRT 663
            SGRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRT
Sbjct: 792  SGRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRT 851

Query: 664  IQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHP 723
            IQ LETI NKI NMT  EKA FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEHP
Sbjct: 852  IQCLETIVNKIENMTENEKANFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHP 911

Query: 724  AITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQ 783
            A+T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKV++KSLDHLGLTFKQADKKLLT KQ
Sbjct: 912  AVTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVYFKSLDHLGLTFKQADKKLLTTKQ 971

Query: 784  LISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDN 843
            LISEISSIKVDQ+NK+IH LTPK KSQL +DF + ++F DIL L   F+A+   YS  D 
Sbjct: 972  LISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKDIFYDILYLADSFIAHTTAYSNPDK 1031

Query: 844  ERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRV 903
            ERLKD    FISLFFS PL +IEE L          S+  +   S      +  + RKR 
Sbjct: 1032 ERLKDLLNYFISLFFSIPLEKIEEALQ---------SYKQNLSDSSGSDDGDSSTPRKRP 1082

Query: 904  RDDTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXX-----XXXXXXXXXVRQEAKKPWLL 958
                  LL DIL+R+K QK+ +    D                      + +EAK PWL 
Sbjct: 1083 YQQEMSLL-DILHRSKYQKLKRSNDEDGKVPQLSEPLDEESNAIEEEELINEEAKNPWLT 1141

Query: 959  GSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKV 1018
            G++V+EA++ G + +R  FN+FAN+NIY+FFRH TT+YERL+E+K++N +VTKEIS R +
Sbjct: 1142 GNLVEEANSQGIIQNRNIFNLFANSNIYIFFRHWTTIYERLLEIKQMNEKVTKEISKRSM 1201

Query: 1019 VQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAF 1078
            V FAKDL+L+S+QL++MGLDF G DAY                HQWFEE LRQAY NKAF
Sbjct: 1202 VTFAKDLDLLSSQLSEMGLDFNGEDAYKQVLKLSRRLINGELEHQWFEEGLRQAYNNKAF 1261

Query: 1079 KLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNI 1138
            KLYTIDKVIQ LVKHAHT++ D KT EIM LF  DR +++TS KDQI+YRLQ RS MSN 
Sbjct: 1262 KLYTIDKVIQLLVKHAHTLMTDAKTAEIMALFVKDRNASTTSAKDQIIYRLQARSYMSNT 1321

Query: 1139 ENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRT 1198
            ENMFR+E++    H S+Q++A++DLTL EP++  DKW+YY+TSY+L HPTEGISH+ L+ 
Sbjct: 1322 ENMFRMEFDRRNLHVSVQYIALDDLTLKEPRADEDKWKYYVTSYALPHPTEGISHEKLKI 1381

Query: 1199 PFLEKIIERDEGYIDDG---DERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSV 1255
            PFLE++IE   G   DG   DE++SPEG++ S +K+KI P+TY + +E G +D+F+RK+ 
Sbjct: 1382 PFLERLIEY--GQDTDGREVDEKFSPEGLSVSTLKIKIQPVTYKLHIESGSYDVFTRKAA 1439

Query: 1256 NKFPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKNNGTLDD 1313
            NK+PT    D+ K+   +   ++  FL+     +  L   +    + +L+ +K   T  D
Sbjct: 1440 NKYPTVANDDIHKEMVVKKTGLISKFLDNAIRLRNDLNETKKLSMQEKLDSLKGATTKAD 1499

Query: 1314 YAEEIST 1320
              ++I+ 
Sbjct: 1500 VDDKITV 1506

 Score =  266 bits (680), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/250 (59%), Positives = 163/250 (65%), Gaps = 48/250 (19%)

Query: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
           YRPLNVKDALSYLEQVKFQF+SRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 67  YRPLNVKDALSYLEQVKFQFNSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 126

Query: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXTEPR----- 243
           LIQGFNTFLP GY IEC ++P+DPI+VTTP GT                   EP+     
Sbjct: 127 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTT----TVNNNVSPPARSALEPQEPSSL 182

Query: 244 -------LQSTQNVP----TVYRSAE------------GSPAAIAT------------PA 268
                  +  + NVP     VY S +             +P+ + +            P 
Sbjct: 183 PEADGSTIPQSHNVPMVPSNVYHSEQSQDQQQQPLPLLANPSGLPSIHQPELPIPQSQPL 242

Query: 269 TTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVY 328
           T QE      KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVY
Sbjct: 243 TAQEDV----KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY 298

Query: 329 AQVTVLFQNA 338
           AQVT LFQNA
Sbjct: 299 AQVTHLFQNA 308

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF   P L++ F  F
Sbjct: 259 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 318

Query: 197 LP 198
           LP
Sbjct: 319 LP 320

 Score = 33.1 bits (74), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 15/98 (15%)

Query: 478 DPSLVPVIPEPIKPL---------ED-----ELNLVEEATFFDKAK-KFIGNKQIYTEFL 522
           +PS +P I +P  P+         ED     ++   +  ++ +K K +F     IY  FL
Sbjct: 222 NPSGLPSIHQPELPIPQSQPLTAQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFL 281

Query: 523 KILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFV 560
           +IL  Y ++     ++   V+H    +P+L + FK F+
Sbjct: 282 EILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 319

>Smik_15.166 Chr15 (284165..288865) [4701 bp, 1566 aa] {ON} YOL004W
            (REAL)
          Length = 1566

 Score = 1090 bits (2818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/988 (56%), Positives = 694/988 (70%), Gaps = 56/988 (5%)

Query: 392  QQNLPPLGNFSTPGDH----------------HPMSLPSVQGPNVGLSQGQSGHIVTQGV 435
            QQNLPP+G+FS P +                 H M LPS+      +  G   +IV QG+
Sbjct: 569  QQNLPPIGSFSPPTNGSTVHENYQDQQHMQPPHLMPLPSM------VQHG--ANIVHQGI 620

Query: 436  SNQHIPVSDLRGAPDASFRASEYNQ-----------VQDVQYMEPTVRPEIDLDPSLVPV 484
            +N+++P+SDLR +    +  S   Q           + + QY +  VRPEIDLDPS+VPV
Sbjct: 621  ANENLPLSDLRTSLTEQYAPSNIQQQQQQHPQSISPIANSQYGDVPVRPEIDLDPSIVPV 680

Query: 485  IPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSH 544
            +PEP +P+ED ++L EE TFF+KAK++IGNK +YTEFLKILNLYSQD+L+ + LVE V  
Sbjct: 681  VPEPTEPIEDNISLNEEVTFFEKAKRYIGNKHLYTEFLKILNLYSQDILDLDDLVEKVDF 740

Query: 545  YLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEACGPSYKRLPKADTFMPCS 604
            YL  + ELF WFK+FVGYQER K IEN++HEKHRLDLDLCEA GPSYKRLPK+DTFMPCS
Sbjct: 741  YLGSNKELFSWFKNFVGYQERTKFIENIVHEKHRLDLDLCEAFGPSYKRLPKSDTFMPCS 800

Query: 605  GRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYIEANLRTI 664
            GRD+MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIEEERHEYDFYIE+NLRTI
Sbjct: 801  GRDDMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIEEERHEYDFYIESNLRTI 860

Query: 665  QTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEIIDALHEHPA 724
            Q LETI NKI NMT  EK  FKLPPGLGHTS+TIYKKVIRKVYDK+RGFEIIDALHEHPA
Sbjct: 861  QCLETIVNKIENMTENEKVNFKLPPGLGHTSMTIYKKVIRKVYDKERGFEIIDALHEHPA 920

Query: 725  ITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQADKKLLTAKQL 784
            +T P+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+KSLDHLGLTFKQADKKLLT KQL
Sbjct: 921  VTAPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFFKSLDHLGLTFKQADKKLLTTKQL 980

Query: 785  ISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANNNTYSPSDNE 844
            ISEISSIKVDQ+NK+IH LTPK KSQL +DF +  +F DIL L   F+++   YS  D E
Sbjct: 981  ISEISSIKVDQTNKKIHWLTPKPKSQLDFDFPDKNIFCDILYLADSFISHTTAYSNPDKE 1040

Query: 845  RLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRKSKEDPKTEKHSARKRVR 904
            RLKD  K FISLFFS  L EIEE L          ++     +S          +RKR  
Sbjct: 1041 RLKDLLKYFISLFFSISLEEIEESLQ---------AYKQSVSESSGSDDGGSSVSRKRSY 1091

Query: 905  DDTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXXX-----XXXXXXXXVRQEAKKPWLLG 959
               E  L DIL+R++ QK+ +    D                      + +EAK PWL G
Sbjct: 1092 QQ-EMTLLDILHRSRYQKLKRSKDEDGKVPQLSEAPDEESNIIEEEELINEEAKNPWLTG 1150

Query: 960  SIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEISNRKVV 1019
            ++V+EA++ G + +R  FN+FANTNIY+FFRH TT+YERL+E+K++N +VTKEI+ R  V
Sbjct: 1151 NLVEEANSQGMIQNRGIFNLFANTNIYIFFRHWTTIYERLLEIKQMNEKVTKEINTRSTV 1210

Query: 1020 QFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFK 1079
             FAKDL+L+S QL++MGLDF G DAY                HQWFEESLRQAY N+AFK
Sbjct: 1211 TFAKDLDLLSNQLSEMGLDFIGEDAYKQVLKLSRRLINGDLEHQWFEESLRQAYNNRAFK 1270

Query: 1080 LYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTSTSTKDQILYRLQVRSNMSNIE 1139
            LYTIDKV Q+LVKHAHT++ D KT EIM LF  DR  T+TS K QI+YRLQVRS+MSN E
Sbjct: 1271 LYTIDKVTQSLVKHAHTLMTDAKTAEIMALFVKDRNVTTTSAKGQIIYRLQVRSHMSNTE 1330

Query: 1140 NMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTP 1199
            NMFRIE++  T H SIQ++A++DLTL EPK   DKW+YY+TSY+L HPTEG+ H+ L+ P
Sbjct: 1331 NMFRIEFDKRTLHVSIQYIALDDLTLKEPKEDEDKWKYYVTSYALPHPTEGVLHEKLKIP 1390

Query: 1200 FLEKIIERDEGYID--DGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNK 1257
            FLE++IE  +  ID  D DE++SPEG++ S +K+KI P TY +++E G +D+F+RKS NK
Sbjct: 1391 FLERLIEFGQD-IDGKDVDEKFSPEGISVSTLKIKIQPTTYKLDIENGSYDVFTRKSANK 1449

Query: 1258 FPTRV--DVKKKKSAELKLVLEGFLNGERGWKRGLTTKRTAEAERRLEYVKN-NGTLDDY 1314
            +PT    D  K+   + K ++  FL+     +  L   +    + + E +K+    L+  
Sbjct: 1450 YPTVANDDTHKEVVVQKKELISRFLDCAVHLRNDLNESQKISMQEKFESLKDTTAKLNVD 1509

Query: 1315 AEEISTDTKAALSTTTDTAGNVSTASFS 1342
             + + T  + A  T  +   N++++  S
Sbjct: 1510 GQVVDTKIEEATKTKQEQQENLASSDAS 1537

 Score =  267 bits (683), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 160/245 (65%), Gaps = 35/245 (14%)

Query: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 229 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 288

Query: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTI---GEIPITXXXXXXXXXXXTEPR-- 243
           LIQGFNTFLP GY IEC ++P+DPI+VTTP GT      I              + P   
Sbjct: 289 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTTVNNNISPPERGTIDAQEPSSLPEAD 348

Query: 244 ---LQSTQNVP----TVYRSAEG---------SPAAIATPATTQEQYGT----------- 276
               Q + NVP     VY S +          S  +   P+  Q +              
Sbjct: 349 GNGTQRSHNVPMVPSNVYHSEQNQDQQQVLPLSATSTGLPSIQQSEIPVHHQIPQIQPLA 408

Query: 277 ---GPKKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTV 333
                KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT 
Sbjct: 409 VQEDVKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTH 468

Query: 334 LFQNA 338
           LFQNA
Sbjct: 469 LFQNA 473

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF   P L++ F  F
Sbjct: 424 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 483

Query: 197 LP 198
           LP
Sbjct: 484 LP 485

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 116/294 (39%), Gaps = 68/294 (23%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXX 348
           A+SY+ ++K +F+ +PDIY  FL+I++ ++ +      V  +V+ LF+            
Sbjct: 237 ALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFR------------ 284

Query: 349 XXXSSAPQLQSHQQINGAMVAPGFGHAQSGLQQALPGTQPLMHQQNLPPLGNFSTPGDHH 408
                                 G+     G    LP    +    N       +TP    
Sbjct: 285 ----------------------GYPILIQGFNTFLPQGYRIECSTNPDDPIRVTTP---- 318

Query: 409 PMSLPSVQGPNVGLSQGQSGHIVTQGVSNQHIPVSDLRG------APDASFRASEYNQVQ 462
            M   +V   N  +S  + G I  Q  S+  +P +D  G       P          Q Q
Sbjct: 319 -MGTTTV---NNNISPPERGTIDAQEPSS--LPEADGNGTQRSHNVPMVPSNVYHSEQNQ 372

Query: 463 DVQYMEPTVRPEIDLDPSL----VPV---IPEPIKPL---ED-----ELNLVEEATFFDK 507
           D Q + P       L PS+    +PV   IP+ I+PL   ED     ++   +  ++ +K
Sbjct: 373 DQQQVLPLSATSTGL-PSIQQSEIPVHHQIPQ-IQPLAVQEDVKKNVDVEFSQAISYVNK 430

Query: 508 AK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFV 560
            K +F     IY  FL+IL  Y ++     ++   V+H    +P+L + FK F+
Sbjct: 431 IKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKFL 484

>TBLA0E03160 Chr5 (789593..794812) [5220 bp, 1739 aa] {ON} Anc_6.29
            YOL004W
          Length = 1739

 Score = 1088 bits (2813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/870 (60%), Positives = 652/870 (74%), Gaps = 20/870 (2%)

Query: 462  QDVQYMEPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEF 521
            Q V Y E  VRPEIDLDPSLVP++PEP +P+ED L LVEE  FFDK KK+IGNK IY EF
Sbjct: 821  QQVMYEENAVRPEIDLDPSLVPIVPEPTQPIEDTLPLVEETNFFDKVKKYIGNKTIYAEF 880

Query: 522  LKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDL 581
            LK+LNLYS DLLE ++LVE + +YL+ + ELF WFK+FVGY E+PKHIEN++HEKH+LDL
Sbjct: 881  LKVLNLYSVDLLEVDELVEKIKYYLNDNEELFSWFKNFVGYVEKPKHIENIVHEKHKLDL 940

Query: 582  DLCEACGPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYED 641
            DLCEACGPSYK+LPK DT MPCSGRDEMCWE+LNDEWVGHPVWASEDSGFIAHRK   + 
Sbjct: 941  DLCEACGPSYKKLPKTDTLMPCSGRDEMCWEILNDEWVGHPVWASEDSGFIAHRKINTKK 1000

Query: 642  TLFKIEEERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKK 701
               +++++ HEYDFYIE+NLRTIQTLETIA+KIANMT  EK  FKLP GLGHT+ TIYKK
Sbjct: 1001 PYLRLKKKVHEYDFYIESNLRTIQTLETIASKIANMTENEKCNFKLPDGLGHTTSTIYKK 1060

Query: 702  VIRKVYDKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFY 761
            VIRKVYDK+RGFEIIDALHE+PAI VP+VLKRLKQKDEEWRRAQREWNKVWRELEQKVF+
Sbjct: 1061 VIRKVYDKERGFEIIDALHEYPAIAVPVVLKRLKQKDEEWRRAQREWNKVWRELEQKVFF 1120

Query: 762  KSLDHLGLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVF 821
            KSLDHLGLTFKQADKKLLT KQLISEISSIKVDQ++KR+H LTPK KSQL ++  + ++ 
Sbjct: 1121 KSLDHLGLTFKQADKKLLTTKQLISEISSIKVDQTHKRMHWLTPKPKSQLDFNLPDKDII 1180

Query: 822  QDILSLVMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISH 881
             DILS V +F+ + +TYS  + ERL DF K F SLFFS PL EI+E + KR      I+ 
Sbjct: 1181 FDILSFVEIFVEHTSTYSNPEKERLIDFMKYFTSLFFSIPLEEIKEAISKRD-----ITE 1235

Query: 882  GDDTRKSKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQXX---XXXXX 938
             +D  K ++  K  + +++KR   D    L DIL R K Q++  G  +D+          
Sbjct: 1236 KND-EKLEDKQKNGEENSKKRTSRDITLSLEDILQRTKYQRLKYGDDSDEVDGHGNRHDD 1294

Query: 939  XXXXXXXXXVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHLTTMYER 998
                     +RQEAKKPWLLG++V+EA+  G +  R  FNMF+NTN+Y+F RHLTTMYER
Sbjct: 1295 QKLLEEEELLRQEAKKPWLLGTLVEEANAQGEIMHRNIFNMFSNTNMYIFIRHLTTMYER 1354

Query: 999  LVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXXXXXXXX 1058
            L E+K++N +V++EIS RK+ +FAKDLNLISTQLT+MGLDF   D Y             
Sbjct: 1355 LHEIKQMNDKVSREISGRKISKFAKDLNLISTQLTEMGLDFSEGDVYQQLLVLCKRLILG 1414

Query: 1059 XXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDNDRTSTS 1118
               HQWFEESLRQA+ NKAFKLYT+DKV QALVKHAHTI+ D KT EIM LF+ DRT  S
Sbjct: 1415 DLEHQWFEESLRQAFNNKAFKLYTLDKVTQALVKHAHTIISDLKTTEIMALFEKDRTKNS 1474

Query: 1119 TSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLRDKWQYY 1178
            TS+KDQILYRLQ R+ M++ ENMFRIEYN TT H  IQ++A++DLT+ + K+L +KW+YY
Sbjct: 1475 TSSKDQILYRLQTRARMTHNENMFRIEYNNTTKHICIQYIALDDLTVKDAKTLEEKWKYY 1534

Query: 1179 LTSYSLSHPTEGISHDNLRTPFLEKII----ERDEGYIDDGDE-----RYSPEGVASSNM 1229
            +TSY+LSHPTEGI  +N++ PFLE+II      ++   DD  +     +YSPEG++ S +
Sbjct: 1535 ITSYALSHPTEGIFQENIQIPFLERIIEEEQLYEDEETDDQKQTKSLMKYSPEGISGSTL 1594

Query: 1230 KVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRV--DVKKKKSAELKLVLEGFLNGERGWK 1287
            K+KIDP  Y + +E G  DIFSRKS+N+FP ++  D K     +LK  +E FLN + GWK
Sbjct: 1595 KIKIDPQNYCLNIEEGSFDIFSRKSLNQFPVKLTQDSKYGTMPKLKNTVEKFLNSKMGWK 1654

Query: 1288 RGLTTKRTAEAERRLEYVKNNGTLDDYAEE 1317
            R ++  +    E + +++ NNG L+ Y E+
Sbjct: 1655 RAISKDQMESIESKWDHLSNNGNLEGYQEK 1684

 Score =  177 bits (449), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 86/97 (88%)

Query: 125 DGSAYRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFH 184
           + + YRPLNVKDALSYLEQVKFQF+SRPDVYNHFLDIMKDFKSQAIDTPGVI RVS+LFH
Sbjct: 295 EDNQYRPLNVKDALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFH 354

Query: 185 GYPALIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221
            YP+LIQGFNTFLP GY IEC S+PN PI V TP GT
Sbjct: 355 DYPSLIQGFNTFLPQGYRIECSSNPNLPITVITPMGT 391

 Score =  121 bits (304), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 94/167 (56%), Gaps = 15/167 (8%)

Query: 242 PRLQSTQNVPTVYRSAEGSPAAIATPATTQEQYGTGPKKAGDVEFSHAISYVNKIKTRFA 301
           P+ Q+T  + T   + +  P   +     QE      ++  DVEFS AISYVNKIK RFA
Sbjct: 503 PKSQTTPPIATAGTATQQFPMVSSVSPPLQEL--PEQRRTQDVEFSQAISYVNKIKNRFA 560

Query: 302 EQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXXXXXXXXXXXSSAPQLQSHQ 361
            QP IYKHFLEILQTYQREQKPINEVY+QVTVLFQ A             SSA       
Sbjct: 561 NQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKFLPDSSANN----- 615

Query: 362 QINGAMVAP---GFGHAQSGLQQALPGTQP--LMHQQNLPPLGNFST 403
             NG++V      F +A +G  Q  P   P   +  QNLPPLG+FST
Sbjct: 616 --NGSIVTSQEENFMYA-NGFNQQQPHLTPHSEIQAQNLPPLGSFST 659

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 40/62 (64%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+++P +Y HFL+I++ ++ +      V  +V+ LF   P L++ F  F
Sbjct: 548 AISYVNKIKNRFANQPYIYKHFLEILQTYQREQKPINEVYSQVTVLFQEAPDLLEDFKKF 607

Query: 197 LP 198
           LP
Sbjct: 608 LP 609

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 33/49 (67%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQN 337
           A+SY+ ++K +F  +PD+Y HFL+I++ ++ +      V A+V+ LF +
Sbjct: 307 ALSYLEQVKFQFNSRPDVYNHFLDIMKDFKSQAIDTPGVIARVSSLFHD 355

>NDAI0C02660 Chr3 complement(615526..620499) [4974 bp, 1657 aa] {ON}
            Anc_6.29 YOL004W
          Length = 1657

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/885 (58%), Positives = 632/885 (71%), Gaps = 34/885 (3%)

Query: 468  EPTVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNL 527
            E   RPEIDLDPS+VP+IPEP +P+E+ + LVEE +FF+K KKFI +K IY EFLK+LNL
Sbjct: 713  EAPTRPEIDLDPSIVPIIPEPTEPIENNITLVEETSFFEKVKKFISSKPIYMEFLKVLNL 772

Query: 528  YSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQERPKHIENVIHEKHRLDLDLCEAC 587
            YSQDLL   +LV  V +Y+  + ELFDWFK+FVGY E P  IEN+IHEKH+LDLDLCEA 
Sbjct: 773  YSQDLLSTNELVTRVDYYIGSNKELFDWFKTFVGYSEIPSTIENIIHEKHKLDLDLCEAY 832

Query: 588  GPSYKRLPKADTFMPCSGRDEMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIE 647
            GPSYK+LPK DTFMPCSGRD MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYE+TLFKIE
Sbjct: 833  GPSYKKLPKTDTFMPCSGRDAMCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEETLFKIE 892

Query: 648  EERHEYDFYIEANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVY 707
            EERHEYDF+IE+NLRTIQTLETIANKI NMT EEK  FKLP GLGHTS TIYKKVIRKVY
Sbjct: 893  EERHEYDFHIESNLRTIQTLETIANKINNMTAEEKKNFKLPVGLGHTSSTIYKKVIRKVY 952

Query: 708  DKDRGFEIIDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHL 767
            DK+RGFEIIDALHEHPA  VP++L+RLK+KDEEWRRAQREWNKVWRELEQKV+YKSLDHL
Sbjct: 953  DKERGFEIIDALHEHPAFAVPIILRRLKEKDEEWRRAQREWNKVWRELEQKVYYKSLDHL 1012

Query: 768  GLTFKQADKKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSL 827
            GLTFKQADKKLLT KQLISEISSI+VDQ+NKRIH LTPK KSQL + F + ++  DIL L
Sbjct: 1013 GLTFKQADKKLLTTKQLISEISSIQVDQNNKRIHWLTPKPKSQLDFTFNDHDILVDILDL 1072

Query: 828  VMVFLANNNTYSPSDNERLKDFFKGFISLFFSYPLHEIEEGLLKRSSQNGTISHGDDTRK 887
              VF+ + +TYS S+ ERLKDF + FI LFFS P  EI++ L  ++ +         +  
Sbjct: 1073 ANVFIDHTSTYSNSEKERLKDFLRVFIGLFFSIPSSEIDKKLSGKNDEKFEKGSSSSSST 1132

Query: 888  SKEDPKTEKHSARKRVRDDTEHLLRDILYRNKQQKVNKGPQNDQXXXXXXXXXXXXXXX- 946
            S   P  +K S    +       L D+L + K QK+ +   N+                 
Sbjct: 1133 SNSTPSAKKRSLELDIP------LADVLRKYKYQKIKEKVINELENNSNEYDERDEEFDE 1186

Query: 947  --------------XVRQEAKKPWLLGSIVDEADNHGHVSDRVTFNMFANTNIYVFFRHL 992
                           + +E KKPWLLGS++D+   HG + +R  FN+FANTNIYVFFRH 
Sbjct: 1187 ELKRQQQEQEEEDHMIDEEMKKPWLLGSVIDKTSEHGLIENRHIFNLFANTNIYVFFRHW 1246

Query: 993  TTMYERLVEVKKINGEVTKEISNRKVVQFAKDLNLISTQLTDMGLDFKGADAYXXXXXXX 1052
            TT+YERL+E+K+IN +VT+EI++RKV  FAKDL LISTQLT MGLDFK +D+Y       
Sbjct: 1247 TTIYERLLELKQINDKVTREINSRKVTPFAKDLGLISTQLTMMGLDFKTSDSYKELLNLT 1306

Query: 1053 XXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQALVKHAHTILMDHKTVEIMLLFDN 1112
                     HQWFEESLRQAY NKAFKLYT DKVIQALVKHA++IL D K  EIM LF+ 
Sbjct: 1307 KRLIKNDIEHQWFEESLRQAYNNKAFKLYTADKVIQALVKHANSILTDSKASEIMALFEK 1366

Query: 1113 DRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNTTTSHASIQFVAVEDLTLDEPKSLR 1172
            DR  +ST+T+DQI+YRLQ R++M+N ENMFRIE+N  T+H  IQ++AVEDLTL    + +
Sbjct: 1367 DRLRSSTTTRDQIIYRLQTRTHMTNTENMFRIEFNENTNHVCIQYIAVEDLTLKPSPTTK 1426

Query: 1173 DKWQYYLTSYSLSHPTEGISHDNLRTPFLEKIIERDEGYIDDGD---------ERYSPEG 1223
            + W+YY+TSY+L HPTEG+  + L+ PFLEK +  +     D D         E+ SPEG
Sbjct: 1427 ETWEYYVTSYALPHPTEGVPQEGLKVPFLEKNLNLELENAQDLDNETEKNEFIEKISPEG 1486

Query: 1224 VASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDVKKKKSA--ELKLVLEGFLN 1281
            +++S +K+KID  TY+++VEPG  D+FSRKS+NKFPT  D KK +S+  E       FL+
Sbjct: 1487 ISTSKLKIKIDQETYNLDVEPGSFDVFSRKSLNKFPT--DAKKIESSIKEKSEAFNKFLS 1544

Query: 1282 GERGWKRGLTTKRTAEAERRLEYVKNNGTLDDYAEEISTDTKAAL 1326
             +RGW       + A  E   +  +  G      + I+T++   +
Sbjct: 1545 SKRGWNNQFKPDQVAGIEEGWKKFQETGEFIPIPKPITTESTTGV 1589

 Score =  166 bits (420), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 81/93 (87%)

Query: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
           YRPLNVKDALSYLEQVK QF+S+P +YN FLDIMKDFKSQ IDTPGVIERVSTLF GYP 
Sbjct: 270 YRPLNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPV 329

Query: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGT 221
           LIQGFNTFLP GY I C  +P+DP++VTTP GT
Sbjct: 330 LIQGFNTFLPQGYTIHCSDNPDDPVRVTTPMGT 362

 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 79/141 (56%), Gaps = 29/141 (20%)

Query: 283 DVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQNAXXXX 342
           +VEFS AI+YVNKIKTR+A+QP IYKHFLEILQTYQRE+KPI+EVY QVTVLF +A    
Sbjct: 464 EVEFSQAINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLL 523

Query: 343 XXXXXXXXXSSA-----------PQLQSHQ--------QINGAMVAP--GFGHAQSGLQQ 381
                    + A           PQLQ  Q        Q   + + P    G   SG  Q
Sbjct: 524 EDFKKFLPETPANNQPVQQPHAHPQLQQLQPRIPSISQQQQPSQLYPFSNNGPVPSGFYQ 583

Query: 382 ALPGTQPLMHQQNLPPLGNFS 402
                   + QQNLPP+G+FS
Sbjct: 584 --------IPQQNLPPIGSFS 596

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 49/78 (62%), Gaps = 6/78 (7%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A++Y+ ++K +++ +P +Y HFL+I++ ++ +      V E+V+ LF+  P L++ F  F
Sbjct: 470 AINYVNKIKTRYADQPFIYKHFLEILQTYQREEKPISEVYEQVTVLFNDAPDLLEDFKKF 529

Query: 197 LPHGYNIECPSDPNDPIK 214
           LP     E P++ N P++
Sbjct: 530 LP-----ETPAN-NQPVQ 541

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 289 AISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVTVLFQ 336
           A+SY+ ++K +F  QP IY  FL+I++ ++ +      V  +V+ LF+
Sbjct: 278 ALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFK 325

 Score = 32.7 bits (73), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 496 LNLVEEATFFDKAK-KFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFD 554
           LN+ +  ++ ++ K +F     IY +FL I+  +    ++   ++E VS    G P L  
Sbjct: 273 LNVKDALSYLEQVKVQFNSQPVIYNQFLDIMKDFKSQTIDTPGVIERVSTLFKGYPVLIQ 332

Query: 555 WFKSFV--GY 562
            F +F+  GY
Sbjct: 333 GFNTFLPQGY 342

>Skud_15.158 Chr15 (276509..281176) [4668 bp, 1555 aa] {ON} YOL004W
           (REAL)
          Length = 1555

 Score =  266 bits (679), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 148/246 (60%), Positives = 161/246 (65%), Gaps = 37/246 (15%)

Query: 129 YRPLNVKDALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPA 188
           YRPLNVKDALSYLEQVKFQFSSRPD+YN FLDIMKDFKSQAIDTPGVIERVSTLF GYP 
Sbjct: 224 YRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMKDFKSQAIDTPGVIERVSTLFRGYPI 283

Query: 189 LIQGFNTFLPHGYNIECPSDPNDPIKVTTPFGTIGEIPITXXXXXXXXXXXTEPR----- 243
           LIQGFNTFLP GY IEC ++P+DPI+VTTP GT   +               EP      
Sbjct: 284 LIQGFNTFLPQGYRIECSTNPDDPIRVTTPMGTTT-VNNNVSPSGRGTVDGQEPSSLSEP 342

Query: 244 ----LQSTQNVP----TVYRSAEGSPAAIATPATTQE------------------QYGTG 277
               +Q   N+P     VYRS +      + P +                     Q  + 
Sbjct: 343 DGNAIQPFHNLPMVPSNVYRSEQSQDQKQSLPLSANSVGLSSIHPPEIPPHHQILQGQSL 402

Query: 278 P-----KKAGDVEFSHAISYVNKIKTRFAEQPDIYKHFLEILQTYQREQKPINEVYAQVT 332
           P     KK  DVEFS AISYVNKIKTRFA+QPDIYKHFLEILQTYQREQKPINEVYAQVT
Sbjct: 403 PVQEDAKKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVT 462

Query: 333 VLFQNA 338
            LFQNA
Sbjct: 463 HLFQNA 468

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 40/62 (64%)

Query: 137 ALSYLEQVKFQFSSRPDVYNHFLDIMKDFKSQAIDTPGVIERVSTLFHGYPALIQGFNTF 196
           A+SY+ ++K +F+ +PD+Y HFL+I++ ++ +      V  +V+ LF   P L++ F  F
Sbjct: 419 AISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVYAQVTHLFQNAPDLLEDFKKF 478

Query: 197 LP 198
           LP
Sbjct: 479 LP 480

>CAGL0J11594g Chr10 complement(1126896..1129709) [2814 bp, 937 aa]
           {ON} weakly similar to uniprot|P22579 Saccharomyces
           cerevisiae YOL004w SIN3 transcription regulatory protein
          Length = 937

 Score =  241 bits (614), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 141/383 (36%), Positives = 214/383 (55%), Gaps = 34/383 (8%)

Query: 491 PLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSP 550
           P++   N+ E   +F   +  + ++ IY EFLK++NL++Q L++     +    +     
Sbjct: 196 PIDRPTNMAEFLIYF---RNLVYDESIYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHN 252

Query: 551 ELFDWFKSFVG-YQERPKHIENVIHEKHRLDL-DLCEACGPSYKRLPKADTFMPCSGRDE 608
            L   F + +  Y++  + ++  +      D+ D     GPSYKRL   +T   C GRD 
Sbjct: 253 GLKTAFGNIMSEYKDIHQRMKPTLKSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDR 312

Query: 609 MCWEVLNDEWVGHPVWASEDSGFIAHRKNQYEDTLFKIEEERHEYDFYI----------- 657
           +C EVLNDEWVGHPVWASE+ GFIAH+KNQYE+TLFK+EEERHEYDF++           
Sbjct: 313 LCHEVLNDEWVGHPVWASEEVGFIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFT 372

Query: 658 --EANLRTIQTLETIANKIANMTPEEKAAFKLPPGLGHTSVTIYKKVIRKVYDKDRGFEI 715
             E +L+  +      N+++  +P+E       P +   S+T  +KVIR++Y  + G  +
Sbjct: 373 EYEKSLQLSKDDGRRRNRVS--SPKE-------PMISLNSIT--EKVIRRLYGIEHGNIL 421

Query: 716 IDALHEHPAITVPLVLKRLKQKDEEWRRAQREWNKVWRELEQKVFYKSLDHLGLTFKQAD 775
           IDA+  +P   VP +LK  K+K ++W  A+ EWNK WRE+EQK +YKSLDHLGL FK A+
Sbjct: 422 IDAIKTNPEKVVPTILKTAKEKYQQWNSAKNEWNKAWREVEQKAYYKSLDHLGLPFKNAE 481

Query: 776 KKLLTAKQLISEISSIKVDQSNKRIHPLTPKAKSQLSYDFKEPEVFQDILSLVMVFLANN 835
           K+ L  KQL+ E  S K D+  K  +        +  Y+F +  V  D+  +++  L +N
Sbjct: 482 KRFLNDKQLLLEYKSEKQDKLLKEHYD-----NYEYKYEFFDKSVLYDVKDIILCGLRSN 536

Query: 836 NTYSPSDNERLKDFFKGFISLFF 858
           ++ S S        F+ F  L F
Sbjct: 537 SSTSESQKNLYCQIFEAFFDLLF 559

 Score =  124 bits (310), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 91/300 (30%), Positives = 151/300 (50%), Gaps = 10/300 (3%)

Query: 972  SDRVTFNMFANTNIYVFFRHLTTMYERLVEVKKINGEVTKEI--SNRKVVQFAKDLNLIS 1029
            S+R   N+F + NI   F ++ T+YER  +VK     + K++    R+    AK L L+ 
Sbjct: 618  SNRQNINIFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLP 677

Query: 1030 TQLTDMGLDFKGADAYXXXXXXXXXXXXXXXXHQWFEESLRQAYKNKAFKLYTIDKVIQA 1089
             QL+D GL+    D Y                HQWFEESLR  ++NKA+KLYTID+VI+ 
Sbjct: 678  MQLSDNGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRN 737

Query: 1090 LVKHAHTILMDHKTVEIM-LLFDNDRTSTSTSTKDQILYRLQVRSNMSNIENMFRIEYNT 1148
            ++    TI      ++I+ LL DN +  T+T  + Q+ YR +VR  M  + +MFR+E   
Sbjct: 738  ILGVITTISQTPSLLQILDLLVDNMKKLTTTKLQ-QLTYRTKVRMLMDGVGDMFRLEIVR 796

Query: 1149 TTSHASIQFVAVEDLTLDEPKSLRDKWQYYLTSYSLSHPTEGISHDNLRTPFLE-KIIER 1207
             ++    Q++ V+DL   +    + +   Y   Y  +  T+ +  D L TP+    +++R
Sbjct: 797  DSNAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR 856

Query: 1208 DEGYIDDGDERYSPEGVASSNMKVKIDPLTYSMEVEPGCHDIFSRKSVNKFPTRVDVKKK 1267
            +E  I      +    +   ++ V I+PL Y +++ PG  DI S   + K  + +   +K
Sbjct: 857  EEQNIP-----FMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRK 911

>Kpol_1064.53 s1064 (95468..96937) [1470 bp, 489 aa] {ON}
           (95468..96937) [1470 nt, 490 aa]
          Length = 489

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 511 FIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSPELFDWFKSFVGYQ---ERPK 567
           + G K +Y ++LK+LN   QD       VE        S ++ ++  + + YQ   ER K
Sbjct: 80  YTGLKNMYQDYLKVLNQLKQDKAAVRDEVEASDDKPEESSDVLEYIVNELPYQQPTERKK 139

Query: 568 HIENVIHEK 576
           +I+N IH K
Sbjct: 140 YIDNFIHSK 148

>Suva_7.477 Chr7 complement(817323..823175) [5853 bp, 1950 aa] {ON}
            YGR184C (REAL)
          Length = 1950

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 67/168 (39%), Gaps = 31/168 (18%)

Query: 445  LRGAPDASFRASEYNQVQDVQY--MEPTVRPEIDLDPSLVPVIPEPIKPLEDELNL---- 498
            L    DA     E   + D+ Y  +  ++ P I     +V V+ E +K  E+E  +    
Sbjct: 1547 LMSITDAKTEGLESKTIYDLAYTSLLKSLLPTIRRCLVMVKVLHELVKDSENETMVIDGF 1606

Query: 499  -VEEAT-------FFDKAKKFIGNKQIYTEFLKILNLYSQDLLEKEKLVEDVSHYLSGSP 550
             VEE         F DKA + I +K+ + +  K      Q ++     +E + +   G  
Sbjct: 1607 DVEEELEFEGLPGFVDKALRLITDKESFVDLFKT----KQAIVPSHPYLEKIPYEYCGIV 1662

Query: 551  ELFDWFKSFVGY----------QERPKHIENVIHEKHRLDLDLCEACG 588
            +L D       Y          +ER +H++N     +RLD  +C  CG
Sbjct: 1663 KLIDLSNFLNTYVTQSKEIKLREERSQHMKNA---DNRLDFKICLTCG 1707

>YDR097C Chr4 complement(640109..643837) [3729 bp, 1242 aa] {ON}
           MSH6Protein required for mismatch repair in mitosis and
           meiosis, forms a complex with Msh2p to repair both
           single-base & insertion-deletion mispairs; potentially
           phosphorylated by Cdc28p
          Length = 1242

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 16/116 (13%)

Query: 470 TVRPEIDLDPSLVPVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYS 529
           T+R ++++  S +P        LE  L  +   T   K K F   +++ T F  I+ L  
Sbjct: 684 TLREQLEITFSKLP-------DLERMLARIHSRTI--KVKDF---EKVITAFETIIEL-- 729

Query: 530 QDLLEKEKLVEDVSHYLSGSPE-LFDWFKSFVGYQERPKHI-ENVIHEKHRLDLDL 583
           QD L+   L  DVS Y+S  PE L +  KS+    ER K I EN+I  +   D++ 
Sbjct: 730 QDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEF 785

>CAGL0H09350g Chr8 complement(912452..918349) [5898 bp, 1965 aa] {ON}
            similar to uniprot|P19812 Saccharomyces cerevisiae
            YGR184c UBR1
          Length = 1965

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 59/119 (49%), Gaps = 20/119 (16%)

Query: 483  PVIPEPIKPLEDELNLVEEATFFDKAKKFIGNKQIYTEFLKILNLYSQDLLE------KE 536
            P+I + +  +E ++++ +  +F + A   +      TEF    +++ Q LL+       +
Sbjct: 1622 PLIIDDVN-IESDISIEDYVSFANSATPLL------TEFTDFDDMFVQALLDSKFTEGND 1674

Query: 537  KLVEDVSHYLSGSPELFD---WFKSFVGYQERPKHIE----NVIHEKHRLDLDLCEACG 588
              ++D+ H   G  +L +   +  ++V   ++ K +E    NVI+ K+RLD  +C  CG
Sbjct: 1675 TYLKDIPHEYPGVVKLINLKKYLNTYVTDSKQFKLLEEALTNVINPKNRLDFRICLTCG 1733

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 142,240,685
Number of extensions: 6380728
Number of successful extensions: 20373
Number of sequences better than 10.0: 102
Number of HSP's gapped: 20932
Number of HSP's successfully gapped: 168
Length of query: 1377
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1255
Effective length of database: 39,492,147
Effective search space: 49562644485
Effective search space used: 49562644485
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)