Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL003C6.28ON37537520200.0
Ecym_30326.28ON37737612381e-170
SAKL0E01518g6.28ON37937911741e-160
NCAS0D021406.28ON37637710781e-146
Kpol_1037.236.28ON37837810641e-144
TDEL0G044106.28ON38137810501e-141
ZYRO0C07546g6.28ON37737810451e-141
Suva_15.1726.28ON39837810371e-139
CAGL0E02497g6.28ON37637710281e-138
NDAI0C026506.28ON38938810291e-138
Skud_15.1596.28ON37938110271e-138
TPHA0J003906.28ON38037910111e-136
KLTH0C10978g6.28ON3773789921e-133
YOL003C (PFA4)6.28ON3783789871e-132
KLLA0C06204g6.28ON3773779781e-131
Smik_15.1676.28ON3783789791e-131
Kwal_56.224596.28ON3833789531e-127
KAFR0A051306.28ON3964018741e-115
KNAG0F029306.28ON3863848491e-111
TBLA0B004806.28ON3774023986e-44
NDAI0G013403.12ON3351351992e-16
NCAS0E013003.12ON3272191814e-14
KLLA0E02069g3.12ON3252661781e-13
TPHA0P015603.12ON3311501743e-13
KNAG0K025703.12ON3281751709e-13
Kwal_55.221263.12ON3602251655e-12
CAGL0D02508g3.12ON3322411655e-12
Kpol_1014.293.12ON3261301629e-12
ZYRO0C03410g3.12ON327711611e-11
KAFR0B053708.286ON3291951602e-11
SAKL0C13596g3.12ON3331121592e-11
KAFR0A085903.12ON3311321576e-11
KLTH0F19580g3.12ON3421361566e-11
Suva_14.153.12ON3301821541e-10
Ecym_20143.12ON339681522e-10
CAGL0B01991g8.286ON3301351522e-10
TDEL0A003103.12ON329391513e-10
NCAS0B035908.286ON3291031513e-10
Skud_14.153.12ON3361341495e-10
TBLA0H001503.12ON3452531495e-10
SAKL0H16434g8.286ON555921499e-10
TPHA0C010708.286ON3331501461e-09
Smik_14.63.12ON3341891452e-09
YNL326C (PFA3)3.12ON3361911452e-09
KLTH0G13112g8.286ON3492841452e-09
TBLA0D040408.286ON3291271442e-09
Suva_10.3428.389ON356381443e-09
TDEL0F041308.286ON3281171433e-09
ZYRO0D06600g8.286ON330381424e-09
Skud_12.3218.389ON356381424e-09
Skud_4.3878.286ON336371416e-09
YDR126W (SWF1)8.286ON336371391e-08
Smik_12.3068.389ON359391391e-08
ADL197C3.12ON390401391e-08
Suva_2.2898.286ON335371381e-08
YLR246W (ERF2)8.389ON359381372e-08
Smik_4.3728.286ON335371362e-08
NDAI0J010008.286ON3391181353e-08
TDEL0F051308.389ON359521353e-08
Ecym_41788.389ON368381354e-08
ZYRO0C04092g8.389ON366381344e-08
SAKL0H13860g8.389ON352381327e-08
KNAG0A027108.389ON354391311e-07
NDAI0G022508.389ON389381311e-07
AGL125C8.389ON367391311e-07
Kpol_1033.168.286ON3211281301e-07
KLTH0F08668g8.389ON358391301e-07
NCAS0C029208.389ON374381292e-07
TPHA0C023608.389ON404771292e-07
KLLA0D18370g8.389ON355381264e-07
Kwal_23.33028.389ON353391247e-07
Ecym_42828.286ON3401391247e-07
KAFR0H019808.389ON361381248e-07
TBLA0H009208.389ON360381231e-06
CAGL0G08217g8.389ON326681221e-06
AGR065W8.286ON326371183e-06
KNAG0H031108.286ON3311221158e-06
KLLA0F19690g8.286ON324371132e-05
NCAS0F013905.579ON3742591122e-05
TPHA0C003705.626ON7591091107e-05
Kwal_56.236978.286ON338521087e-05
KNAG0C062305.626ON7521161098e-05
NCAS0C052805.626ON7571271071e-04
Kpol_1004.575.579ON3621351052e-04
ZYRO0D13860g5.579ON3651321042e-04
KAFR0H005705.626ON757701034e-04
Skud_4.5275.626ON764601034e-04
KNAG0C028305.579ON3541291015e-04
Skud_4.7345.579ON380741025e-04
NDAI0H018905.579ON40659990.001
Ecym_41145.579ON372109980.001
ZYRO0C11132g5.626ON75969980.001
YDR459C (PFA5)5.579ON37452970.002
TBLA0E028305.579ON38637970.002
Smik_4.5155.626ON76461980.002
YOR034C (AKR2)5.626ON749123960.003
Suva_8.875.626ON730164960.003
CAGL0M08712g5.626ON76371940.005
KLTH0G04972g5.579ON36756930.006
Kpol_526.325.626ON77759930.007
Kwal_47.183665.579ON35670910.008
Suva_2.4325.626ON76360920.008
YDR264C (AKR1)5.626ON76460910.011
KLLA0D06149g5.579ON34937900.011
Suva_2.6345.579ON38838900.013
NDAI0H008505.626ON78646900.014
KAFR0I011105.579ON37052890.015
Smik_4.7375.579ON37844890.016
TBLA0J008305.626ON73989890.018
SAKL0G06160g5.579ON36437880.019
Smik_15.2135.626ON744165880.028
TDEL0A044405.579ON36538860.037
KLTH0E02420g5.626ON73488850.068
TDEL0A049205.626ON75060840.084
Skud_15.1995.626ON741123820.14
Kpol_1062.504.132ON16878780.15
AER388C5.626ON72461810.17
Skud_15.3045.477ON88354800.24
ABR203W5.579ON35938790.26
SAKL0G07326g5.626ON73771790.35
CAGL0K06347g5.579ON35240770.44
Ecym_13305.626ON73975770.52
TBLA0A075001.29ON788111770.61
KNAG0B031405.626ON682113741.4
SAKL0H01320g5.36ON18537702.4
KAFR0F004402.84ON31981702.8
NCAS0D004602.84ON31647703.0
KLLA0E16721g5.626ON75245686.1
NDAI0G027902.84ON31847678.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL003C
         (375 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   782   0.0  
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   481   e-170
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   456   e-160
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   419   e-146
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   414   e-144
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   409   e-141
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   407   e-141
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   404   e-139
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   400   e-138
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     400   e-138
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   400   e-138
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   394   e-136
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   386   e-133
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   384   e-132
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   381   e-131
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   381   e-131
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   371   e-127
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   341   e-115
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   331   e-111
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   157   6e-44
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      81   2e-16
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    74   4e-14
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    73   1e-13
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    72   3e-13
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    70   9e-13
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    68   5e-12
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    68   5e-12
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    67   9e-12
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    67   1e-11
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    66   2e-11
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    66   2e-11
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    65   6e-11
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    65   6e-11
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    64   1e-10
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    63   2e-10
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    63   2e-10
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    63   3e-10
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      63   3e-10
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    62   5e-10
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    62   5e-10
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    62   9e-10
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    61   1e-09
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    60   2e-09
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    60   2e-09
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    60   2e-09
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    60   2e-09
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    60   3e-09
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    60   3e-09
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    59   4e-09
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    59   4e-09
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    59   6e-09
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    58   1e-08
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    58   1e-08
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    58   1e-08
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    58   1e-08
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    57   2e-08
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    57   2e-08
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    57   3e-08
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    57   3e-08
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    57   4e-08
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    56   4e-08
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    55   7e-08
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    55   1e-07
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     55   1e-07
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    55   1e-07
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    55   1e-07
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    55   1e-07
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     54   2e-07
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    54   2e-07
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    53   4e-07
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    52   7e-07
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    52   7e-07
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    52   8e-07
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    52   1e-06
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    52   1e-06
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    50   3e-06
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    49   8e-06
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    48   2e-05
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    48   2e-05
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    47   7e-05
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    46   7e-05
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    47   8e-05
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    46   1e-04
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    45   2e-04
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    45   2e-04
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    44   4e-04
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    44   4e-04
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    44   5e-04
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    44   5e-04
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    43   0.001
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    42   0.001
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    42   0.001
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    42   0.002
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    42   0.002
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    42   0.002
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    42   0.003
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    42   0.003
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    41   0.005
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    40   0.006
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    40   0.007
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    40   0.008
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    40   0.008
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    40   0.011
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    39   0.011
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    39   0.013
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    39   0.014
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    39   0.015
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    39   0.016
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    39   0.018
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    39   0.019
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    39   0.028
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    38   0.037
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    37   0.068
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    37   0.084
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    36   0.14 
Kpol_1062.50 s1062 complement(108109..108615) [507 bp, 168 aa] {...    35   0.15 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    36   0.17 
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...    35   0.24 
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    35   0.26 
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    35   0.35 
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    34   0.44 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    34   0.52 
TBLA0A07500 Chr1 complement(1856643..1859009) [2367 bp, 788 aa] ...    34   0.61 
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    33   1.4  
SAKL0H01320g Chr8 (141328..141885) [558 bp, 185 aa] {ON} some si...    32   2.4  
KAFR0F00440 Chr6 (100249..101208) [960 bp, 319 aa] {ON} Anc_2.84...    32   2.8  
NCAS0D00460 Chr4 (71070..72020) [951 bp, 316 aa] {ON} Anc_2.84 Y...    32   3.0  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    31   6.1  
NDAI0G02790 Chr7 (649288..650244) [957 bp, 318 aa] {ON} Anc_2.84...    30   8.0  

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/375 (100%), Positives = 375/375 (100%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL
Sbjct: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
           APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT
Sbjct: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV
Sbjct: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
           EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD
Sbjct: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300

Query: 301 EATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWYND 360
           EATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWYND
Sbjct: 301 EATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWYND 360

Query: 361 WGESLEHFGVDVEVE 375
           WGESLEHFGVDVEVE
Sbjct: 361 WGESLEHFGVDVEVE 375

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  481 bits (1238), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 221/376 (58%), Positives = 284/376 (75%), Gaps = 1/376 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +KWPWLG+AIPCFLI+F GY A  FVL  FLS K+ +WFQ SL+MIW+SY+KAIY 
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG P  GF+PL++EW+NYC KC+ +KPERTHHCK C QCVLVMDHHCP+TMNC+G    
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   WII TT  L   F KR  F W  R++TA LV+K+E+IFLTILTP +AF+LLT
Sbjct: 121 PHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           IS+LF RC+KNQ++NG TQIEAWEMDRIE++FY++RL+PQLL+NL+E+YP SL+G + E+
Sbjct: 181 ISILFGRCIKNQVLNGMTQIEAWEMDRIESMFYNRRLVPQLLSNLEELYPNSLDGHKGEI 240

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
           +  L++   SF++++NFPYD +PW NL+NCMG  L WLNPFG P  +GMVF+KNE+S Y+
Sbjct: 241 DRILNNRKISFEDLVNFPYDSDPWRNLINCMGPMLTWLNPFGKPNGNGMVFEKNELSAYE 300

Query: 301 EATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRH-VPIAVPPRNEWYN 359
             +++ DKLL+LPWPPD  R   +  S   VE  T+ GE ++R+R   P     R EWYN
Sbjct: 301 HGSTLTDKLLSLPWPPDGERAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYN 360

Query: 360 DWGESLEHFGVDVEVE 375
           DWGE+L HFGVDV+ +
Sbjct: 361 DWGENLAHFGVDVDAD 376

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  456 bits (1174), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/379 (58%), Positives = 278/379 (73%), Gaps = 4/379 (1%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MAV +KWPWLG+AIP FLISF GY AH+F+L+NFL  K+ LWF+ SL MIWISY+ AIY 
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG+PT GFRP ++EW+N+C KC  YKPER HHCK CNQCVL MDHHCPWTMNC+G +  
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
           A       W+I TT  LL Y VKRI F W  R+     V + ELIFLTILTP+DAF+LLT
Sbjct: 121 AHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVHRSELIFLTILTPMDAFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           ISLL +RC KNQI+ G TQIE+WEMDRIEN+F+  +L+P++L NLKEI PGSL  Q+ ++
Sbjct: 181 ISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLKEIRPGSLSNQDDDI 240

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
            + LS +  S DE++NFPYD+NPW N +N +G   +W+ P+G  K +GM+F+KNE+S Y+
Sbjct: 241 RKLLSQNRLSLDEIVNFPYDLNPWANAVNSLGDMYSWILPWGTAKGNGMIFEKNELSVYE 300

Query: 301 EATSIQDKLLALPWPPDDTRH---GIAFPSVSHVEKDTQGGEQVVRRRHV-PIAVPPRNE 356
               I+DKLL+LPWPPD  RH   G     V+ VE  T+ GE+VVR+R V P    PR +
Sbjct: 301 PEIPIEDKLLSLPWPPDGGRHKVPGGGANDVNIVESSTRDGERVVRKRWVDPRTTMPRKK 360

Query: 357 WYNDWGESLEHFGVDVEVE 375
           WYNDWGE+L  FGVD++ E
Sbjct: 361 WYNDWGENLADFGVDLDEE 379

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  419 bits (1078), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/377 (51%), Positives = 263/377 (69%), Gaps = 3/377 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +K+PW+GV IPC L SF GY AH FVL NF+S+K  LWFQ SL+M+WISY  AI+ 
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPGRP K F+PL+ EW ++C KC+ +KPER HHCK CNQCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W++ TTG LL+  +KR  + W  +   + L  K E+ FL IL P+D F+L+T
Sbjct: 121 PHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFEKTEITFLIILIPMDGFVLIT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           ++LLF+RC+ NQI+ G+TQIE+WE++R+ENL+Y ++LLPQLL NL EIYP     + K +
Sbjct: 181 VALLFIRCLSNQIIGGKTQIESWELERLENLYYRKKLLPQLLVNLWEIYPNEKTPENKVL 240

Query: 241 EEFLS--SSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISD 298
            + L        F+ ++ FPYD++ W N L  +GSP+ WL  FGGP +DGM F+KNE++ 
Sbjct: 241 AKKLQERGRKVRFENIVTFPYDLDIWSNALTVLGSPVQWLWLFGGPDSDGMHFKKNELAL 300

Query: 299 YDEATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWY 358
           Y+E  +I+D LL+LPWPPD  R+ I     ++VE  T+ GEQV+R+R+       R  W 
Sbjct: 301 YEEGAAIEDLLLSLPWPPDGGRNFIQ-QKGTNVESITENGEQVIRQRNFENDNSYRKTWN 359

Query: 359 NDWGESLEHFGVDVEVE 375
           NDWGE+LE FGVDV+VE
Sbjct: 360 NDWGENLEDFGVDVDVE 376

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  414 bits (1064), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/378 (50%), Positives = 264/378 (69%), Gaps = 3/378 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +K+PW+G+AIPCFLISF  Y AH+F+L NFLS  + +WF++S++MIWISY+ AIY 
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG+P   + P   +W+NYC KC  YKPERTHHCK C QCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+I TT  LL++ + RI F W +R   + L +K E+IFLTI TP+D F+LLT
Sbjct: 121 PHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFNKSEIIFLTITTPMDGFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           ISLLF+RC  NQ+++GRTQIE WE +R+E+LFY +RL PQL++NL E +P       +  
Sbjct: 181 ISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKPQLISNLWEFHPELKTPDNEAK 240

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
            E + S    FD +++FPYD+    N+   +GSP+ WL  +G P  DGM+F+KNE S ++
Sbjct: 241 AEKIVSKRIRFDLLVSFPYDLGLINNITTVLGSPVTWLWFYGEPSGDGMLFKKNEYSLFE 300

Query: 301 EATSIQDKLLALPWPPDDTRHG--IAFPSVSHVEKDTQGGEQVVRRRH-VPIAVPPRNEW 357
           E + ++D++L+LPWPPD  +HG  I   S + +E  T+ GE V+R+R  V   +  R +W
Sbjct: 301 EDSILEDQILSLPWPPDGGKHGFNIENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQW 360

Query: 358 YNDWGESLEHFGVDVEVE 375
           YNDWGE+LE FGVD++VE
Sbjct: 361 YNDWGENLEDFGVDIDVE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  409 bits (1050), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/378 (51%), Positives = 254/378 (67%), Gaps = 3/378 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +KWPWLG+AIPC L+SF GY  HFF+L+NFLS  + LWFQ +L++IW+SY+ AIY 
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPGRP   F   +YEW+NYC KC+ YKPER HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+I  T  LL+  V RI   W +R     +  + EL+FLTILTPLDAF+LLT
Sbjct: 121 PHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFHRSELVFLTILTPLDAFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEG-QEKE 239
           I++L  RC+ NQI NG +QIE WE++R++ LF  +RL+P L+    +I+PG+ E   E  
Sbjct: 181 ITILLCRCLANQIFNGMSQIETWELERLQALFDSKRLVPLLIEAAWDIFPGTREQINEST 240

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
             E   +     ++V+NFPYD++PW N    +G+PL WL PFG PK DGM F KNEIS+Y
Sbjct: 241 AAELSMNKELRLEDVVNFPYDLDPWSNAEQLLGNPLLWLWPFGRPKGDGMSFVKNEISEY 300

Query: 300 DEATSIQDKLLALPWPPDDTRHGIAFPSV-SHVEKDTQGGEQVVRRRHVPIA-VPPRNEW 357
               S +D LL+LPWPPD  R      S+ S +E  T+ GEQ++RRR    + +  R +W
Sbjct: 301 SSRASYEDLLLSLPWPPDGGRTRAGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQW 360

Query: 358 YNDWGESLEHFGVDVEVE 375
            NDWGE+LE FGVDV+ E
Sbjct: 361 QNDWGENLEDFGVDVDTE 378

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  407 bits (1045), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 201/378 (53%), Positives = 254/378 (67%), Gaps = 4/378 (1%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +KWP+LG+AIPCFLISF GY AH+F+L+NFLS ++ +WF+ SL+MIW SY+ AIY 
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
            PG+P   F+P +  W++YC KC  YKPER HHCK CNQCVL MDHHCPWT NC+G    
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+IATTG LL+    R  F   N  +   L +K ELIFLTIL P+D FILLT
Sbjct: 121 PHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWNKSELIFLTILIPMDGFILLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239
           IS+LF+RC+ NQI  GRTQIE WE +R+E L+Y +RLLP LL N  E+YP     + E E
Sbjct: 181 ISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKRLLPHLLANFWELYPELRTRELEDE 240

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
                +      D ++NFPYDI+PW N +  +GSPL WL PFG PK DGM F KN+IS++
Sbjct: 241 ASRLSTRRRIGLDHLVNFPYDIDPWSNTIEFLGSPLFWLWPFGKPKGDGMFFPKNDISEF 300

Query: 300 DEATSIQDKLLALPWPPDDTRHG-IAFPSVSHVEKDTQGGEQVVRRRHV-PIAVPPRNEW 357
           +E T++ D LLALPWPPD  +   I+    + VE   + GEQV+R+R V P     R +W
Sbjct: 301 EE-TNLTDMLLALPWPPDGGKDKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQW 359

Query: 358 YNDWGESLEHFGVDVEVE 375
            N WGE+LE FGVDV+ E
Sbjct: 360 QNTWGENLEDFGVDVDAE 377

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  404 bits (1037), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 261/378 (69%), Gaps = 3/378 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MAV +KWPWLG+AIP FLISF GY AH+F+L+NFLS  + + F+ SLSMIW+SY+ AIY 
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG+P+  ++P    W NYC KC+ YKPER+HHCK CNQCVL+MDHHCPWTMNC+G +  
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNY 140

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+IATTG L    +KR+ F W  R+    L  K EL+FLTILTPL+ F+LLT
Sbjct: 141 PHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFKKSELVFLTILTPLNFFVLLT 200

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239
           I +LF+RC+ NQI+NGR+QIE+W+MDR+E+LF  QRL+ +L+ N   IYP +   Q E++
Sbjct: 201 IVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEARSPQLERD 260

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
            E+ L+     F+EV+NFPY+I+ + N    +G    WL P G P  DG  FQKN+IS Y
Sbjct: 261 AEKLLTQHKIRFEEVVNFPYNIDLFTNATIYLGPLHLWLWPCGAPAGDGNSFQKNDISKY 320

Query: 300 DEATSIQDKLLALPWPPDDTRHGIAFP-SVSHVEKDTQGGEQVVRRRHVPIA-VPPRNEW 357
           +  +S++D +L+LPWPPD  +   A   S   +E   +GGEQVVR R         R +W
Sbjct: 321 EVNSSLEDIMLSLPWPPDGGKIKTASNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKW 380

Query: 358 YNDWGESLEHFGVDVEVE 375
           YNDWGESL+ FGVDV++E
Sbjct: 381 YNDWGESLDDFGVDVDME 398

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  400 bits (1028), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/377 (52%), Positives = 255/377 (67%), Gaps = 3/377 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +KWPWLG+AIP FLI+  GY AH+F+L NFLS ++ LW+Q   +MIW+SY+ AIY 
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
            PG+P   F+P + EW+ YC KC+ YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  PPGKPPTNFKPSKNEWKVYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+I  T  L  +   RI   WV+R + + L  K ELIFLTILTPL+AFILLT
Sbjct: 121 PHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLYYKSELIFLTILTPLNAFILLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPG-SLEGQEKE 239
           IS+L +RC+ NQI NGR+QIE+WEMDR+E L    +LLP L+ N+  I+P    E  E +
Sbjct: 181 ISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPILIENVWYIFPNLRNEHVESQ 240

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
            E  L+    S DE++NFPYD+ P+ N +  +G+P  WL PF GP+ DG+ FQKNE S  
Sbjct: 241 AEALLNKKRLSLDELVNFPYDLGPFRNAIQLLGTPPLWLYPFSGPQDDGLHFQKNEESMI 300

Query: 300 DEATSIQDKLLALPWPPDDTRH-GIAFPSVSHVEKDTQGGEQVVRRRHVPIAVPPRNEWY 358
           ++  S+ D +L LPWPPD T+H        S+V+  ++ GEQV+R R  P     R+EW 
Sbjct: 301 EDPNSLNDIILCLPWPPDSTKHLNSTSEHTSNVQIISEEGEQVIRIR-TPEKKLSRSEWL 359

Query: 359 NDWGESLEHFGVDVEVE 375
           NDWGESLE FGVDV+VE
Sbjct: 360 NDWGESLEDFGVDVDVE 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  400 bits (1029), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 261/388 (67%), Gaps = 14/388 (3%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MA+ +K+PWLGVAIP F+ISF GY +H+F+L+NFLS K+ +WFQ SLSMIW+SY  AI+ 
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  NPGRPTKGFRPLRY----EWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           NPG+P K  +P+ +    +W  +C KC  YKPER+HHCK CNQCVL+MDHHCPWTMNC+G
Sbjct: 61  NPGKPPKNCKPIDFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVG 120

Query: 117 LQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAF 176
            +          WII TTG LL + +KR    W  R+  + +  + E+IFLTIL P+DAF
Sbjct: 121 YKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFDRNEIIFLTILIPMDAF 180

Query: 177 ILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGS-LEG 235
           ILLTISLLF+RC  NQIV G TQIE WE++R+ENLFY+++LLP ++  L E+YP    + 
Sbjct: 181 ILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLWEVYPNERTKV 240

Query: 236 QEKEVEEFLS-SSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKN 294
            +   ++ LS      F+ ++NFPYDI+ W N+   MGS  NW+  FG P  +G+ F+KN
Sbjct: 241 ADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGSAFNWIWIFGVPDRNGLKFEKN 300

Query: 295 EISDYDEATSIQDKLLALPWPPDDTRHGIAFPSVSHVEKDTQGGEQVVRRR---HVPIAV 351
           EIS Y+  +S++D LL+LPWPPD  R+ I+    S VE     GEQVVR R      I+ 
Sbjct: 301 EISLYEPGSSVEDLLLSLPWPPDKGRNFISNKDTS-VESLVYDGEQVVRNRASNDTNIST 359

Query: 352 ----PPRNEWYNDWGESLEHFGVDVEVE 375
                 R EW NDWGESL  FGVD+E E
Sbjct: 360 INKDISREEWNNDWGESLVDFGVDIEAE 387

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  400 bits (1027), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 196/381 (51%), Positives = 263/381 (69%), Gaps = 8/381 (2%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MAV +KWPWLG+AIP FLISF GY AH+F+L+NFLS  + L F++SLSMIW+SY+ AIY 
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           N GRP   +RP    W N+C KC++YKPER+HHCK CNQCVL+MDHHCPWTMNC+G +  
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNY 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+I TT IL    VKRI F W  R     L  K ELIFLTIL+PLD F+LLT
Sbjct: 121 PHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFEKSELIFLTILSPLDFFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239
           I++LF+RC+ NQI+NGR+QIE+W+MDR+E+L    +L+P+L+ N   IYP +   Q E++
Sbjct: 181 IAILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERD 240

Query: 240 VEEFLSS-STCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISD 298
            ++ L+      FDE+++FPY+ NP  N +  +G    WL P+G P  DG  F KN+IS 
Sbjct: 241 ADKLLTQRGRARFDELVSFPYNFNPCTNAILYLGPIRLWLWPYGTPAGDGNSFPKNDISQ 300

Query: 299 YDEATSIQDKLLALPWPPDDTR-HGIAFPSVSHVEKDTQGGEQVVRRR---HVPIAVPPR 354
           Y+  + ++D +L+LPWPPD  +   ++  + S +E   +GGEQ+VR R   H   A+  R
Sbjct: 301 YEVNSPLEDIILSLPWPPDGNKTKAVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAI--R 358

Query: 355 NEWYNDWGESLEHFGVDVEVE 375
            +WYNDWGESL+ FGVDV++E
Sbjct: 359 EKWYNDWGESLDDFGVDVDME 379

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  394 bits (1011), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 199/379 (52%), Positives = 261/379 (68%), Gaps = 4/379 (1%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V  KWPW+G+AIPC LISF GY +H+++L   LS  +  +F+ SL+MIW+SY+ AI  
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG+P K F+PL +EW+N+C KC  YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGKPGKNFKPLPHEWRNFCKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   WI+ATTG LL Y +KRI + W NR   + L  + E+I L + TPL+ FILLT
Sbjct: 121 PHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFERSEVIALFVCTPLNLFILLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239
           I+LLF RC+ NQI+NG+TQIE WEMDR+EN FY ++LLPQL+ NL E+YP     + ++E
Sbjct: 181 ITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKKLLPQLILNLWELYPELKSAKHDEE 240

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
            E  +      +D ++NFPYD+  + N+   +G PL WL PFGGP  +GM F+KNEI+ +
Sbjct: 241 AERLIEKKGIRYDSIVNFPYDLGIFKNITALVGQPLYWLWPFGGPSGNGMNFEKNEIALF 300

Query: 300 DEATSIQDKLLALPWPPDDTRHGIA--FPSVSHVEKDTQGGEQVVRRR-HVPIAVPPRNE 356
           D  +S+    LALPWPPD  RH  +    + S+VE  T  GEQVVR R H    +  R E
Sbjct: 301 DPDSSLPVFTLALPWPPDKGRHNNSKTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREE 360

Query: 357 WYNDWGESLEHFGVDVEVE 375
           W+N+WGE+LE FGVDVE+E
Sbjct: 361 WFNEWGENLEDFGVDVEME 379

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  386 bits (992), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 188/378 (49%), Positives = 247/378 (65%), Gaps = 5/378 (1%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +KWPWLG+A+P FLI++ GY +H+F+L NF S  + LWF+ SL++IW+SY  AI+K
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPGRP   F P  ++W+NYC KC+ YKPERTHHCK C QCVL MDHHCPWTMNC+G    
Sbjct: 61  NPGRPPPNFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W++ TT  L     +R    W +R  T   V   EL FL +  PL+AFILLT
Sbjct: 121 PHFVRFLTWVVLTTSYLGLLLTQRAFDHWASR-NTRKFVHTSELCFLFVNAPLNAFILLT 179

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           +SLL  RCVKNQ +NG TQIE+WE DRIENLF+++RL+PQL+ NLKE++P      E   
Sbjct: 180 VSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKELFPED-TFDEGAA 238

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
           ++ LSS     +++INFPYD++   N+ + MG   +W  P G P+ +G  F  N++SDYD
Sbjct: 239 QKLLSSKQLELEDIINFPYDVDILENMKSSMGPIYSWCLPCGRPRDEGTRFVTNDLSDYD 298

Query: 301 EATSIQDKLLALPWPPDDTRHGIAFPS--VSHVEKDTQGGEQVVRRRHVPIAVP-PRNEW 357
              SI+DKLL+LPWPPD  R      +   S +E  + GGE  +R R     +  PR EW
Sbjct: 299 IKASIEDKLLSLPWPPDGGRQKSQRSADIASTLETFSSGGEATLRNRSFDSRISVPRTEW 358

Query: 358 YNDWGESLEHFGVDVEVE 375
           +NDWGE+L  FGVDV+ E
Sbjct: 359 HNDWGENLSDFGVDVDAE 376

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  384 bits (987), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 190/378 (50%), Positives = 252/378 (66%), Gaps = 3/378 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V ++WPWLG+AIP FLISF GY AH+F+L+NFLS  + + F+  LSMIW+SY+ AI  
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPGRP   ++P    W+N+C KC++YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANY 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   WII TT +L     KRI F W  R+       K ELIFLTI +PL++F+LLT
Sbjct: 121 PHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFKKSELIFLTISSPLNSFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239
           I++LF+RC+ NQI+NGR+QIE+W+MDR+E+LF   RL  +L+ N   IYP S   Q +K+
Sbjct: 181 ITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKD 240

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
            EE L+     FDE++NFPYD + + N L  +G    WL P+G P  DG  F KN IS Y
Sbjct: 241 AEEHLTKKRPRFDELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKY 300

Query: 300 DEATSIQDKLLALPWPPDDTRHGIAFP-SVSHVEKDTQGGEQVVRRRHVPIAV-PPRNEW 357
           +  +S++D +L+LPWPPD  +    F    S +E   + GEQ++R R         R +W
Sbjct: 301 EANSSLEDHILSLPWPPDGGKTNTVFNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKW 360

Query: 358 YNDWGESLEHFGVDVEVE 375
           YNDWGESL+ FGVDV++E
Sbjct: 361 YNDWGESLDDFGVDVDME 378

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  381 bits (978), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 242/377 (64%), Gaps = 2/377 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MA+ +K  WLGVAIP FL++  GY +H+F+L+NFLS+ E +++Q   +MIW+SY+ AIY 
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG P K F+P   EW NYC KC  YKPER HHCK CNQCVL MDHHCPWT+NC+G    
Sbjct: 61  NPGIPPKDFKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+I +T  LL   + RI   W  R+   +  S  E+IF+ I+TP+DAF+LLT
Sbjct: 121 PHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFHHRSTSEIIFICIMTPMDAFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           +S L  RC+ NQ ++G TQIE+WEMDRI++L Y  RLL Q++  L E  P  L  ++ E+
Sbjct: 181 VSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVERRPEILPAKQHEI 240

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
            + LS    + ++  NFPYD+NPW N+ N MG    WL P+  P   G  F KNE+  YD
Sbjct: 241 NKLLSKRYVNQEDFTNFPYDVNPWTNINNAMGPWYLWLWPWSKPPTIGTSFAKNELFFYD 300

Query: 301 EATSIQDKLLALPWPPDD-TRHGIAFPSVSHVEKDTQGGEQVVRRRHVPIAVP-PRNEWY 358
             +SI+D L++LPWPPD  T H  A  S S +E    GGEQV+R + V +     RN WY
Sbjct: 301 PNSSIEDMLMSLPWPPDGLTHHSRALGSGSSIETIVSGGEQVIRDKSVDLRDRLGRNSWY 360

Query: 359 NDWGESLEHFGVDVEVE 375
           NDWGE L  FGVD E+E
Sbjct: 361 NDWGEDLSDFGVDTELE 377

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  381 bits (979), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/378 (50%), Positives = 252/378 (66%), Gaps = 3/378 (0%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MAV ++WPWLG+AIP  LISF GY AH+F+L+NFL   + + F+ SLSMIW SY+ AIY 
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPGRP   ++P    W N+C KC+ YKPER+HHCK CNQCVL+MDHHCPWTMNC+G    
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNY 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   WII TT IL    VKRI F W  R     L  K EL FLTIL+PL+ F+LLT
Sbjct: 121 PHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFKKSELTFLTILSPLNFFVLLT 180

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQ-EKE 239
           I++LF+RC+ NQIVNGR+QIE+W+MDR+E+LF  +RL+ +L+ N   IYP S   Q E++
Sbjct: 181 ITVLFLRCLFNQIVNGRSQIESWDMDRLESLFDSRRLIQKLIYNTWRIYPESKTLQHERD 240

Query: 240 VEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDY 299
            E  L     SF+ ++NFPY+ +   N +  +G    WL P+G P  +G  F KN+IS+Y
Sbjct: 241 AEGLLKQQRSSFEGLVNFPYNFDLHTNAILYLGPVHLWLWPYGIPTGNGNNFPKNDISNY 300

Query: 300 DEATSIQDKLLALPWPPDDTR-HGIAFPSVSHVEKDTQGGEQVVRRRHVPIA-VPPRNEW 357
           +  + ++D +L+LPWPPD      ++ P  S +E   +GGEQVVR R         R +W
Sbjct: 301 EVDSPLEDIILSLPWPPDGGETTTVSNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKW 360

Query: 358 YNDWGESLEHFGVDVEVE 375
           +NDWGESL+ FGVDV++E
Sbjct: 361 FNDWGESLDDFGVDVDME 378

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  371 bits (953), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 191/378 (50%), Positives = 246/378 (65%), Gaps = 5/378 (1%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +KWPWLG+AIP  LI+F GY +H+F+L NFLS  + +WFQ+ LSMIWISY  AI+ 
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  NPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYL 120
           NPG+P  GF+PL ++W+N C KC+TYKPERTHHCK C+QCVLVMDHHCPWTMNC+G    
Sbjct: 61  NPGKPPTGFQPLPHQWKNICQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNF 120

Query: 121 APQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLT 180
                   W+I TT  L     KRI   W  R+ T   V K EL+F+ I TPL+AF+ LT
Sbjct: 121 PHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRH-TRIYVQKIELVFIFINTPLNAFVWLT 179

Query: 181 ISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEV 240
           I LL +RC KNQ + G TQIE WE +RIEN F + RL+PQLL NL EIY G         
Sbjct: 180 IILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGRLIPQLLENLAEIY-GDDILNSPNA 238

Query: 241 EEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYD 300
           ++ +++     +E++NFPYD+N   N  + +G+ L  + P+  P  +G+ F KN++S YD
Sbjct: 239 KKLINARDLQLEEIVNFPYDLNIVANTRHAIGNLLTCILPWSSPVGNGLKFTKNDLSSYD 298

Query: 301 EATSIQDKLLALPWPPDDTRHGIAFPS--VSHVEKDTQGGEQVVRRR-HVPIAVPPRNEW 357
              +I+DKLL+LPWPPD  R      S   S +E  +  GE V+R+R   P     R EW
Sbjct: 299 TCHTIEDKLLSLPWPPDGGRQQPTGDSQVSSRIEMHSSRGEPVLRKRLRDPRINMQRTEW 358

Query: 358 YNDWGESLEHFGVDVEVE 375
           YNDWGE+L  FGVDVE E
Sbjct: 359 YNDWGENLSDFGVDVESE 376

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 187/401 (46%), Positives = 256/401 (63%), Gaps = 31/401 (7%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           MA+ +KWPWLG+AIP FLISF GY AH+F+L + LS+K  LWFQ SLSMIW+SY+ AI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  NPGRPT-----KGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCL 115
           +PG P+     +  + +R     YC KC+ YKP R HHCK CN+C+L+MDHHCPWTMNC+
Sbjct: 61  DPGSPSIADKNEDIKTIR----TYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCV 116

Query: 116 GLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDA 175
           G +          W+I TT  LL    +RI F W N Y+++ LV +QE++ LTILTP+DA
Sbjct: 117 GFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQRQEIVMLTILTPMDA 176

Query: 176 FILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQR-----LLPQLLTNLKEIYP 230
           FILLTI+LL +RC  NQI +G +QIE WEM+R+E+ FY ++      L  L+ N+  I+ 
Sbjct: 177 FILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILINNVFTIFS 236

Query: 231 -GSLEGQEKEVEEFL---SSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKA 286
             S E  ++EV   L        +F  +INFPYDI+   N    +G   +WLNPFG P+ 
Sbjct: 237 IESPEDYQEEVNGLLRQHDKRRLAFHSIINFPYDIDILTNATCVLGPFFSWLNPFGAPEG 296

Query: 287 DGMVFQKNEISDYDEATSIQDKLLALPWPPD--DTRHGIAF-PSVSHVEKDTQGGEQVVR 343
           DGM F+ NEI+  ++A+++ D LL+LPWPPD   +++G +      +VE   +GGE V+R
Sbjct: 297 DGMHFELNEIAS-EKASTLADLLLSLPWPPDTCTSKYGKSIDEGTKYVETHIEGGECVLR 355

Query: 344 RRHV--PIAVPPRNE-------WYNDWGESLEHFGVDVEVE 375
            R V     +P  NE       W N+WGE+L+ FGVD+E E
Sbjct: 356 NRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIEGE 396

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/384 (45%), Positives = 232/384 (60%), Gaps = 15/384 (3%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M V +K PW G+AIPC LI F GY AH+F+L N LS K  + FQ  L+MIWISY+ AIY 
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  NPGRPTKGF--RPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ 118
           NPG+P  G   +    +   YC KC  +KPER+HHCK C QCVL+MDHHCPWTMNCLG  
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFG 120

Query: 119 YLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYA--TANLVS--KQELIFLTILTPLD 174
                     W+I TT  L  Y + RI   W  R       +VS   +EL+ L +LTP+D
Sbjct: 121 NFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTKELVSLVVLTPMD 180

Query: 175 AFILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLE 234
            F+L TI+ LFVRCV NQ++ G TQIE+WEM+R++N+FY ++LLP ++  + E +P    
Sbjct: 181 LFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMIERVWEKFPHEQT 240

Query: 235 GQ-EKEVEEFL---SSSTCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMV 290
            + E E E+ L         F  V+NFPYD++   N+   +GSP+  L PF   + +G+ 
Sbjct: 241 PEHELEAEKLLEMNEQGLLKFSSVVNFPYDVDLLTNIHQSLGSPMLLLWPFSTAQGNGVT 300

Query: 291 FQKNEISDYDEATSIQDKLLALPWPPDDTR---HGIAFPSVSHVEKDTQGGEQVVRRRHV 347
           FQKN+IS Y++  SI D LL L WPPD  R   H         +++  + GE ++R+R+ 
Sbjct: 301 FQKNDISTYEDNLSISDLLLCLSWPPDGGRRIPHPQREDGAHMIDQTVEDGEFMIRKRNS 360

Query: 348 PIAVPPRNEWYNDWGESLEHFGVD 371
           PI    R  W N WGE+LE FGVD
Sbjct: 361 PIE--SRTTWENQWGETLEGFGVD 382

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  157 bits (398), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 127/402 (31%), Positives = 193/402 (48%), Gaps = 55/402 (13%)

Query: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60
           M +    PW GVAIP  +I      ++F +L + L+  + +W+  +  MI  SY+ AI  
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  ----NPGRPTKGFRPLRYEWQN------YCTKCETYKPERTHHCKRCNQCVLVMDHHCPW 110
                P   T+ F       +N       C KC+  K  R HHCK CN CV++MDHHCPW
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPW 120

Query: 111 TMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVS--KQELIFLT 168
           TMNC+G            W+I +T  LL   +K+    ++ R +  +L    K ++I LT
Sbjct: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIILT 180

Query: 169 ILTPLDAFILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNL--- 225
           +L P   F+ LT+ LL ++ ++NQI NG TQIE W+ + IEN ++  +     L      
Sbjct: 181 LLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLLE 240

Query: 226 -------KEIYPGSLEGQEKEVEEFLSSS--TCSFDEVINFPYDINPWVNLLNCMGS--P 274
                  K++   S+   +K +    + +    SF  +INFPYD+    N+   MGS  P
Sbjct: 241 NLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300

Query: 275 LNWLNPFGGPKADGMVFQKNEISDYDEATS---IQDKLLALPWPPDDTRHGIAFPSVSHV 331
           L+W NP+  P       + NE + +D+  +   I+D LL LPWP + + +          
Sbjct: 301 LSWFNPWYTPLT-ASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTF------- 352

Query: 332 EKDTQGGEQVVRRRHVPIAVPPRNEWYNDWGESLEHFGVDVE 373
               Q GE VV+               ND+GE+L+ FGVD +
Sbjct: 353 ----QDGELVVKS--------------NDYGETLQDFGVDYD 376

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 9/135 (6%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL--QYLAPQHSIFCWIIATTGIL 137
           C  C+ +KP+R HHC  CN+C+L MDHHCPW   C+G   Q    Q  I+C I A   + 
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTIYAFVALG 168

Query: 138 LHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGR 197
           L      I + +VN Y   N ++ + + F  ++  L AF++    L F      Q++  R
Sbjct: 169 L------ISYQFVNWYKNQNYMN-EYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNR 221

Query: 198 TQIEAWEMDRIENLF 212
           T IE + + R    F
Sbjct: 222 TTIEMYGIRRYNRDF 236

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 95/219 (43%), Gaps = 44/219 (20%)

Query: 8   PWLGVAIPCFLISFTGYFAHFFVLT-------NFLSFK----ELLWFQVSLSMIWISYWK 56
           P + V  P  +++  G FA+F V++       NF   +    E     + L   +I+   
Sbjct: 30  PSILVLTPILILATIGIFAYFRVVSTGPGTPSNFPDLRVYNLEDAKRGIELPPEYIAKRS 89

Query: 57  AIYKNPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
              K  GR               C  C+ +KP+R HHC  C++C+L MDHHCPW   C+G
Sbjct: 90  FTLKKDGR------------YRLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIG 137

Query: 117 L--QYLAPQHSIFCW-----IIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTI 169
              Q    Q  I+C      ++  T   LHY+    ++             + ELI L +
Sbjct: 138 FENQKYFVQFLIYCTAYSIVVLFFTSCELHYWFSGKQY-------------EDELIDLML 184

Query: 170 LTPLDAFILLTISLLFVRCVK-NQIVNGRTQIEAWEMDR 207
           LT     I++T+SL+F       Q++  +T IE + M R
Sbjct: 185 LTVWILAIVITVSLIFFSSFSIYQLLKNQTTIEMYGMKR 223

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 116/266 (43%), Gaps = 57/266 (21%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYLAPQHSIFCWII 131
           +C  CE +KP+R HHC +CN+C L MDHHCPW  +C+G       +Q+LA       +++
Sbjct: 104 FCQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVL 163

Query: 132 ATTGILLHYFVKRIKFTWVNRYATANLVSKQELI--FLTILTPLDAFILLTISLLFVRCV 189
             T   L+ + +++K+        + L+    L+   L+++  +  F   T ++  V   
Sbjct: 164 LMTSAQLYSWFRQMKY-------KSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLV--T 214

Query: 190 KNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEVEEF--LSSS 247
           KN+     T IE +E   I +                EIY  S+      V+    L S 
Sbjct: 215 KNE-----TTIEQYEWGNIRHDL--------------EIYGDSINCNMGSVDNVFDLGSR 255

Query: 248 TCSFDEVINFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVF--QKNEISDYDEATSI 305
           + +F+ V+        W  LL  +   +   +PF      G+ F  Q +    Y E+ ++
Sbjct: 256 SANFNCVMG-----ASWAELL--LPIQVRADDPFDPYANQGLFFPVQSDTYRIYRESVNL 308

Query: 306 QDKLLALPWPPDDTRHGIAFPSVSHV 331
           Q +L+        TR  +  PS+ H+
Sbjct: 309 QQRLI--------TRLTLR-PSIEHI 325

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 66/150 (44%), Gaps = 21/150 (14%)

Query: 60  KNPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL-- 117
           KN GRP              C  C  +KP+R+HHC  CN+CVL MDHHCPW   C+G   
Sbjct: 102 KNNGRP------------RVCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKN 149

Query: 118 QYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFI 177
           Q    Q  I+     T   ++     +  + W +  +  N      L+FL IL  + +  
Sbjct: 150 QKFFIQFLIYN---TTYAYVIAILTSKQMYNWFDDGSYENEFVNMYLLFLWILALVVSLA 206

Query: 178 LLTISLLFVRCVKNQIVNGRTQIEAWEMDR 207
           L   +   V  V    +N +T IE + M +
Sbjct: 207 LSCFAGFSVYMV----MNNKTTIEMYAMRK 232

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 70.1 bits (170), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 84/175 (48%), Gaps = 22/175 (12%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYLAPQHSIFCWIIA 132
           C  C  +KP+R HHC  C++C+L MDHHCPW   C+G       +Q+L    +   ++++
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 133 TTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQ 192
            T + L+ +    KF          L+S   L+FL I + L  FI +T   LF     +Q
Sbjct: 163 MTSVQLYRWFYNDKF-------QEELISGY-LLFLWIFS-LVVFIAMT---LFSAFSVSQ 210

Query: 193 IVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEVEEFLSSS 247
           ++  +T IE + + R  N     R+L     +L ++   +L    K  +E +  +
Sbjct: 211 VLKNQTTIEMYGVQRWRN---QARILGDQQASLHDVNIFNLGSWRKNWDEVMGHT 262

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 92/225 (40%), Gaps = 34/225 (15%)

Query: 13  AIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYKNPGRPTK----- 67
            + CFL  +TG     +V     S   L+    +L++   SY+K      G P +     
Sbjct: 41  VLTCFLFFYTGIITISYVRVVPTSIVALM-ISTNLTLSLYSYFKVASVGAGTPMEFPELR 99

Query: 68  ---------GFR-PLRYEWQN-----------YCTKCETYKPERTHHCKRCNQCVLVMDH 106
                    G   P R+  Q            +C  C  +KP+R HHC  CN+C L MDH
Sbjct: 100 ITNIEDAEEGLELPPRFLTQRCVTLKRNGRFRFCRTCVVWKPDRCHHCSGCNKCYLKMDH 159

Query: 107 HCPWTMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIF 166
           HCPW  +C+G  Y   ++ I   +  T   +L +F+         R    N    QELI 
Sbjct: 160 HCPWFASCVG--YRNQKYFIHFLLYTTAYSILVFFLTGADLLMWFRSQGYN----QELIN 213

Query: 167 LTILTPLDAFILLTISLL-FVRCVKNQIVNGRTQIEAWEMDRIEN 210
           L +L      +++TIS+L F       +   +T IE +E     N
Sbjct: 214 LPLLIVWILSLVITISMLAFTSYTIYLVAKNQTTIEMYEWTNYRN 258

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 108/241 (44%), Gaps = 31/241 (12%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL--QYLAPQHSIFCWIIATTGIL 137
           C  C ++KP+R HHC  CN CVL MDHHCPW   C+G   Q    Q  I+C + +   IL
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYS---IL 162

Query: 138 LHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISL-LFVRCVKNQIVNG 196
           +        +TW           + ELI  T+L+     ++++IS+ +F     +Q+   
Sbjct: 163 VLILSSMEIYTWFK-----GEFFEVELINFTLLSLWLLALVVSISITIFTVFSISQVCQN 217

Query: 197 RTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEVEEFLSSSTCSFDEVIN 256
           +T IE + + R     Y++      +  L E     ++G     +  L     +++EV+ 
Sbjct: 218 QTTIELYSLRR-----YNEE-----VAFLNEFSNEPIKGTINIFD--LGKKLINWEEVMG 265

Query: 257 FPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVF--QKNEISDYDEATSIQDKLLALPW 314
             Y +  W   ++   S L+      G  + G+ F   KN     +E+  +QD+LL    
Sbjct: 266 --YSLIEWALPISRRPSSLD----LEGSHSHGLFFNVNKNVSKTMNESVDLQDRLLRRLT 319

Query: 315 P 315
           P
Sbjct: 320 P 320

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 63/130 (48%), Gaps = 9/130 (6%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATT--GIL 137
           C  C  +KP+R HHC  C++C+L MDHHCPW   C+G +    Q     ++I TT   IL
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFK---NQKYFVQFLIYTTVYAIL 162

Query: 138 LHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGR 197
           +  +     + W         + K  L+ + IL+     + LT++  F      Q +N R
Sbjct: 163 VMTYTSFQIYDWFKNELYETEIIKIRLLMVWILS---VAVFLTVT-CFTGFSIYQTINNR 218

Query: 198 TQIEAWEMDR 207
           T IE + + +
Sbjct: 219 TTIEMYTLRK 228

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 10/71 (14%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYL--APQHSIFCWI 130
           C  C  +KP+R HHC RC++C+L MDHHCPW   C+G       +QYL  A  +SI  ++
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIFL 166

Query: 131 IATTGILLHYF 141
            ++   LLH+F
Sbjct: 167 FSSIQ-LLHWF 176

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 81/195 (41%), Gaps = 17/195 (8%)

Query: 69  FRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFC 128
           F  L +    +C+ C   KP R+ HC  CN+CVL+ DHHC W  NC+G   L      + 
Sbjct: 126 FDSLIFYPNTFCSTCRLEKPARSKHCNICNRCVLLSDHHCIWANNCIG---LGNYQYFYT 182

Query: 129 WIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRC 188
           ++++ T +L + F++ I  T  +     N+V       LT L    AF    I L+F   
Sbjct: 183 FLVSNTLLLGYAFLRIILLTAYSDIGFPNIV-------LTFLILSGAF--FAILLVFTYL 233

Query: 189 VKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEVEEFLSSST 248
               + +G T  E  +   I+      RL+          +P    GQ          ST
Sbjct: 234 QFALVYDGMTTNEKDKWFTIQEFMREGRLIRTDNGQWLIAHPEEPAGQATRF-----YST 288

Query: 249 CSFDEVINFPYDINP 263
            ++D  I  P +  P
Sbjct: 289 NAYDHTIYCPVNFRP 303

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 20/112 (17%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYLAPQHSIFCWIIA 132
           C  C+ +KP+R+HHC  CN+C L MDHHCPW  +C+G       +Q+L        ++  
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

Query: 133 TTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLL 184
           TTG+ L        + W++     N + ++ELI L+++T     I+  IS+ 
Sbjct: 165 TTGLQL--------WKWLD-----NKMYEKELIDLSLMTVWLLSIISCISMF 203

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 64/132 (48%), Gaps = 13/132 (9%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL--QYLAPQHSIFCWIIATTGIL 137
           C  C  +KP+R HHC  CN+C+L MDHHCPW   C+G   Q    Q   +C    T+  +
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFLFYC----TSYSI 161

Query: 138 LHYFVKRIK-FTWVNRYATANLVSKQELIFLTILTPLDAFILLTISL-LFVRCVKNQIVN 195
           +  FV  I+ + W    +      + E I   +LT     I++ ISL LF      Q++ 
Sbjct: 162 IVLFVTSIQIYHWFRSTSY-----EYEFIDFKLLTVWLLAIVIFISLVLFTGFSVFQLLG 216

Query: 196 GRTQIEAWEMDR 207
            +T IE +   R
Sbjct: 217 NQTTIELYAYRR 228

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 65/136 (47%), Gaps = 25/136 (18%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYL--APQHSIFCW 129
           +C  C  +KP+R HHC  C +C L MDHHCPW  +C+G       +Q+L      SI  +
Sbjct: 105 FCRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIF 164

Query: 130 IIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLL-FVRC 188
           +++ T +LL +  +R                 QE+I L +L      + ++IS+L F   
Sbjct: 165 LLSGTELLLWFKNQRY---------------NQEMIQLPLLVVWILSVAISISMLAFTSY 209

Query: 189 VKNQIVNGRTQIEAWE 204
               I   +T IE +E
Sbjct: 210 TVYLITKNQTTIEMYE 225

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 75/182 (41%), Gaps = 33/182 (18%)

Query: 53  SYWKAIYKNPGRP-------------------------TKGFRPLRYEWQ-NYCTKCETY 86
           +Y+KAI K PG P                         +K    L+++ +   C  C  +
Sbjct: 53  TYFKAIAKGPGSPLDFPDLLVHDLQAAENGLELPPEYMSKRCMTLKHDGRFRVCQICHVW 112

Query: 87  KPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIK 146
           KP+R HHC  C+ C+L MDHHCPW   C G +          +      ++L Y    + 
Sbjct: 113 KPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTFYAFLVLIYSCYELG 172

Query: 147 FTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLL-FVRCVKNQIVNGRTQIEAWEM 205
            TW +  +       QELI   +L      I + IS+L F      Q+ N +T IE + M
Sbjct: 173 -TWFHSGSF-----NQELIDFHLLGVALLAIAIFISVLAFTAFSIYQVCNNQTTIELYGM 226

Query: 206 DR 207
            R
Sbjct: 227 RR 228

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 9/68 (13%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYL--APQHSIFCW 129
           YC  C  +KP+R+HHC  CN+C L  DHHCPW  +C+G       +Q+L  +  +SI  +
Sbjct: 109 YCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIF 168

Query: 130 IIATTGIL 137
           I AT  I+
Sbjct: 169 IAATLQIV 176

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 59/135 (43%), Gaps = 7/135 (5%)

Query: 72  LRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWII 131
           L Y  Q+ C  C+  KP R+ HC  CN C+ + DHHC W  NC+G+      +S  C   
Sbjct: 128 LLYFPQHECRTCKQVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLC--- 184

Query: 132 ATTGILLHYFVKRIKFTWVNRYA-TANLVSKQELIFLTILTPLDAFILLTISLLFVRCVK 190
            +  +LL Y   R+ F   N+ A       ++ L+ L+IL      IL          V 
Sbjct: 185 -SNLLLLSYSFIRLIFIQFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVN 243

Query: 191 NQIVNGRTQIEAWEM 205
           + +       + W+M
Sbjct: 244 SGMTTNEK--DKWQM 256

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 28/39 (71%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ 118
           C  C  +KP+R HHC  CN+C+L MDHHCPW  +C+G +
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFR 146

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 51/103 (49%), Gaps = 8/103 (7%)

Query: 68  GFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIF 127
            F  L +  Q  C  C++YKP R+ HC  C++CVLV DHHC W  NC+G       ++ F
Sbjct: 125 AFDNLIFYPQILCRTCQSYKPARSKHCSICDRCVLVADHHCIWVNNCVG----KGNYTYF 180

Query: 128 CWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTIL 170
              + T    L Y   R+    +  + T N+   +  + LTIL
Sbjct: 181 YMFLITNTFSLTYAFIRL----LTIFYTTNVYLPKNTLTLTIL 219

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 62/134 (46%), Gaps = 17/134 (12%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139
           C  C  +KP+R HHC  C+ C+L MDHHCPW   C G +    Q     +++ TT    +
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFK---NQKFFIQFLMYTT---FY 159

Query: 140 YFVKRIKF-----TWVNRYATANLVSKQELIFLTIL-TPLDAFILLTISLLFVRCVKNQI 193
            F+  I       TW N  + +     +ELI L +L T L A  +    L F      Q+
Sbjct: 160 AFLVLIDTCYELGTWFNSGSFS-----RELIDLHLLGTALLAIAVFISVLAFSAFSIYQV 214

Query: 194 VNGRTQIEAWEMDR 207
            N +T IE   M R
Sbjct: 215 CNNQTTIELHSMRR 228

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 101/253 (39%), Gaps = 59/253 (23%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139
           C  C  +KP+R HHC  C++C+L MDHHCPW   C+G +     H  F   +     L  
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFK----NHKYFINFLIYNS-LYA 160

Query: 140 YFVKRI--KFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISL-LFVRCVKNQIVNG 196
            FV  I  K  W N ++    V+  ELI + +L      ++ ++S+ LF      Q++  
Sbjct: 161 TFVCLISSKELW-NWFSQEKYVT--ELINIHLLLLFIVSLITSVSMTLFTAYSIYQVLIN 217

Query: 197 RTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEGQEKEVEEFLSSSTCSFDEVIN 256
           RT IE +   R                              KE  E L  +T +++   N
Sbjct: 218 RTTIELYAYRRY-----------------------------KEELEILQDTTTTYNSQSN 248

Query: 257 FP------YDINPW-VNLLNCMGSP-LNWLNPFGGPK---------ADGMVFQKNE--IS 297
            P      +D+  + +N    MG+    WL P    K           G+ F  N    S
Sbjct: 249 RPLPTDNVFDLGSYKLNWCETMGTTWKEWLLPVQTNKYIKSRHTSDEKGLYFNINRKVAS 308

Query: 298 DYDEATSIQDKLL 310
              E+  +QD+LL
Sbjct: 309 QLQESAILQDRLL 321

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139
           C  C   KP R+ HC  CN+C+L++DHHC W  NC+G       +  F   + +   LL 
Sbjct: 132 CQTCHKIKPARSKHCSICNKCILMVDHHCIWVNNCIG----KGNYKYFYGFLLSNVTLLS 187

Query: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILT 171
           Y   R+  T +   +    +  + ++ LTILT
Sbjct: 188 YSFLRL--TSIQLMSQTENIKTKPMLVLTILT 217

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 70/150 (46%), Gaps = 11/150 (7%)

Query: 69  FRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFC 128
           F  + Y   N C+ C   KP R+ HC  C  C+L+ DHHC W  NC+G   L      F 
Sbjct: 128 FDNIIYHSGNVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIG---LGNYKYFFM 184

Query: 129 WIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRC 188
           +++  T  L + F++ +  T     +  ++   + ++ L ILT   +F ++     +++ 
Sbjct: 185 FLLLNTISLSYAFLRLLHITL----SKPDVPKSKNILALCILT--GSFSVICGVFFYLQ- 237

Query: 189 VKNQIVNGRTQIEAWEMDRIENLFYHQRLL 218
              Q+ NG T  E  +   ++ L    +L+
Sbjct: 238 -MKQVNNGMTTNETDKWYAVQELMREGKLI 266

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 74/189 (39%), Gaps = 31/189 (16%)

Query: 45  VSLSMIWISYWKAIYKNPGRP-------------------------TKGFRPLRYEWQ-N 78
            +L++   +Y+K I + PG P                         +K    L+++ +  
Sbjct: 45  ATLTVALYTYYKVISRGPGSPLDFPDLIVHDLKAAENGLELPPEYISKRCMTLKHDGRFR 104

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILL 138
            C  C  +KP+R HHC  C+ CVL MDHHCPW   C G +          +      ++L
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMYTTCYAFLVL 164

Query: 139 HYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRT 198
            Y    +  TW N    +   +++ + F  +   L A  +    L F      Q+   +T
Sbjct: 165 IYTCYELG-TWFN----SGSFNRELIDFQLLGVALLAVAVFITVLAFTVFSIYQVCKNQT 219

Query: 199 QIEAWEMDR 207
            IE   M R
Sbjct: 220 TIEVHGMRR 228

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 79/191 (41%), Gaps = 37/191 (19%)

Query: 46  SLSMIWISYWKAIYKNPGRP-------------------------TKGFRPLRYEWQ-NY 79
           +L++   +Y+K I + PG P                         +K    L+++ +   
Sbjct: 46  TLAVALYTYYKVIARGPGSPLDFPDLLVHDLKAAENGLELPPEYMSKRCLTLKHDGRFRV 105

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATT--GIL 137
           C  C  +KP+R HHC  C+ C+L MDHHCPW   C G +    Q     +++ TT    L
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFR---NQKFFIQFLMYTTLYAFL 162

Query: 138 LHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVK-NQIVNG 196
           +  +      TW N  +       +ELI   +L      + + IS+L   C    Q+   
Sbjct: 163 VLIYTCYELGTWFNSGSF-----NRELIDFHLLGVALLAVAVFISVLAFTCFSIYQVCKN 217

Query: 197 RTQIEAWEMDR 207
           +T IE   M R
Sbjct: 218 QTTIEVHGMRR 228

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 104/284 (36%), Gaps = 41/284 (14%)

Query: 6   KWPWLGVAIPCFLISFTGYFAHFF-------VLTNFLSFKELLWFQVSLSM--------I 50
           ++ W   AIP F +S   Y    F       + +     + LL   V+LS         I
Sbjct: 47  RFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRSRLFGVERLLIIPVALSAPIITGLLTI 106

Query: 51  WISYWKAIYKNPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPW 110
           WI   K+ Y +P      +  L +     C  C+  K  RT HC  C+QCV + DHHC W
Sbjct: 107 WIK-PKSTYASPM--LDAYDELIFHSGVSCRTCKLPKFARTKHCPICDQCVQLADHHCVW 163

Query: 111 TMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTIL 170
             NC+G       +  F   + +   L +Y   R+ F           V  ++L+ L+IL
Sbjct: 164 ANNCIG----RGNYQYFYLFLVSNVFLTNYGFLRLLF-------LQRFVHSRQLLILSIL 212

Query: 171 TPLDAFILLTISLLFVRCVKNQIVNGR--------TQIEAWEMDRIENLFYHQRLLPQLL 222
                 IL   S      V++ +              I A +M   +   Y+ RLL    
Sbjct: 213 LGCFGVILAVFSYFQFVLVRDGMTTNEENKWLVIHDMIRARQMVTDDTGKYYFRLLADCQ 272

Query: 223 TNLKEIYPGSLEGQEKEVEEFLSSSTCSFDEVINFPYDINPWVN 266
            +  E         +   E  L+ S+      I   Y  NP+ N
Sbjct: 273 EDSAESLTNPRHSSQGPNEFHLNDSSPD----IYVYYSTNPYDN 312

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 16/127 (12%)

Query: 6   KWPWLGVAIPCFLISFTGYFA-HFFVLTNFLSFKELLWFQ----VSLSMIWISYWKAI-- 58
           K+ W    +P F I+   Y   +F+     L   +L +F+    + +S+I   ++  I  
Sbjct: 47  KYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHDKLTYFERFFFIPISIISTPFFGIITM 106

Query: 59  ---------YKNPGRPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCP 109
                    Y N       +  + Y     C  C+  KP R+ HC  C+QC+LV DHHC 
Sbjct: 107 LINPDTALMYSNDSIKKYAYDRILYFPDTECKTCKVEKPARSKHCAVCDQCILVNDHHCV 166

Query: 110 WTMNCLG 116
           W  NC+G
Sbjct: 167 WVNNCIG 173

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YCT C  ++P R+ HC  CN CV+V DHHC W  NC+G
Sbjct: 174 YCTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIG 211

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139
           C  C   KP R+ HC  C +CVLV DHHC W  NC+G       +  F   +    I L 
Sbjct: 138 CRTCHIEKPARSRHCNLCRECVLVADHHCVWVNNCIG----KGNYQFFYAFLVVNVISLS 193

Query: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNG 196
           Y   R+ +  V +  +  +  +  LIF TIL    A I    + L ++ V + +  G
Sbjct: 194 YGFLRVLWISVMKDPSMVVYPRSILIF-TILCGTFAIICGVFTYLQLQLVNDGMTTG 249

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 22/38 (57%), Positives = 26/38 (68%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL 117
           C  C+  KP R+ HC  CNQCVL +DHHC W  NC+GL
Sbjct: 135 CRTCQLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGL 172

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (65%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YC  C  ++P RT HC  CN CV+V DHHC W  NC+G
Sbjct: 174 YCQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVG 211

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C+ C   KP R+ HC  CN+C+LV DHHC W  NC+G
Sbjct: 136 CSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIG 172

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 25/37 (67%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C+ C   KP R+ HC  CN+CVLV DHHC W  NC+G
Sbjct: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIG 172

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 78  NYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
            YC  C  ++P R+ HC  CN CV+V DHHC W  NC+G
Sbjct: 173 KYCQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIG 211

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 77  QNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
             YC KC+ +KP+R HHC  C++C L  DHHC W   C+G
Sbjct: 168 HRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIG 207

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 25/37 (67%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C+ C T K  R+ HC  CN+CVLV DHHC W  NC+G
Sbjct: 136 CSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIG 172

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YC  C  ++P R+ HC  CN CV+V DHHC W  NC+G
Sbjct: 174 YCPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIG 211

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C+ C   KP R+ HC  CN+C+LV DHHC W  NC+G
Sbjct: 136 CSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIG 172

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 52/118 (44%), Gaps = 10/118 (8%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL-QYLAPQHSIFCWIIATTGILL 138
           C  C   KP R+ HC+ CN C+L+ DHHC W  NC+G   YL     + C  I  T   +
Sbjct: 139 CRTCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFI 198

Query: 139 HYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNG 196
             F+          Y   +  S + ++ L IL    A I    + L ++ VK+ +   
Sbjct: 199 RLFLM---------YCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTN 247

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           P     PL      YCT C  ++P R  HC  C  CV+  DHHC W  NC+G
Sbjct: 166 PKSNVDPLSKIDIRYCTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVG 217

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YCT C  ++P R  HC  CN C++  DHHC W  NC+G
Sbjct: 188 YCTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVG 225

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YCT C  ++P R  HC  C  C+L  DHHC W  NC+G
Sbjct: 180 YCTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIG 217

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YCT C  ++P R  HC  C  C++  DHHC W  NC+G
Sbjct: 171 YCTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIG 208

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 78  NYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
            YCT C+ ++P R  HC+ C  CV   DHHC W  NC+G
Sbjct: 184 KYCTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVG 222

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YCT C  ++P R+ HC  C  C++  DHHC W  NC+G
Sbjct: 216 YCTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIG 253

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 78  NYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
            YCT C  ++P R  HC  C+ C+L  DHHC W  NC+G
Sbjct: 185 KYCTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIG 223

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 15/128 (11%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139
           C  C   KP R+ HC  C++C+L+ DHHC W  NC+G+      +  F   I    + + 
Sbjct: 135 CKTCRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMG----NYKWFYLFIGGNSLTMI 190

Query: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRTQ 199
           Y   R+ F  +    T    S + ++ + IL    A I    + L +  V   I      
Sbjct: 191 YCFTRLLFISIKYKVT----SSRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTN--- 243

Query: 200 IEAWEMDR 207
               EMD+
Sbjct: 244 ----EMDK 247

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 22/39 (56%)

Query: 78  NYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
            YC  C  ++P R  HC  C  CVL  DHHC W  NC+G
Sbjct: 176 KYCATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIG 214

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YC  C  ++P R+ HC  C  CVL+ DHHC W  NC+G
Sbjct: 183 YCKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVG 220

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 11/77 (14%)

Query: 71  PLRYEWQ----NYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQY 119
           P++ E Q     YC  C  ++P R+ HC  C+ CV+ +DHHC W  NC+G       L +
Sbjct: 183 PIKDESQYVEITYCRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIF 242

Query: 120 LAPQHSIFCWIIATTGI 136
           L        +++  TGI
Sbjct: 243 LTSTIMTVIFLLINTGI 259

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YC  C  ++P R+ HC  C+ CVL  DHHC W  NC+G
Sbjct: 173 YCQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIG 210

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%)

Query: 78  NYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
            YC  C  ++P R  HC  C  C+L  DHHC W  NC+G
Sbjct: 171 KYCPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIG 209

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 65/139 (46%), Gaps = 12/139 (8%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLH 139
           C  C   K  R+ HC  C +C+LV DHHC W  NC+GL      +  F   + +   +L 
Sbjct: 133 CRSCRLKKAARSKHCSICGRCILVADHHCVWLNNCIGL----GNYQYFYLFLLSNCSMLS 188

Query: 140 YFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNGRTQ 199
           Y   R+     +  A + L    +  FL+++  +  F +++IS  +++     + +G T 
Sbjct: 189 YATIRL-----SSVAPSGLWRSNK-SFLSLMILVCCFAVISISFTYMQFA--LVRDGMTT 240

Query: 200 IEAWEMDRIENLFYHQRLL 218
            E  +   I  L  +++LL
Sbjct: 241 NEKDKWYTIHKLMRNEQLL 259

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 22/38 (57%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YC  C  ++P R  HC  C  CV+  DHHC W  NC+G
Sbjct: 177 YCRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVG 214

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           YC+ C  ++P R  HC  C  C+ V DHHC W  NC+G
Sbjct: 189 YCSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVG 226

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 7/68 (10%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYLAPQHSIFCWII 131
           YC  C+ ++P R  HC  C  CVL  DHHC W  NC+G       L +L         +I
Sbjct: 159 YCHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI 218

Query: 132 ATTGILLH 139
           A   + LH
Sbjct: 219 ANCALHLH 226

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C  C   KP R+ HC  C +CV + DHHC W  NC+G
Sbjct: 126 CRTCRVRKPARSRHCGVCGRCVPLADHHCVWLNNCVG 162

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 52/122 (42%), Gaps = 19/122 (15%)

Query: 14  IPCFLISFTGYFAHFF------VLTNFLSFKELLWFQ-VSLSMIWISYWKAIYKNP---G 63
           +P F  S   Y  + +      V+   L F EL +FQ + L+ I +S    ++  P   G
Sbjct: 54  VPVFYFSLYCYMLNLYRSELLPVIWGRLYFIELYFFQPLLLAAIPVSGLLTMFTRPEGCG 113

Query: 64  RPTKGFRPLRYEW---------QNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNC 114
              +G  P   +W            C  C T K  R+ HC  C +C+ + DHHC W   C
Sbjct: 114 GRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARSKHCSICRRCIQLADHHCIWFNTC 173

Query: 115 LG 116
           +G
Sbjct: 174 IG 175

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C  C+T K  R+ HC  C +C+ + DHHC W  NC+G
Sbjct: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVG 165

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/259 (21%), Positives = 105/259 (40%), Gaps = 42/259 (16%)

Query: 64  RPTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNC--------L 115
           +P K ++  +  +  +CT C++ K  R+HH K+  +C+L  DH+C W + C        L
Sbjct: 102 KPPKYYQCDKNGYPPWCTHCQSLKLSRSHHSKQVGRCILRFDHYCAW-IGCVIARNNYRL 160

Query: 116 GLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDA 175
            LQY+   + +  W   T  +    F++ I           N++    L  L  +  L  
Sbjct: 161 FLQYVGWFNLLLLWYWLTIAV----FIRTIGML------NGNVIVGFILSCLGWMMTLGL 210

Query: 176 FILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNLKEIYPGSLEG 235
           F    IS ++       + N +T IE  + +R       +R   +++    EI    +E 
Sbjct: 211 F----ISHIYY------MSNNKTSIETLDAER------GKRKKHKMMVTNDEIEHARIEY 254

Query: 236 QEK------EVEEFLSSSTCSFDEVINFPYDINPWVNLLNCMGSP-LNWLNPFGGPKADG 288
             K      + ++F      + DE        + W+N    +GS  + WL P+G    D 
Sbjct: 255 NRKYFCYYNQQDKFRYVVELTADEFAKCWKKRSFWINAREFLGSDIIFWLFPWGSYFPDL 314

Query: 289 MVFQKNEISDYDEATSIQD 307
              + +    Y ++  +++
Sbjct: 315 RKREASSFQSYGQSYDLEN 333

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 19/109 (17%)

Query: 45  VSLSMIWISYWKAIYKNPGRPTKG-------------FRPLRYEWQNYCTKCETYKPERT 91
           +++S+I I + K I  +PG   +               +  +Y+  N+C +  T KP R+
Sbjct: 416 ITISIICILFGKLITSDPGNIYEEKDHGLVREMVEELMKLGKYDTSNFCIETLTRKPLRS 475

Query: 92  HHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIAT--TGILL 138
            +    N  V   DH+CPW  N +GL+     H  F + I +  TGI L
Sbjct: 476 RYSYMNNALVSRFDHYCPWVYNDVGLK----NHKTFLFFILSMETGIGL 520

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           P   F  + +     C  C+  K  R+ HC  C +C  + DHHC W  NC+G
Sbjct: 116 PVDQFDGILFHAGVECRTCKMPKYARSKHCAICGRCTQLADHHCVWANNCIG 167

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 17/116 (14%)

Query: 41  LWFQVSLSMIWISYWKAIYKNPG--RPTKGFRPLR-----------YEWQNYCTKCETYK 87
           + F   L  + + +++ +Y +PG   P   F  +R           ++ +N+C +    K
Sbjct: 408 ILFVAVLGCVHLLFFQLVYSDPGVLEPETDFNEIRNKISELLKIGKFDTKNFCIETWQRK 467

Query: 88  PERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLHYFVK 143
           P R       ++ VL  DH+CPW  N +GL      H  F + + + G+ +  FVK
Sbjct: 468 PLRCKFSSFHSRLVLRFDHYCPWVYNDVGLL----NHKKFMYYVMSVGLGIVCFVK 519

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 53/127 (41%), Gaps = 24/127 (18%)

Query: 30  VLTNFLSFKELLWFQVSLSMIWISYWKAIYKNPG--------RPTKG-----FRPLRYEW 76
           +LTNF  F       + L  I+  + K I+ +PG           +G         +++ 
Sbjct: 401 LLTNFFMF-------LILMQIYYLFIKLIFSDPGCVPIETDHENVRGTIKELLDTGKFDI 453

Query: 77  QNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGI 136
           +N+C +    KP R+H        V   DH CPW  N +GL+     H  F W I  T +
Sbjct: 454 KNFCLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLK----NHKNFMWFILLTEV 509

Query: 137 LLHYFVK 143
            + +F+ 
Sbjct: 510 GIWFFIS 516

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 12/135 (8%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL-QYLAPQHSIFCW--IIATTGI 136
           C  C++ K  RTHH KR   C+   DHHC W    +G   YL     +F +  ++    I
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVFYFSCLLLIFWI 183

Query: 137 LLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVNG 196
            +  ++KRI    V+   T   +    ++ L +  P   F ++T+S LF+  V    +N 
Sbjct: 184 SIVSYIKRI----VDYPHTGYKLDPNLIVILILSVP---FSIMTLS-LFLSHVYFTFMN- 234

Query: 197 RTQIEAWEMDRIENL 211
           RT +E   + R + L
Sbjct: 235 RTSLEIINIKRNKKL 249

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 59/132 (44%), Gaps = 11/132 (8%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ--YLAPQHSIFCWI-IATTG 135
           +CT C++ K ER HH +    CV   DH C +  + +G     L  Q+ +F  I +A   
Sbjct: 126 WCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIW 185

Query: 136 ILLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLFVRCVKNQIVN 195
             +  +++ I   +    +  N      LI + ILT L  F +   SLL  +   N IV 
Sbjct: 186 TSIVAYIRSITRDYRGHGSHLN----GNLIAILILTTL--FWITVTSLLLTQL--NCIVK 237

Query: 196 GRTQIEAWEMDR 207
            +T IE  E  R
Sbjct: 238 NKTSIEVMERRR 249

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +    KP R+      N  V   DH+CPW  N +GL+     H IF + I 
Sbjct: 456 KFDTRNFCIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLK----NHKIFIFFII 511

Query: 133 TTGILLHYFV 142
           +  I +  FV
Sbjct: 512 SVEIGILIFV 521

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +  T KP R+      N  V   DH+CPW  N +GL+     H  F + IA
Sbjct: 465 KFDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLK----NHKAFIFFIA 520

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 22/129 (17%)

Query: 71  PLRYE-----WQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQ 118
           PL Y+     +  +C  C++ K  RTHH  R   CV   DH+C W    +G       +Q
Sbjct: 112 PLIYQCDENGYPTWCAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQ 171

Query: 119 YLAPQHSIFC--WIIATTGILLHYFVKR-------IKFTWVNRYATANLVSKQELIFLTI 169
           +L     +    WI  +  I ++ F +        I   W + + T  L +   +I L  
Sbjct: 172 FLVYMDCLLLIMWISMSPFIRVYTFRRDGNLIAIYILSVWCSLFVTGLLTAHIYMISLN- 230

Query: 170 LTPLDAFIL 178
           LT L+  IL
Sbjct: 231 LTSLEGIIL 239

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQH 124
           P K ++   + +  +C+ C++ K ERTHH      CV   DH+C W    +G       +
Sbjct: 117 PPKCYQSDPHGYPIWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRD----NY 172

Query: 125 SIFCWIIATTGILL 138
            +F   +A   ILL
Sbjct: 173 RLFVQFVAYFSILL 186

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG-------LQYLAPQHSIFCWI 130
           +CT C++ K ER HH ++   C+   DH+C W    +G       +QY+   + +  WI
Sbjct: 116 WCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWI 174

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 7/109 (6%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ--YLAPQHSIFCWI-IATTGI 136
           C+ C++ K ER+HH +    CV   DH+C W    +G +   L  Q+ ++  I + T  +
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 137 LLHYFVKRIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISLLF 185
            +  F+KRI    V+     +L     +I L IL    AF +  +  +F
Sbjct: 187 TIALFMKRI----VDYNKEHDLTLNLNIIVLFILVLAFAFFVTPLFAVF 231

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +    KP R+      N  V   DH+CPW  N +GL+     H  F   I 
Sbjct: 457 KFDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLR----NHKAFLMCIL 512

Query: 133 TTGILLHYF 141
              IL+  F
Sbjct: 513 LVEILMLLF 521

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           P K ++   + +  +C++C++ K ERTHH      C+   DH+C W    +G
Sbjct: 116 PPKCYQSDPHGYPIWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIG 167

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C++C++ K ERTHH      CV   DH+C W    +G
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIG 159

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +++C +  T KP R+ +    N  V   DH+CPW  N +GL+     H  F + I 
Sbjct: 465 KFDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLK----NHKAFIFFIT 520

Query: 133 T 133
           +
Sbjct: 521 S 521

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 13/123 (10%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +    KP R+ +       V   DH+CPW  N +GL+     H +F +   
Sbjct: 441 KFDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLK----NHKLFVFFAV 496

Query: 133 TTG--------ILLHYFVK-RIKFTWVNRYATANLVSKQELIFLTILTPLDAFILLTISL 183
           T          + L YF K    +  V  YA   L+  + L   +   P   F+ + IS+
Sbjct: 497 TVQYHMFLFMWLCLAYFKKTNYIYEQVEEYARCALLKNETLCKGSNYDPSTFFLFIWISV 556

Query: 184 LFV 186
            F+
Sbjct: 557 NFI 559

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 65/164 (39%), Gaps = 23/164 (14%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +Y+  N+C +    KP R+ +       V   +H+CPW  N +GL+     H +F +   
Sbjct: 424 KYDRNNFCVETLERKPLRSKYSLFSGALVARFNHYCPWVYNDIGLK----NHKLFMFFAF 479

Query: 133 TTG--------ILLHYFVKRIK-FTWVNRYATANLVSKQELIFLTILTPLDAFILLTIS- 182
           +          + L YF K    +  V  YA    +  + L   +   P   F+ + IS 
Sbjct: 480 SVQYEMFLFMWLCLEYFKKTNHIYEQVEEYAKCTFLKNETLCKGSNYDPSTFFLFIWISM 539

Query: 183 -------LLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLP 219
                  +L V+C   QI  G T  E + + + E       L+P
Sbjct: 540 NFVWLGGMLIVQCF--QIFKGITSPELYALIKEERKAEALNLIP 581

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +++C +    KP R+ +    +  +L  DH+CPW  N +GL+     H +F + I 
Sbjct: 449 KFDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLK----NHKLFIFFIL 504

Query: 133 TTGILLHYFVK 143
              + +  FVK
Sbjct: 505 ALELGIFSFVK 515

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ--YLAPQHSIFCWIIA 132
           +CT C++ K  RTHH      C+   DH+C W    +G +   L  Q + + W  A
Sbjct: 131 WCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFA 186

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWII 131
           +++  N+C +    KP R+ +    +  V   DH CPW  N +GL+     H +F   I
Sbjct: 472 KFDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLK----NHKLFVLFI 526

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 3/70 (4%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ--YLAPQHSIFCWIIATTGI 136
           +CT C++ K  RTHH      C+   DH+C W    +G +   L  Q + + W+     I
Sbjct: 124 WCTACQSLKSNRTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMI 183

Query: 137 L-LHYFVKRI 145
             +  F++RI
Sbjct: 184 ASIASFLRRI 193

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +    KP R+      N  V   DH+CPW  N +GL+     H  F + I 
Sbjct: 464 KFDTKNFCIETWARKPLRSRFSSLNNAVVARFDHYCPWIFNDVGLK----NHKGFMFFIT 519

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +    KP R+      N  V   DH+CPW  N +GL+     H  F + I 
Sbjct: 465 KFDTKNFCIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLK----NHKAFIFFIT 520

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C+ C++ K  RTHH  +   CV   DH+C W    LG
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLG 164

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           +C+ C++ K ERTHH      CV   DH+C W    +G
Sbjct: 136 WCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIG 173

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ 118
           +++ +N+C +  T KP R+ +    N  V   DH CPW  N +GL+
Sbjct: 467 KFDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLK 512

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           P K ++     +  +C+ CE  K  R+HH    N C+   DH+C W    +G
Sbjct: 104 PAKLYQCDSNGYPRWCSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIG 155

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 22/44 (50%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAP 122
           +C+ C++ K ER+HH      C+   DH+C W    +G     P
Sbjct: 130 WCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRP 173

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 13/89 (14%)

Query: 43  FQVSLSMIWISYWKAIYKNPGRPT---------KGFRPL----RYEWQNYCTKCETYKPE 89
           F VS+  +   ++K I  NPGR           K  + L    +++ +++C +    KP 
Sbjct: 418 FGVSIIGVIYEFYKLIRSNPGRKNRNHDMESVRKTIQTLMELGKFDIRHFCLETWVRKPL 477

Query: 90  RTHHCKRCNQCVLVMDHHCPWTMNCLGLQ 118
           R+         V   DH+CPW  N +GL+
Sbjct: 478 RSKFSYLNQSVVNRYDHYCPWVYNDIGLR 506

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           C+ C++ K ERTHH      CV   DH+C W    +G
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVG 163

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 67/165 (40%), Gaps = 25/165 (15%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +N+C +    KP R+         V   DH CPW  N +GL+     H +F +   
Sbjct: 438 KFDRENFCVETLERKPLRSKFSPFSGALVARYDHFCPWVYNDIGLK----NHKLFLFFAL 493

Query: 133 TTG--------ILLHYFVKRIKFTW--VNRYATANLVSKQELIFLTILTPLDAFILLTIS 182
           T          + L YF KR    +  V+ YA   L   + L   +   P   F+ + +S
Sbjct: 494 TVQYHMFLFMWLCLAYF-KRTNHIYEQVDGYARCALFKNETLCKGSNYDPSTFFLFIWVS 552

Query: 183 --------LLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLP 219
                   +L V+C   QI+ G T  E + + + E       L+P
Sbjct: 553 VNFLWLGAMLIVQCF--QILKGITVPELFILIKEERRAKSFSLIP 595

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           +C+ C++ K ER HH      CV   DH C W    +G
Sbjct: 126 WCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIG 163

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 38/88 (43%), Gaps = 13/88 (14%)

Query: 43  FQVSLSMIWISYWKAIYKNPGRPTKG--FRPLR-----------YEWQNYCTKCETYKPE 89
           F V L++    +   +  +PGR TK     P+R           ++ +++C      KP 
Sbjct: 404 FFVFLTVCLGLFGSLVLSDPGRITKEQELEPVRIAIKELLRIGKFDTRHFCVDTYKRKPL 463

Query: 90  RTHHCKRCNQCVLVMDHHCPWTMNCLGL 117
           R+   +     ++  DH CPW  N +GL
Sbjct: 464 RSKFSRFNEALIVRFDHFCPWIYNDVGL 491

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +Y+ +++C +    KP R+         +   DH+CPW  N +GL+     H  F + +A
Sbjct: 455 KYDTRHFCIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLK----NHKRFLYFVA 510

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 13/123 (10%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ--------YLAPQH 124
           +++ +N+C +    K  R+ +       V   DH+CPW  N +GL+         +  Q+
Sbjct: 435 KFDKENFCVETLERKSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMTVQY 494

Query: 125 SIFCWIIATTGILLHYFVKRIK-FTWVNRYATANLVSKQELIFLTILTPLDAFILLTISL 183
            +F ++  +    L YF K    +  V+ YA    +  + L   +   P   F+ + IS+
Sbjct: 495 HMFLFMWLS----LAYFKKTNHIYEQVDEYAKCTFLKNETLCKGSNYDPSTFFLFIWISV 550

Query: 184 LFV 186
            FV
Sbjct: 551 NFV 553

>Kpol_1062.50 s1062 complement(108109..108615) [507 bp, 168 aa] {ON}
           complement(108109..108615) [507 nt, 169 aa]
          Length = 168

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 234 EGQEKEVEEFLSSSTCSFDEVINFPYDINPWVNL-LNCMGSPLNWLNPFGGPKADGMVFQ 292
           E Q KE+E+  SS T + +E+IN  Y I+  +N+ L  +   ++  N     K + M+ Q
Sbjct: 74  ETQIKELEDLQSSKTFTLEELINHLYSIDQILNIKLKNLDDEISE-NTVKFKKLNDMILQ 132

Query: 293 -KNEISDYDEATSIQDKL 309
             N+ SD + +  I D L
Sbjct: 133 SNNDTSDGNSSADITDTL 150

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 4/61 (6%)

Query: 69  FRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFC 128
            R  +Y+ +++C       P R  + +  +  +L  DH+CPW  N +G +     H IF 
Sbjct: 437 LRVGKYDSKHFCIHSWIRLPLRAKYKRFVHSVILRYDHYCPWIYNYIGFR----NHKIFI 492

Query: 129 W 129
           +
Sbjct: 493 Y 493

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 255 INFPYDINPWVNLLNCMGSPLNWLNPFGGPKADGMVFQKNEISDYDEATSIQDK 308
           I FP D +P + + NC+  P  WLN   GP  D +  Q+ +  +++   S  +K
Sbjct: 282 IGFPKDEHPII-VPNCVAVPKKWLNLGNGPNEDNISLQREQSDEFENIKSEMEK 334

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116
           +C+ C++ K  RTHH      CV  +DH+C W    +G
Sbjct: 121 WCSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIG 158

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 4/71 (5%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIA 132
           +++ +++C      KP R+         V   DH CPW  N +GL+     H  F + I 
Sbjct: 445 KFDAKHFCISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLR----NHKTFLFFIL 500

Query: 133 TTGILLHYFVK 143
                +  F+K
Sbjct: 501 CLETCIFVFLK 511

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 79  YCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQ 118
           +C+ C++ K  RT H      CV   DH+C W    +G +
Sbjct: 115 WCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFK 154

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 4/75 (5%)

Query: 69  FRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFC 128
            R  +++ +++C       P R+ +    N  +   DH+CPW  N +G       H IF 
Sbjct: 445 LRIGKFDAKHFCIHSWVRIPLRSKYKTARNVLIARYDHYCPWVYNQIGF----CNHKIFL 500

Query: 129 WIIATTGILLHYFVK 143
           + I    I +  FV+
Sbjct: 501 FFIMFLQIGVFIFVR 515

>TBLA0A07500 Chr1 complement(1856643..1859009) [2367 bp, 788 aa]
           {ON} Anc_1.29 YCL045C
          Length = 788

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 53/111 (47%), Gaps = 13/111 (11%)

Query: 75  EWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCL-----GLQYLAPQHSIFCW 129
           E++N+ T C  + P+  H+ K  +  +L ++         L      +++L+  +S    
Sbjct: 149 EFENFKTSCTEFDPKLQHNIKIIDNEILFVEDAKDTLRITLPPKFQKIEFLSTDNSTNLK 208

Query: 130 IIATTGILLHYFVK----RIKFTWVNRYATANLVSKQELIFLTIL-TPLDA 175
           ++A T   ++Y+      ++K TW    + AN+V   + +F+ I  T LD+
Sbjct: 209 VLAATEGEIYYYYSIVDNKLKTTWTKDESIANIV---DYVFIDIKSTSLDS 256

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 45/113 (39%), Gaps = 21/113 (18%)

Query: 43  FQVSLSMIWISYWKAIYKNPG-------------RPTKGFRPLRYEWQNYCTKCETYKPE 89
           F V  +++ + Y + I+ +PG                K  +   +    +C K    KP 
Sbjct: 355 FPVLSTLLLLCYGRLIFSDPGCIPEETDTDLIRNDIEKLIKLGSFNCHTFCLKTWIRKPV 414

Query: 90  RTHHCKRCNQCVLVMDHHCPWTMNCLGLQYLAPQHSIFCWIIATTGILLHYFV 142
           R    K   Q V   DH+C W  N +GL+     H ++ + +    ILL  F+
Sbjct: 415 RCSLSKLNQQQVARFDHYCAWIYNDVGLK----NHKLYIFFL----ILLETFL 459

>SAKL0H01320g Chr8 (141328..141885) [558 bp, 185 aa] {ON} some
          similarities with uniprot|P40325 YGR268C Saccharomyces
          cerevisiae HUA1 uncharacterized ORF
          Length = 185

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 63 GRPTKGFRPLRYEWQNYCTKCET--YKPERTHHCKRC 97
          G+PT+   P  Y    YCTKC    YK +  H CK+C
Sbjct: 61 GKPTRPKLPWTYPKGYYCTKCGNTGYKIKNGHSCKKC 97

>KAFR0F00440 Chr6 (100249..101208) [960 bp, 319 aa] {ON} Anc_2.84
           YHR144C
          Length = 319

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 3/81 (3%)

Query: 32  TNFLSFKELLWFQVSLSMIWISYWKAIY-KNPGRPTKGFRPLRYEWQNYCTKCETYKPER 90
           TN     E++  +  LSMI  S    +  K    P +   PLR +W  Y  K  T    R
Sbjct: 127 TNAGDLNEMI--RSKLSMIINSQLDILRNKKKDNPEEINAPLRPDWDTYFMKLATLAASR 184

Query: 91  THHCKRCNQCVLVMDHHCPWT 111
           ++  KR   CV+V D+    T
Sbjct: 185 SNCMKRRVGCVIVRDNRVIAT 205

>NCAS0D00460 Chr4 (71070..72020) [951 bp, 316 aa] {ON} Anc_2.84
           YHR144C
          Length = 316

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWT 111
           P +   PLR +W  Y  K  T    R++  KR   CV+V DH    T
Sbjct: 156 PFENVPPLRPDWDTYFMKLATLAASRSNCMKRKVGCVIVRDHRVIAT 202

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 11/45 (24%), Positives = 22/45 (48%)

Query: 73  RYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLGL 117
           +++ +++C       P R+ + +     +   DH CPW  N +GL
Sbjct: 461 KFDAKHFCVHTWIRIPLRSKYDRDSACLISAFDHFCPWVYNQIGL 505

>NDAI0G02790 Chr7 (649288..650244) [957 bp, 318 aa] {ON} Anc_2.84
           YHR144C
          Length = 318

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 21/47 (44%)

Query: 65  PTKGFRPLRYEWQNYCTKCETYKPERTHHCKRCNQCVLVMDHHCPWT 111
           P +   PLR  W  Y  K  T    R++  KR   CV+V DH    T
Sbjct: 158 PFENVPPLRPSWDTYFMKLATLAATRSNCMKRKVGCVIVRDHRVIAT 204

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.473 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,719,215
Number of extensions: 1901080
Number of successful extensions: 5927
Number of sequences better than 10.0: 144
Number of HSP's gapped: 5968
Number of HSP's successfully gapped: 144
Length of query: 375
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 264
Effective length of database: 40,753,473
Effective search space: 10758916872
Effective search space used: 10758916872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)