Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ACL002C6.27ON32932915880.0
Ecym_30316.27ON3282729151e-123
CAGL0E02519g6.27ON3153079111e-122
NCAS0H015106.27ON3133289111e-122
KNAG0M012406.27ON3142709041e-121
NDAI0F017406.27ON3132758991e-120
Kpol_1032.96.27ON3182738951e-120
TDEL0G044206.27ON3223218921e-119
KAFR0G026506.27ON3212748851e-118
SAKL0E01474g6.27ON3112768781e-117
ZYRO0C07612g6.27ON3192748781e-117
Kwal_56.224546.27ON3153198651e-115
KLTH0C11044g6.27ON3152708591e-114
TBLA0E030606.27ON3192728551e-113
KLLA0D01331g6.27ON3082698441e-112
TPHA0M002906.27ON3273068331e-110
Smik_15.1686.27ON3272758161e-108
YOL002C (IZH2)6.27ON3172728131e-107
Skud_15.1606.27ON3272738121e-107
Suva_15.1736.27ON3272707981e-105
SAKL0C09218g3.90ON3142757175e-93
KLTH0C09504g3.90ON3192767151e-92
Skud_4.7663.90ON3162726891e-88
Kwal_56.227043.90ON3202766872e-88
YDR492W (IZH1)3.90ON3162726776e-87
Smik_4.7693.90ON3162726752e-86
Suva_2.6683.90ON3152696723e-86
CAGL0G04631g3.90ON3162736551e-83
TPHA0A006403.90ON3273096464e-82
Kpol_1053.263.90ON3243136301e-79
TBLA0B022903.90ON3262746301e-79
ZYRO0B06556g3.90ON3182826264e-79
KLLA0C12441g3.90ON3152776185e-78
AFR337W3.90ON3172846142e-77
TDEL0D053403.90ON3162716107e-77
KAFR0A081303.90ON3192756073e-76
Ecym_35883.90ON3052745872e-73
NDAI0A071603.90ON3302995822e-72
NCAS0I025703.90ON3142745752e-71
KNAG0K021603.90ON3233235594e-69
TBLA0B082553.90ON2962844487e-53
NCAS0C049203.90ON3262723252e-34
NDAI0G043003.90ON3182712884e-29
CAGL0I07491g3.90ON3012882322e-21
Skud_15.533.90ON3122811812e-14
KAFR0J006705.197ON5092321833e-14
Suva_15.643.90ON3122771785e-14
Smik_15.563.90ON3122131662e-12
YOL101C (IZH4)3.90ON3122121662e-12
KLLA0F15510g5.197ON6222821622e-11
Kpol_2002.945.197ON5772371496e-10
KLTH0B03498g5.197ON5462371452e-09
NCAS0D026005.197ON5432371443e-09
NDAI0I023305.197ON5782361408e-09
Kwal_33.151225.197ON5662371363e-08
TPHA0E031205.197ON5692381354e-08
KNAG0B051005.197ON5382351336e-08
AAL153C5.197ON4193101326e-08
YLR023C (IZH3)5.197ON5432381292e-07
Skud_12.915.197ON5422431273e-07
TBLA0C060505.197ON4372451255e-07
Smik_12.865.197ON5422341212e-06
Suva_10.1045.197ON5412381113e-05
Ecym_71095.197ON5683161104e-05
KNAG0K006703.90ON3212181077e-05
ZYRO0B10538g5.197ON5312371061e-04
CAGL0D03322g5.197ON545234990.001
TDEL0E043205.197ON450313980.001
SAKL0G12980g5.197ON563151940.004
KLLA0F19888g8.295ON491546678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ACL002C
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON} Sy...   616   0.0  
Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to A...   357   e-123
CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {O...   355   e-122
NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON...   355   e-122
KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.2...   352   e-121
NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27      350   e-120
Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON} (22700..2...   349   e-120
TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON...   348   e-119
KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON...   345   e-118
SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar...   342   e-117
ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {O...   342   e-117
Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C...   337   e-115
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...   335   e-114
TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27...   333   e-113
KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar...   329   e-112
TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27 ...   325   e-110
Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {O...   318   e-108
YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}  ...   317   e-107
Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {O...   317   e-107
Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {O...   311   e-105
SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar...   280   5e-93
KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {O...   280   1e-92
Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W...   270   1e-88
Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W...   269   2e-88
YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membr...   265   6e-87
Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W...   264   2e-86
Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W...   263   3e-86
CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar...   256   1e-83
TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON...   253   4e-82
Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON...   247   1e-79
TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON...   247   1e-79
ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar...   245   4e-79
KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa] ...   242   5e-78
AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic h...   241   2e-77
TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90...   239   7e-77
KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3....   238   3e-76
Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar ...   230   2e-73
NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {...   228   2e-72
NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON...   226   2e-71
KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.9...   219   4e-69
TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}             177   7e-53
NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {...   129   2e-34
NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90    115   4e-29
CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {O...    94   2e-21
Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON} ...    74   2e-14
KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5....    75   3e-14
Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON...    73   5e-14
Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON} ...    69   2e-12
YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}  ...    69   2e-12
KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some...    67   2e-11
Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON} (2295...    62   6e-10
KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {...    60   2e-09
NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.1...    60   3e-09
NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197     59   8e-09
Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023...    57   3e-08
TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {O...    57   4e-08
KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.1...    56   6e-08
AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON} Syn...    55   6e-08
YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON} ...    54   2e-07
Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {O...    54   3e-07
TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON} Anc_5...    53   5e-07
Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {O...    51   2e-06
Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {...    47   3e-05
Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}...    47   4e-05
KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {O...    46   7e-05
ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {...    45   1e-04
CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {...    43   0.001
TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {O...    42   0.001
SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]...    41   0.004
KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 a...    30   8.9  

>ACL002C Chr3 complement(353449..354438) [990 bp, 329 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL002C
          Length = 329

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/329 (91%), Positives = 301/329 (91%)

Query: 1   MNDSDLKQRVKFVAPENDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPD 60
           MNDSDLKQRVKFVAPENDTASSYSTKETTFLQDGTV           EVSSLCSWDDLPD
Sbjct: 1   MNDSDLKQRVKFVAPENDTASSYSTKETTFLQDGTVAAAITATRAIREVSSLCSWDDLPD 60

Query: 61  WQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADY 120
           WQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADY
Sbjct: 61  WQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADY 120

Query: 121 STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMIS 180
           STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMIS
Sbjct: 121 STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMIS 180

Query: 181 QMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPV 240
           QMYYGFYDSTAMFSLF                 PHFRSREWRKYRAAIFTAFGLSGLLPV
Sbjct: 181 QMYYGFYDSTAMFSLFSTVTLSLALACAVVSLSPHFRSREWRKYRAAIFTAFGLSGLLPV 240

Query: 241 ITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHV 300
           ITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHV
Sbjct: 241 ITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHV 300

Query: 301 LVVIAALCHLRALLSCYKNVHTNALFVSL 329
           LVVIAALCHLRALLSCYKNVHTNALFVSL
Sbjct: 301 LVVIAALCHLRALLSCYKNVHTNALFVSL 329

>Ecym_3031 Chr3 (61592..62578) [987 bp, 328 aa] {ON} similar to
           Ashbya gossypii ACL002C
          Length = 328

 Score =  357 bits (915), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 163/272 (59%), Positives = 200/272 (73%)

Query: 50  SSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFI 109
           S L SW ++P+WQ+DNEHIL GYV+ETNS+++T  SL YLHNESVNIY+HLIPG+CF  +
Sbjct: 46  SKLFSWHEIPEWQRDNEHILGGYVKETNSFKETLHSLLYLHNESVNIYTHLIPGVCFFCV 105

Query: 110 ALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIG 169
              NKYV++ + TTTWKDY +ID F +GA  CL +SG YHC+KSHS  VS+ GN+LDYIG
Sbjct: 106 LFLNKYVISRFKTTTWKDYAIIDTFFVGAFACLVMSGTYHCLKSHSYPVSIVGNQLDYIG 165

Query: 170 IVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
           IV LIS SM S +YYGFY+S+ MF  F                   FRSR WR YRA+IF
Sbjct: 166 IVILISTSMFSLLYYGFYNSSKMFYGFSGVTLLLGTICTVVTLDSRFRSRLWRPYRASIF 225

Query: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFD 289
            AFGLS +LP++ S  YYG  E ++ +QL W+ LEGVLYI GA +YG+RFPE + PGSFD
Sbjct: 226 VAFGLSSILPILASILYYGSEETWNSVQLGWIILEGVLYIFGAFIYGIRFPESMAPGSFD 285

Query: 290 IWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321
           IWGHSHQLFHVLVVIAALCH +A+   Y+ VH
Sbjct: 286 IWGHSHQLFHVLVVIAALCHFKAVTQSYELVH 317

>CAGL0E02519g Chr5 complement(242867..243814) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002c
          Length = 315

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 211/307 (68%), Gaps = 6/307 (1%)

Query: 16  ENDTASSYSTKETTFL-QDGTVXXXXXXXXXXXEVSSLCSWDDLPDWQKDNEHILSGYVR 74
           +   A+  +T+E   +  DG +            V  L +W+++P+WQKDNEHI +GYVR
Sbjct: 6   QRKVATMVTTEEQPLIGTDGQIKLRKKTV-----VRKLYTWEEIPEWQKDNEHIHTGYVR 60

Query: 75  ETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWKDYLMIDIF 134
           ET+S  +  RSLFYLHNE+VNIYSHLIP I F     FNKYVV  YSTTT  DYL+IDIF
Sbjct: 61  ETSSVMECIRSLFYLHNETVNIYSHLIPAIAFFSTIFFNKYVVPTYSTTTLIDYLIIDIF 120

Query: 135 LLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFS 194
            LGA  CL LS  +HC+KSHSL V+VFGNKLDY+GIV LI  SM+S +YYGF+ +   F 
Sbjct: 121 FLGAFSCLILSSTFHCLKSHSLRVAVFGNKLDYLGIVFLIVASMVSILYYGFHGNPWFFG 180

Query: 195 LFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYS 254
           +F                   FRSREWR YRAA+F  FGLS +LP++   F YGP E ++
Sbjct: 181 IFSLITMTFGAACAVVSLKDTFRSREWRPYRAALFVIFGLSAVLPILAGLFKYGPTETWT 240

Query: 255 RIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALL 314
           RIQLKW+ LEGV YI GA LYG+RFPEK+ PGSFD+WGHSHQ+FH+LVV+AALCHL+ALL
Sbjct: 241 RIQLKWVILEGVFYIFGAFLYGIRFPEKMSPGSFDLWGHSHQIFHILVVVAALCHLKALL 300

Query: 315 SCYKNVH 321
             Y  VH
Sbjct: 301 GSYSLVH 307

>NCAS0H01510 Chr8 complement(287981..288922) [942 bp, 313 aa] {ON}
           Anc_6.27
          Length = 313

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/328 (51%), Positives = 218/328 (66%), Gaps = 26/328 (7%)

Query: 4   SDLKQRVKFVAP--------ENDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSW 55
            +L+QRV   +         ++D  S   TK+TT                   +  L +W
Sbjct: 3   KNLQQRVALTSTSTSTKTTIDDDNVSIKHTKKTT------------------TIRKLYTW 44

Query: 56  DDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKY 115
           D++P+WQKDNEHI++GYVRETNS+R+ F SLFY+HNE+ N+YSHL+PG+ F    LF+KY
Sbjct: 45  DEIPEWQKDNEHIIAGYVRETNSFRRCFDSLFYIHNETGNVYSHLVPGVVFFLTMLFDKY 104

Query: 116 VVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALIS 175
            +  + TTT+ DYL+I++F LGA  CL LS  +HC KSHSL+++ FGNKLDY+GIV LI 
Sbjct: 105 AIVSFETTTFTDYLIINLFFLGAFTCLILSSTFHCFKSHSLKIATFGNKLDYLGIVVLIV 164

Query: 176 CSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLS 235
            SMIS ++YGFYD+   F  F                   FRSREWR YRA +F AFGLS
Sbjct: 165 TSMISILFYGFYDNGPFFYGFSLLTLSFGSACAIVSLKDKFRSREWRPYRAGLFVAFGLS 224

Query: 236 GLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSH 295
            +LP++T   YYGP E ++RIQLKW+ LEGV YI GA LYG+RFPEK   G+FDIWGHSH
Sbjct: 225 AVLPILTGVMYYGPHETWTRIQLKWVVLEGVFYIFGAFLYGIRFPEKYVNGTFDIWGHSH 284

Query: 296 QLFHVLVVIAALCHLRALLSCYKNVHTN 323
           Q+FH+LVV+AA CHL+ALL  Y+ VH N
Sbjct: 285 QIFHLLVVVAAFCHLKALLGSYELVHMN 312

>KNAG0M01240 Chr13 (226766..227710) [945 bp, 314 aa] {ON} Anc_6.27
           YOL002C
          Length = 314

 Score =  352 bits (904), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 161/270 (59%), Positives = 196/270 (72%)

Query: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFN 113
           +W+++P+WQKDNEHI+ GYVRETNS+ K   SLFYLHNESVN+YSHLIP +CF  +   N
Sbjct: 38  TWNEIPEWQKDNEHIIDGYVRETNSFLKCVHSLFYLHNESVNVYSHLIPALCFFSVLFLN 97

Query: 114 KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVAL 173
           KY V  + TT+  DYL ID+F LGA  CL LS  +HC KSHSL+V+ FGNKLDY+GIV L
Sbjct: 98  KYCVKSFETTSLVDYLFIDLFFLGAFTCLILSSTFHCFKSHSLKVATFGNKLDYLGIVVL 157

Query: 174 ISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFG 233
           I  SMIS +YYGFYDS+ MF  F                  HFRSREWR YRA +F AFG
Sbjct: 158 IVTSMISILYYGFYDSSVMFYFFSFVTLSFGTACGVVSLKDHFRSREWRPYRAGLFVAFG 217

Query: 234 LSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGH 293
           LS +LP+++  F YG  EA+ RIQ+KW+ LEGV YI GA LYG+RFPEK  PG +DIWGH
Sbjct: 218 LSAILPILSGMFAYGIEEAFHRIQIKWIILEGVFYILGAFLYGIRFPEKGSPGKYDIWGH 277

Query: 294 SHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           SHQ+FH+LVV+AALCHL+ L+  Y+ VH  
Sbjct: 278 SHQVFHILVVVAALCHLKGLMVSYELVHKG 307

>NDAI0F01740 Chr6 (429141..430082) [942 bp, 313 aa] {ON} Anc_6.27
          Length = 313

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 164/275 (59%), Positives = 197/275 (71%)

Query: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLF 108
           V  L  WD++P+WQKDNEHI+SGYVRETNS++    SLFY+HNES N+YSHL+PG+ F F
Sbjct: 38  VYKLYRWDEIPEWQKDNEHIISGYVRETNSFKGCLHSLFYVHNESGNVYSHLLPGVFFFF 97

Query: 109 IALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168
             + NKY +  YSTT+  DYLMID+F  GA  CL LS ++HC KSHSL+V+  GNKLDY+
Sbjct: 98  TMVLNKYGITIYSTTSIVDYLMIDLFFFGAFCCLILSSLFHCFKSHSLKVATLGNKLDYL 157

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GIV LI  SMIS MY+GF+D+   F  F                  HFRSREWR YRA +
Sbjct: 158 GIVILIVTSMISIMYFGFFDNPLFFYFFSSLTFLFGGACATVSLKDHFRSREWRPYRAGL 217

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288
           F AFGLS +LP++   FYYG  E + RIQLKW+ LEG  YI GA LYGVRFPEK  PGSF
Sbjct: 218 FVAFGLSAILPILAGTFYYGIEETFIRIQLKWIILEGFFYIFGAFLYGVRFPEKYVPGSF 277

Query: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           DIWGHSHQ+FH+LVV+AA CHLR LLS Y+ VH+ 
Sbjct: 278 DIWGHSHQIFHILVVVAAFCHLRGLLSSYEIVHSR 312

>Kpol_1032.9 s1032 (22700..23656) [957 bp, 318 aa] {ON}
           (22700..23656) [957 nt, 319 aa]
          Length = 318

 Score =  349 bits (895), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 163/273 (59%), Positives = 196/273 (71%)

Query: 51  SLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIA 110
            L +W+ LPDWQKDNEHILSGYV+ETNS +    SL ++HNESVNI+SHL+P  CF+   
Sbjct: 40  QLVTWEHLPDWQKDNEHILSGYVKETNSIKACLHSLLFIHNESVNIFSHLVPAFCFMTTI 99

Query: 111 LFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGI 170
           +F+KYVV  Y TTT KDYLM+D+FL GA  CL +S  +HC+K+HS  VS FGNKLDY+GI
Sbjct: 100 IFDKYVVERYPTTTLKDYLMLDLFLFGAFTCLMMSSAFHCLKAHSPYVSSFGNKLDYLGI 159

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
           V LI  SM S +YYGFYD++ ++  F                   FR+REWR YRAA+F 
Sbjct: 160 VVLIVSSMSSILYYGFYDNSFLYFTFSAITFTFGLSCAVVSLGERFRAREWRPYRAAMFV 219

Query: 231 AFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDI 290
           AFGLS LLP+     YYG  E   R+QLKW+ LEGV YI GA+LYGVRFPE+L+PG FDI
Sbjct: 220 AFGLSALLPIFAGFLYYGVQETTIRVQLKWVVLEGVFYIFGALLYGVRFPERLKPGMFDI 279

Query: 291 WGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           WGHSHQLFH+LVV+AALCHLR LL  Y  VHT 
Sbjct: 280 WGHSHQLFHILVVVAALCHLRGLLGSYTIVHTR 312

>TDEL0G04420 Chr7 complement(802412..803380) [969 bp, 322 aa] {ON}
           Anc_6.27 YOL002C
          Length = 322

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 172/321 (53%), Positives = 219/321 (68%), Gaps = 7/321 (2%)

Query: 1   MNDSDLKQRVKFVAPENDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPD 60
           M+DS LK+R +  +   D  S+ + +ET+    G             +   L +WD++P 
Sbjct: 1   MSDS-LKKRSQ-CSLTTDQTSTVTKEETSGPVKGQ-----KTDKMSKKKRKLYTWDEIPH 53

Query: 61  WQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADY 120
           WQ+DNEHILSGYV ET S  + F SLFYLHNESVNIY+HL+PGI FLF+  F+K+ V  +
Sbjct: 54  WQRDNEHILSGYVGETRSMFQCFLSLFYLHNESVNIYTHLLPGIAFLFVLCFDKFAVTQF 113

Query: 121 STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMIS 180
            TTT  DY+MID+F L +  CLTLS ++HC+K+HS  V+ FGNKLDY+GIV L+  SM+S
Sbjct: 114 ETTTLIDYVMIDLFSLVSFTCLTLSSIFHCLKNHSRSVATFGNKLDYLGIVVLVVTSMVS 173

Query: 181 QMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPV 240
            MYYGF+++ A+F LF                   FR+REWR YRAA+F AFGLS +LP+
Sbjct: 174 IMYYGFFETPALFYLFSFITCTFGAACAVVSLKEGFRTREWRPYRAAMFVAFGLSAVLPI 233

Query: 241 ITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHV 300
           +T  FYYG  E Y RIQ+KW+ L G+ YI+GAVLYGVRFPEK  PG +DIWGHSHQLFHV
Sbjct: 234 VTGIFYYGFSEIYLRIQVKWVLLGGIFYITGAVLYGVRFPEKYAPGKYDIWGHSHQLFHV 293

Query: 301 LVVIAALCHLRALLSCYKNVH 321
           LVV+AALCHL  L+  Y  VH
Sbjct: 294 LVVVAALCHLYGLIKSYNLVH 314

>KAFR0G02650 Chr7 complement(547561..548526) [966 bp, 321 aa] {ON}
           Anc_6.27 YOL002C
          Length = 321

 Score =  345 bits (885), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/274 (58%), Positives = 198/274 (72%)

Query: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL 107
           ++  L +W+++PDWQKDNEHI+SGYV+ETNS+     SLFYLHNESVN+YSHLIP +CFL
Sbjct: 36  KIIQLYNWNEIPDWQKDNEHIISGYVKETNSFFSCIESLFYLHNESVNVYSHLIPAVCFL 95

Query: 108 FIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDY 167
             +L NK +V  + TTT  DYL ID+F LGA  CL LS  +HC KSHSL ++ FGNKLDY
Sbjct: 96  MTSLLNKTIVPKFRTTTVLDYLYIDLFFLGAFTCLILSSTFHCFKSHSLRIATFGNKLDY 155

Query: 168 IGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAA 227
           +GIV LIS SMIS +YYGFYD+ ++F +F                   FRSRE R YRA 
Sbjct: 156 LGIVVLISTSMISLLYYGFYDTPSLFYVFAFITLSFGLACATVSLKDKFRSRECRAYRAT 215

Query: 228 IFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGS 287
           +F  FGLS +LPVI   ++YG    + RIQLKW+ LEGV YI GA LYG+RFPEK  PG 
Sbjct: 216 LFVCFGLSAVLPVICGLYHYGFYNTWHRIQLKWVLLEGVFYIFGAFLYGIRFPEKYTPGK 275

Query: 288 FDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321
           +DIWGHSHQLFH+LVVIAALCH +AL+  Y++VH
Sbjct: 276 YDIWGHSHQLFHILVVIAALCHFKALMCSYEHVH 309

>SAKL0E01474g Chr5 (112382..113317) [936 bp, 311 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 311

 Score =  342 bits (878), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 156/276 (56%), Positives = 199/276 (72%)

Query: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL 107
            V  L SW+++PDWQKDNEHI  GYVRETNS+   F SLFY+HNESVNIY+HL+PG+CF 
Sbjct: 32  RVRRLYSWEEIPDWQKDNEHIRHGYVRETNSFLGCFDSLFYMHNESVNIYTHLLPGLCFF 91

Query: 108 FIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDY 167
           F+ LF+K  +  + TTT+ DY+M+D+F LGA  CL LS  +HC+K+HSL +++ GNKLDY
Sbjct: 92  FVVLFDKVAIKVFDTTTFLDYIMVDLFFLGAFTCLILSSTFHCLKTHSLRIAILGNKLDY 151

Query: 168 IGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAA 227
           +GIVALI  SMIS MYYGF+DS   F  F                   FRSREWR YRAA
Sbjct: 152 LGIVALIVSSMISIMYYGFFDSGKFFYGFSTLTLVFGIACAIASLSDTFRSREWRPYRAA 211

Query: 228 IFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGS 287
           +F AFGLS +LP+ +    YG  E + ++Q+KW+ L GV YI GA+LY +R PE++ PG 
Sbjct: 212 LFVAFGLSAVLPIFSGVAVYGFKETWVKVQVKWVLLGGVFYIIGALLYALRLPERISPGK 271

Query: 288 FDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           FDIWGHSHQ+FH+LVVIAALCHL+A+L+ Y+ VH  
Sbjct: 272 FDIWGHSHQIFHILVVIAALCHLKAVLNSYELVHKK 307

>ZYRO0C07612g Chr3 complement(578864..579823) [960 bp, 319 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  342 bits (878), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 197/274 (71%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           L +W+++PDWQKDNEHI+ GYVRETNS R+  +SL YLHNES+NIY+H +PG+CFL   +
Sbjct: 42  LYTWNEIPDWQKDNEHIVGGYVRETNSIRECLQSLLYLHNESINIYTHFLPGLCFLATCI 101

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
           F+K+ + ++ TTTW DY+ ID F  GA  CL LS  +HC KSHS  VSVFGNKLDY+GIV
Sbjct: 102 FDKFAIKNFDTTTWIDYMAIDFFFFGAFSCLILSSTFHCFKSHSSRVSVFGNKLDYLGIV 161

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
            LI CSMIS +YY F+DS  +F  F                   FRSREWR YRA +F A
Sbjct: 162 ILIVCSMISILYYAFHDSNKLFYSFTLIIFCFGVSCTIASFDDTFRSREWRPYRAGLFVA 221

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FGLS LLP++     YG  E ++RIQ+KW+ LEG+ YI GA LY +RFPE+L PG+FD  
Sbjct: 222 FGLSALLPIMGGIIKYGFHETWTRIQMKWVILEGIFYIFGAFLYSIRFPERLAPGAFDFV 281

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTNAL 325
           GHSHQ+FHVLVVIAALCHL AL++ Y+ VHTN L
Sbjct: 282 GHSHQIFHVLVVIAALCHLVALMNSYELVHTNLL 315

>Kwal_56.22454 s56 (136175..137122) [948 bp, 315 aa] {ON} YOL002C -
           Hypothetical ORF [contig 185] FULL
          Length = 315

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 208/319 (65%), Gaps = 12/319 (3%)

Query: 7   KQRVKFVAPENDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPDWQKDNE 66
           K++   + PE        T+ETT L +G+                L  WD++P+WQKDNE
Sbjct: 8   KRKAVGIEPEG-----VMTEETTTLLNGSRIEERTR-------RRLYKWDEIPEWQKDNE 55

Query: 67  HILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWK 126
           HIL+GY+ ET S     +SL YLHNESVNIY+HLIPG CFL + LFN+  +  Y TT   
Sbjct: 56  HILNGYILETKSVGACLKSLLYLHNESVNIYTHLIPGWCFLLMTLFNQLAIERYETTRMI 115

Query: 127 DYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGF 186
           DY+MID+F LG   CL +S  +HC K HSL V+V GNKLDY+GIVAL+  SM+S ++YGF
Sbjct: 116 DYIMIDLFFLGGFTCLMMSSTFHCFKCHSLPVAVLGNKLDYLGIVALVVTSMVSILFYGF 175

Query: 187 YDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFY 246
           +D+   F +F                   FRSR+WR YRAA+F AFGLS L PVI    +
Sbjct: 176 HDNNLYFYVFSGLTIMFGLACTIVSLSDKFRSRDWRPYRAALFVAFGLSALFPVIAGICH 235

Query: 247 YGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAA 306
           YG    ++RIQLKW+ LEGV YI GA+LYGVRFPE++ PG+FDIWG SHQLFHVLVVIAA
Sbjct: 236 YGFKVTWTRIQLKWVFLEGVFYILGALLYGVRFPERVAPGTFDIWGQSHQLFHVLVVIAA 295

Query: 307 LCHLRALLSCYKNVHTNAL 325
            CHLRALL  YK VH+  L
Sbjct: 296 SCHLRALLGAYKWVHSQML 314

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  335 bits (859), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 195/270 (72%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           L +WD++P+WQ+DNEHI+ GY+ ET S  +  +SL YLHNESVNIY+HL+PG CFL +A+
Sbjct: 41  LYTWDEIPEWQRDNEHIVGGYILETKSTWECLKSLLYLHNESVNIYTHLLPGWCFLLVAV 100

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
           FN+ V+  + TT   DY+MID+F LG   CL +S V+HC K HSL V++ GNKLDY+GIV
Sbjct: 101 FNQVVIEKFETTRLIDYVMIDLFFLGGFTCLMMSSVFHCFKCHSLPVAILGNKLDYLGIV 160

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
           AL+  S++S ++YGF+D    F LF                   FRSREWR YRA++F A
Sbjct: 161 ALVVTSIVSILFYGFHDYDLYFWLFSGLTMAFGLACATVSLSNKFRSREWRPYRASLFVA 220

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FGLS LLPVI    +YG  E ++RIQL+W+ L GV YI GAVLYG+RFPE++ PG FDIW
Sbjct: 221 FGLSALLPVIAGALHYGLKETWTRIQLEWVLLGGVFYILGAVLYGIRFPERMAPGCFDIW 280

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVH 321
           GHSHQLFH+LVV+AALCHLRALL  YK  H
Sbjct: 281 GHSHQLFHILVVVAALCHLRALLGAYKLFH 310

>TBLA0E03060 Chr5 (769031..769990) [960 bp, 319 aa] {ON} Anc_6.27
           YOL002C
          Length = 319

 Score =  333 bits (855), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 157/272 (57%), Positives = 194/272 (71%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           L +WD++P WQ DNE+I +GYVRETNS +++F SLFY+HNESVNIY+HLIP  CFL + L
Sbjct: 39  LYTWDEIPVWQHDNEYIYTGYVRETNSMKESFLSLFYIHNESVNIYTHLIPAFCFLSMLL 98

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
           FN Y V  + TTT+ DY+ ID+F +GA  CL LS  +HC KSHSL++SVFGNKLDY+GIV
Sbjct: 99  FNTYGVKPHPTTTYGDYVAIDLFFIGAFTCLGLSSTFHCFKSHSLKISVFGNKLDYLGIV 158

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
            LIS S+IS +Y+G++D   +F +F                   FR+REWR YRAA+F  
Sbjct: 159 ILISTSLISVLYFGYHDDPFIFYIFSGITLCFGIACGIASLKDKFRTREWRPYRAALFVL 218

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FGLSG+LP+I     YG  E + R+QLKW+  EGVLYI GA LYG RFPEK  PG  DIW
Sbjct: 219 FGLSGVLPIIAGIMKYGIREVFERVQLKWIIWEGVLYIFGAFLYGARFPEKFMPGKVDIW 278

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           G SHQ+FHVLVVIAALCHLR L+  Y+ VH  
Sbjct: 279 GQSHQIFHVLVVIAALCHLRGLIGSYELVHQK 310

>KLLA0D01331g Chr4 (117469..118395) [927 bp, 308 aa] {ON} similar to
           uniprot|Q12442 Saccharomyces cerevisiae YOL002C IZH2
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family direct target of the Zap1p
           transcription factor expression induced by zinc
           deficiency and fatty acids deletion increases
           sensitivity to elevated zinc
          Length = 308

 Score =  329 bits (844), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/269 (57%), Positives = 191/269 (71%), Gaps = 1/269 (0%)

Query: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF- 112
           SWD++PDWQKDNEHIL GYVRET S+++ F SLFYLHNESVNIY+HLIP +   FI LF 
Sbjct: 35  SWDEIPDWQKDNEHILHGYVRETQSWKELFHSLFYLHNESVNIYTHLIPAVALFFIMLFA 94

Query: 113 NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVA 172
             +V+ +Y TT+  DY MI++F  G   CLT+S ++H +K HSL ++ FGNKLDY+GIV 
Sbjct: 95  THHVINEYPTTSAIDYFMINLFFFGCATCLTMSSMFHTIKCHSLPIATFGNKLDYLGIVV 154

Query: 173 LISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAF 232
           LIS SMIS ++YGF+DS+ +F  F                   FRSREWR YRA +F  F
Sbjct: 155 LISTSMISILFYGFHDSSLLFYPFAGLTSLFGLICGYMSLKDKFRSREWRPYRATMFVLF 214

Query: 233 GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWG 292
           GLS + P++     YG  E + R+QL W+  EGVLYI GA LYGVRFPE+L PG FDIWG
Sbjct: 215 GLSAVFPIVAGFIVYGKDETWKRVQLTWVIWEGVLYIFGAFLYGVRFPERLAPGKFDIWG 274

Query: 293 HSHQLFHVLVVIAALCHLRALLSCYKNVH 321
           HSHQLFHVLVV+AALCHL+AL+  Y  VH
Sbjct: 275 HSHQLFHVLVVVAALCHLKALVVSYGLVH 303

>TPHA0M00290 Chr13 (57784..58767) [984 bp, 327 aa] {ON} Anc_6.27
           YOL002C
          Length = 327

 Score =  325 bits (833), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/306 (50%), Positives = 201/306 (65%), Gaps = 3/306 (0%)

Query: 19  TASSYSTKETTFLQDGTVXXXXXXXXX---XXEVSSLCSWDDLPDWQKDNEHILSGYVRE 75
           ++S+ + +E T   DG                ++ ++  WDDLPDWQKDNEHI  GYV+E
Sbjct: 17  SSSAVTEEEYTIANDGVKSNKKLVKIIGRFTRQLITITHWDDLPDWQKDNEHIHEGYVKE 76

Query: 76  TNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYVVADYSTTTWKDYLMIDIFL 135
           TNS+   F SLF+LHNESVNIYSH++PG+C LF+ L +  ++  + TTT+ DY MID+FL
Sbjct: 77  TNSFINCFESLFFLHNESVNIYSHMVPGLCALFMLLIDINIIKKFPTTTFVDYFMIDLFL 136

Query: 136 LGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFSL 195
            GA  CL LS  +H +KSHSL V+++GNKLDY+GIV LI  SMIS +YYGFYD+   F L
Sbjct: 137 AGAFSCLILSSAFHTLKSHSLFVAIYGNKLDYLGIVILIVTSMISILYYGFYDTPYFFHL 196

Query: 196 FXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSR 255
           F                   FRSREWR YRA +F  FGLS + PV+T  +YYG  + + R
Sbjct: 197 FSTITILFGIACGTVSLANKFRSREWRPYRATLFVCFGLSAVFPVLTGIWYYGLEDTFKR 256

Query: 256 IQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALLS 315
           IQLKW+  EG  YI GA LY +R+PE++ PG+FD+WGHSHQ+FHV VVIAA  H   LLS
Sbjct: 257 IQLKWIVTEGFFYIFGAFLYAMRYPERICPGAFDLWGHSHQIFHVFVVIAAYSHFHGLLS 316

Query: 316 CYKNVH 321
            Y+  H
Sbjct: 317 AYEYAH 322

>Smik_15.168 Chr15 complement(290724..291707) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  318 bits (816), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 148/275 (53%), Positives = 195/275 (70%)

Query: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLF 108
           +  L SWD++P+WQ+DN+ IL GYVRET+S+ +TF+SLFYLHNESVNIYSHL+P + F  
Sbjct: 46  LKRLYSWDEIPEWQRDNDFILHGYVRETSSFIETFKSLFYLHNESVNIYSHLVPALGFFT 105

Query: 109 IALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168
           + L +K  +  + TTTWKD+++ID+F  GA  CL LS  +HC+KSHSL ++  GNKLDY+
Sbjct: 106 VLLLDKSTIKVFETTTWKDHVVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYL 165

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI  LI  SM+S ++YG+Y+  ++F LF                   FR REWR YRA +
Sbjct: 166 GICILIVTSMVSILFYGYYEKFSLFCLFALITVSFGVACSIVSLKDKFRKREWRPYRAGL 225

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288
           F  FGLS ++P+ +  + Y   E +++IQL W+ L GVLYI GAVLYG+RFPEK+ PG F
Sbjct: 226 FVCFGLSSIVPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKF 285

Query: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           DIWGHSHQLFH LVVIA+LCHLR LL+ Y+ VH  
Sbjct: 286 DIWGHSHQLFHFLVVIASLCHLRGLLNSYELVHIK 320

>YOL002C Chr15 complement(323411..324364) [954 bp, 317 aa] {ON}
           IZH2Plasma membrane protein involved in zinc homeostasis
           and osmotin-induced apoptosis; transcription regulated
           by Zap1p, zinc and fatty acid levels; similar to
           mammalian adiponectins; deletion increases sensitivity
           to elevated zinc
          Length = 317

 Score =  317 bits (813), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/272 (54%), Positives = 194/272 (71%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           L SWD++P+WQ+DN+ IL GYV+ET+S+ +TF+SLFYLHNESVNIYSHLIP + F  + L
Sbjct: 39  LYSWDEIPEWQRDNDFILHGYVKETSSFIETFKSLFYLHNESVNIYSHLIPALGFFTVLL 98

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
            +K  +  ++TTTW D+++ID+F  GA  CL LS  +HC+KSHSL ++  GNKLDY+GI 
Sbjct: 99  LDKSTIKVFATTTWLDHMVIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYLGIC 158

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
            LI  SM+S +YYG+++  ++F LF                   FR REWR YRA +F  
Sbjct: 159 ILIVTSMVSILYYGYFEKFSLFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVC 218

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FGLS ++P+ +  + Y   E +++IQL W+ L GVLYI GAVLYG+RFPEK+ PG FDIW
Sbjct: 219 FGLSSIIPIFSGLYCYSFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKICPGKFDIW 278

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           GHSHQLFH LVVIAALCHLR LL+ Y+ VH  
Sbjct: 279 GHSHQLFHFLVVIAALCHLRGLLNSYELVHIK 310

>Skud_15.160 Chr15 complement(283003..283986) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  317 bits (812), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 193/273 (70%)

Query: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLF 108
           +  L SWD++P+WQ+DN++IL GYVRET S+ +TF+SLFY+HNESVNIYSHLIP + F  
Sbjct: 46  LKRLYSWDEIPEWQRDNDYILHGYVRETCSFVETFKSLFYMHNESVNIYSHLIPALGFFT 105

Query: 109 IALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168
           + L +K  +  + TTTWKD+++ID+F  GA  CL LS  +HC+KSHSL ++  GNKLDY+
Sbjct: 106 VLLLDKSTIKVFETTTWKDHMIIDLFYSGAFACLILSSSFHCLKSHSLRIATLGNKLDYL 165

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI  LI  SM S +YYG+Y+  ++F LF                   FR REWR YRA +
Sbjct: 166 GICILIVTSMTSILYYGYYEKFSLFCLFALITVSFGIACSIVTLKDKFRKREWRPYRAGL 225

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288
           F  FGLS ++P+ +  + Y   E +++IQL W+ L GVLYI GAVLYG+RFPEK+ PG F
Sbjct: 226 FVCFGLSSIVPIFSGLYCYTFSEIWTQIQLFWVLLGGVLYIIGAVLYGMRFPEKVCPGKF 285

Query: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321
           DIWGHSHQLFH LVVIA+ CHLR LL+ Y+ VH
Sbjct: 286 DIWGHSHQLFHFLVVIASFCHLRGLLNSYELVH 318

>Suva_15.173 Chr15 complement(297915..298898) [984 bp, 327 aa] {ON}
           YOL002C (REAL)
          Length = 327

 Score =  311 bits (798), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 147/270 (54%), Positives = 191/270 (70%)

Query: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFN 113
           SWD++P+WQ+DN++IL GYV+ET+S+  TF+SLFY+HNESVNIYSHLIP + FL + L +
Sbjct: 51  SWDEIPEWQRDNDYILHGYVKETSSFVDTFKSLFYMHNESVNIYSHLIPAVGFLTVLLLD 110

Query: 114 KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVAL 173
           K  +  + TTTW D++MID+F  GA  CL LS  +HC KSHSL+++  GNKLDY+GI  L
Sbjct: 111 KTTITVFETTTWLDHMMIDLFFTGAFACLILSSSFHCFKSHSLKIATLGNKLDYLGICIL 170

Query: 174 ISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFG 233
           I  SM+S +YYG+YD    F LF                   FR REWR YRA +F  FG
Sbjct: 171 IVTSMVSILYYGYYDKFPAFCLFALITVSFGIACSIVSLKDKFRKREWRPYRAGLFVCFG 230

Query: 234 LSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGH 293
           LS ++P+ +  +YY   E +++IQL W+ L G LYI GAVLYG+RFPEK+ PG FDIWGH
Sbjct: 231 LSSIVPIFSGLYYYSFSEIWNQIQLFWVLLGGALYIIGAVLYGMRFPEKVYPGRFDIWGH 290

Query: 294 SHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           SHQLFH LVVIA+LCH+R +L+ Y+ VH  
Sbjct: 291 SHQLFHFLVVIASLCHMRGVLNSYELVHIK 320

>SAKL0C09218g Chr3 (839747..840691) [945 bp, 314 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 314

 Score =  280 bits (717), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 131/275 (47%), Positives = 183/275 (66%), Gaps = 2/275 (0%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           LC++++LPDWQKDNE IL GYVRET S  + F+SL Y HNE+VNIY+HL+PG+ +L + +
Sbjct: 31  LCTFEELPDWQKDNELILDGYVRETRSVSECFKSLLYFHNETVNIYTHLVPGVTYLLMLM 90

Query: 112 F--NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIG 169
           F  +  ++  + ++T  DY++I+ FLLGA VCL  S  +HC+K HS E S   +K+DY+G
Sbjct: 91  FLTDFILIPKFPSSTMTDYIIINFFLLGAFVCLMCSSCFHCLKQHSEEHSDIWSKVDYMG 150

Query: 170 IVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
           I+ LISCSM+S +YYGF+D    F +F                   F S+ +R +RA+ F
Sbjct: 151 IIVLISCSMVSILYYGFHDHLFHFKIFTVVTVILGSCCAAFVLNDRFNSKNFRVFRASFF 210

Query: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFD 289
            +FG SGL+P+I     +G  E+  R+QLK++ LE V YI GAV YG R PE   PG FD
Sbjct: 211 VSFGFSGLVPIIFGLVKFGISESVHRVQLKYVGLEAVFYIGGAVFYGFRIPENFGPGKFD 270

Query: 290 IWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTNA 324
           + GHSHQ+FHV+VV+ +LCHLRA++  Y  +HT  
Sbjct: 271 LVGHSHQIFHVMVVLGSLCHLRAVVGSYIFMHTGV 305

>KLTH0C09504g Chr3 complement(788442..789401) [960 bp, 319 aa] {ON}
           similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 319

 Score =  280 bits (715), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 180/276 (65%), Gaps = 2/276 (0%)

Query: 50  SSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFI 109
           + LC +++LPDWQ+DN+ IL+GYVRETNS +K F SL Y HNE+VNIY+HLIP   +L +
Sbjct: 32  NGLCCFEELPDWQRDNDKILAGYVRETNSMKKCFESLTYFHNETVNIYTHLIPSGTYLVM 91

Query: 110 ALF--NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDY 167
            +F  + +++  + TTT  DY+MI+ FLLGA +CL  S  +HC+K HS   S   +K+DY
Sbjct: 92  LMFFTDLFLIPQFPTTTMSDYIMINFFLLGAFLCLMCSTCFHCLKQHSEAQSNIWSKVDY 151

Query: 168 IGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAA 227
           +GI+ LISCS +S +YYGFYD    F +F                   F ++ WR  RA 
Sbjct: 152 MGIIVLISCSTVSLLYYGFYDYLFHFKMFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAG 211

Query: 228 IFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGS 287
            F  FG SG++P++     +G  E+  R+QL+++ LE + YISGAV+YG R PE L PG 
Sbjct: 212 FFVTFGFSGIVPIVVGLVKFGIAESSKRVQLRFVLLEALFYISGAVIYGFRIPETLLPGK 271

Query: 288 FDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           FD  GHSHQ+FH+LVV+ +LCH RALL  Y  +HT 
Sbjct: 272 FDFVGHSHQIFHILVVLGSLCHFRALLGSYFFMHTG 307

>Skud_4.766 Chr4 (1354630..1355580) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  270 bits (689), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 185/272 (68%), Gaps = 2/272 (0%)

Query: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGIC-FLF-IAL 111
           ++D+LP+WQKDN+ IL+GYVRET S++K  RSLFY +NE+VNIY+HL+P I  FLF I L
Sbjct: 42  NFDELPEWQKDNDKILTGYVRETLSWKKCLRSLFYWNNETVNIYTHLVPAIIYFLFAITL 101

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
            N +++  + +T+W DY +I+IFL+GA  CL  S  +HC+K HS E S F +KLDY+GI+
Sbjct: 102 TNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCLKQHSEEQSNFWSKLDYLGII 161

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
           +LISCSMI  +Y+G++D  + FSLF                   F +  +R +RA  F  
Sbjct: 162 SLISCSMIPIIYFGYFDHVSYFSLFTTVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFIL 221

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FG SGLLP+ T  F +G     +RI++ ++  E + YISGAV+YG R PE + PG FD  
Sbjct: 222 FGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETIAPGKFDFL 281

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           G SHQ+FH++VV+ +LCHL+A++  YK +H++
Sbjct: 282 GSSHQIFHIMVVLGSLCHLKAIIDSYKLMHSH 313

>Kwal_56.22704 s56 (244431..245393) [963 bp, 320 aa] {ON} YDR492W -
           Hypothetical ORF [contig 184] FULL
          Length = 320

 Score =  269 bits (687), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 177/276 (64%), Gaps = 2/276 (0%)

Query: 50  SSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFI 109
           S+LC +++LP+WQ+DNE IL+GYVRET S RK   SL Y HNE++NIY+HLIP   +L +
Sbjct: 33  SALCRFEELPEWQRDNEKILAGYVRETRSMRKCLESLTYFHNETLNIYTHLIPSGTYLVL 92

Query: 110 ALF--NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDY 167
            +F  + +++  + +TT  DY+MI+ +LLGA +CL  S  +HC+K HS   S   +K+DY
Sbjct: 93  LMFFTDVFLIPHFPSTTMSDYIMINFYLLGAFLCLLCSTCFHCLKQHSEAQSNIWSKVDY 152

Query: 168 IGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAA 227
           +GI+ LISCS +S +YYGF+D    F +F                   F ++ WR  RA 
Sbjct: 153 MGIIVLISCSTVSLLYYGFHDYLFHFKIFTIAVVVLGSCCAAFVLNDRFNAKNWRACRAG 212

Query: 228 IFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGS 287
            F  FG SG++P+I     +G  E+  R+QL+++ LE   YI GA++YG R PE L PG 
Sbjct: 213 FFVTFGFSGIVPIIMGLVKFGVAESSKRVQLRFVLLEAFFYIGGAIIYGFRIPETLIPGK 272

Query: 288 FDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           FD  GHSHQ+FH+LVV+ +LCH RAL+  Y  +HT 
Sbjct: 273 FDFVGHSHQIFHILVVLGSLCHFRALIGSYFFMHTG 308

>YDR492W Chr4 (1434924..1435874) [951 bp, 316 aa] {ON}  IZH1Membrane
           protein involved in zinc ion homeostasis, member of the
           four-protein IZH family; transcription is regulated
           directly by Zap1p, expression induced by zinc deficiency
           and fatty acids; deletion increases sensitivity to
           elevated zinc
          Length = 316

 Score =  265 bits (677), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 185/272 (68%), Gaps = 2/272 (0%)

Query: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGIC-FLF-IAL 111
           ++D+LP+WQKDN+ IL+GYVRET S++K   SLFY +NE+VNIY+HL+P I  F+F I L
Sbjct: 42  NFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFAITL 101

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
            N +++  + +T+W DY +I+IFL+GA  CL  S  +HCMK HS + S F +KLDY+GI+
Sbjct: 102 TNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGII 161

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
           +LISCSMI  +Y+G++D  + FSLF                   F +  +R +RA  F  
Sbjct: 162 SLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHDKFNTSTFRPFRAMFFIL 221

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FG SGLLP+ T  F +G     +RI++ ++  E + YISGAV+YG R PE L PG FD +
Sbjct: 222 FGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFF 281

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           G SHQ+FH++VV+ ++CHL+A++  YK +H++
Sbjct: 282 GSSHQIFHIMVVLGSVCHLKAIIDSYKLMHSH 313

>Smik_4.769 Chr4 (1356263..1357213) [951 bp, 316 aa] {ON} YDR492W
           (REAL)
          Length = 316

 Score =  264 bits (675), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 184/272 (67%), Gaps = 2/272 (0%)

Query: 54  SWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGIC-FLF-IAL 111
           ++D+LP+WQKDN+ IL+GYVRET S++K   SLFY +NE+VNIY+HL+P +  F+F I L
Sbjct: 42  NFDELPEWQKDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAVIYFVFAITL 101

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
            N +++  + +T+W DY +I+IFL+GA  CL  S  +HCMK HS + S F +KLDY+GI+
Sbjct: 102 TNYFLIPVFPSTSWSDYTVINIFLMGAFSCLMCSSCFHCMKQHSEKQSNFWSKLDYLGII 161

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
           +LISCSMI  +Y+G++D  + FSLF                   F +  +R +RA  F  
Sbjct: 162 SLISCSMIPIIYFGYFDHISYFSLFTIVTLVLATFCTVCVLHEKFNTSTFRPFRAMFFIL 221

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
           FG SGLLP+ T  F +G     +RI++ ++  E + YISGAV+YG R PE L PG FD  
Sbjct: 222 FGFSGLLPLTTGFFKFGIQGVLNRIKVSFVFWEALFYISGAVIYGFRIPETLAPGKFDFL 281

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           G SHQ+FH++VV+ ++CHL+A++  YK +H++
Sbjct: 282 GSSHQIFHIMVVLGSICHLKAIIGSYKLMHSH 313

>Suva_2.668 Chr2 (1186763..1187710) [948 bp, 315 aa] {ON} YDR492W
           (REAL)
          Length = 315

 Score =  263 bits (672), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 183/269 (68%), Gaps = 2/269 (0%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGIC-FLF-IALFNK 114
           +LPDWQ+DN+ IL+GYVRET S++K   SLFY +NE+VNIY+HL+P I  F+F + L N 
Sbjct: 44  ELPDWQRDNDKILTGYVRETLSWKKCLYSLFYWNNETVNIYTHLVPAIVYFVFGVTLTNY 103

Query: 115 YVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALI 174
           +++  + +TTW DY +I+IFL+GA +CL  S  +HCMK HS + S F +KLDY+GI++LI
Sbjct: 104 FLIPVFPSTTWSDYTVINIFLMGAFLCLMCSSCFHCMKQHSEKQSDFWSKLDYLGIISLI 163

Query: 175 SCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGL 234
           SCSMI  +Y+G++D  + FSLF                   F +  +R +RA  F  FG 
Sbjct: 164 SCSMIPIIYFGYFDHASYFSLFTIVTLVLATFCTICVLHDKFNTSTFRPFRAMFFILFGF 223

Query: 235 SGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHS 294
           SGLLP+ T  F +G     +RI++ ++  E + YISGA++YG R PE L PG FD +G S
Sbjct: 224 SGLLPLTTGLFKFGLQGVLNRIRVSFVFWEALFYISGALIYGFRIPETLAPGKFDFFGSS 283

Query: 295 HQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           HQ+FH++VV+ ++CHL+A++  YK +H++
Sbjct: 284 HQIFHIMVVLGSVCHLKAIIDSYKLMHSH 312

>CAGL0G04631g Chr7 (441149..442099) [951 bp, 316 aa] {ON} similar to
           uniprot|Q03419 Saccharomyces cerevisiae YDR492w
          Length = 316

 Score =  256 bits (655), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 118/273 (43%), Positives = 179/273 (65%), Gaps = 2/273 (0%)

Query: 55  WDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF-- 112
           +++LP+WQKDN+ IL GYVRETNS+++  +SL YL+NESVNIY+HLIP + ++ ++L+  
Sbjct: 41  FNELPEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLA 100

Query: 113 NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVA 172
           N +++  Y +T+  DY++I++F LGA  CL  S  +HCMK HS       +KLDY+GI+ 
Sbjct: 101 NVFLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIIC 160

Query: 173 LISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAF 232
           LISCS +  +YYG++D  + F++F                   F + E+R  RA+ FT F
Sbjct: 161 LISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFTLF 220

Query: 233 GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWG 292
           G SG++P+      +G      RI L ++ LE + YISGA++YG RFPE + PG FD +G
Sbjct: 221 GFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKFDFFG 280

Query: 293 HSHQLFHVLVVIAALCHLRALLSCYKNVHTNAL 325
            SHQ+FH++VV+ ++CHL A++  Y  +H+N L
Sbjct: 281 SSHQIFHIMVVLGSICHLFAMVESYHLIHSNFL 313

>TPHA0A00640 Chr1 complement(115042..116025) [984 bp, 327 aa] {ON}
           Anc_3.90 YOL101C
          Length = 327

 Score =  253 bits (646), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 186/309 (60%), Gaps = 3/309 (0%)

Query: 17  NDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPDWQKDNEHILSGYVRET 76
            + +S  S +  +  ++GTV               L S+ +LP+WQKDNE I+ GYVRET
Sbjct: 11  EEQSSKLSRRRFSVSKNGTVLLESTEIVETYS-KKLYSFHELPEWQKDNELIIQGYVRET 69

Query: 77  NSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF--NKYVVADYSTTTWKDYLMIDIF 134
           NS+ K F SL Y HNES+NIY+HLIPG+ +  + LF  +  VV  + +TT  DY++ID +
Sbjct: 70  NSWFKCFHSLSYFHNESINIYTHLIPGLVYFIMLLFYTDLLVVPSFPSTTIMDYIVIDFY 129

Query: 135 LLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFS 194
           LLGA +CL  S  +HC+K HS + S F +K+DY+GI+ LISCS+IS +YYG++D    F 
Sbjct: 130 LLGAFICLVGSSCFHCLKQHSEDQSNFWSKIDYVGIICLISCSLISLLYYGYFDHFIYFK 189

Query: 195 LFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYS 254
           +F                   F ++ +R  RA  F  F  S ++P+ T    +  +E  +
Sbjct: 190 VFTLITLILATICTVCVLDERFNAKNFRPIRAGFFVVFATSAVIPICTGLIKFDYVEVIN 249

Query: 255 RIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALL 314
           RIQL+++  E   Y+ GA+LYG R PE   PG FD+ G SHQ+FHV+VVI +L HL+A++
Sbjct: 250 RIQLRFVGWETFFYVVGALLYGYRIPEIFAPGRFDLVGSSHQIFHVMVVIGSLFHLKAVI 309

Query: 315 SCYKNVHTN 323
             Y+ +H +
Sbjct: 310 GSYEFMHKS 318

>Kpol_1053.26 s1053 complement(40099..41073) [975 bp, 324 aa] {ON}
           complement(40099..41073) [975 nt, 325 aa]
          Length = 324

 Score =  247 bits (630), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 129/313 (41%), Positives = 186/313 (59%), Gaps = 4/313 (1%)

Query: 13  VAPENDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPDWQKDNEHILSGY 72
           +A      SS S + T+   +GTV           E   LC + +LPDWQKDNE IL+GY
Sbjct: 4   IATVEREYSSVSKRRTSKSANGTVTIEVEREEH--EEIKLCHFHELPDWQKDNEFILTGY 61

Query: 73  VRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF--NKYVVADYSTTTWKDYLM 130
           VRETNS +K  RSL   +NES+NIYSHLI  I +  + LF  +   +  + +TT+ DY++
Sbjct: 62  VRETNSIKKCLRSLGCFNNESINIYSHLIAAISYFVVLLFYTDILCIPSFPSTTFVDYMV 121

Query: 131 IDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDST 190
           ID++LLGA  CL  S ++HCMK HS   S   +K+DYIGI+ LI+CS+IS +YYG+ D  
Sbjct: 122 IDLYLLGAFTCLIGSSLFHCMKQHSESHSDMWSKVDYIGIICLITCSLISLLYYGYMDHF 181

Query: 191 AMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPI 250
             F +F                   F S+ +R  RA  F  F +S ++P+      +G  
Sbjct: 182 IYFKVFTVITLVLATICTICVLDQRFNSKNFRPIRAGFFILFSMSAVIPIGAGFSKFGFT 241

Query: 251 EAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHL 310
           E   RIQL++++ E   Y+ GA+LYG R PE L PG+FD+ G SHQ+FH++V++ ++ HL
Sbjct: 242 EVLQRIQLRFVAWETFFYVVGALLYGFRIPETLYPGNFDLVGSSHQIFHIMVILGSVFHL 301

Query: 311 RALLSCYKNVHTN 323
           +A+L  Y  +H+N
Sbjct: 302 KAVLGSYTFMHSN 314

>TBLA0B02290 Chr2 complement(534472..535452) [981 bp, 326 aa] {ON}
           Anc_3.90 YOL101C
          Length = 326

 Score =  247 bits (630), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 123/274 (44%), Positives = 171/274 (62%), Gaps = 3/274 (1%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           L ++++LP WQ+DNE IL+GY+RETNS++   RSL + HNE++NIYSH I    +L + +
Sbjct: 43  LYTYEELPSWQQDNEMILTGYIRETNSWKLCLRSLTFFHNETINIYSHGISAAIYLLLLV 102

Query: 112 F---NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168
           F   N   +  + TTT  DYL++DI+LLGA  CLTLS  +HC+K HS   S   +K+DYI
Sbjct: 103 FFFTNLIYLPSFPTTTLHDYLVLDIYLLGAATCLTLSSCFHCLKQHSQSQSDIWSKMDYI 162

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI+ LI+CS IS +Y+G+ D    F  F                   F +R+W+  RA  
Sbjct: 163 GIICLITCSTISLLYFGYRDHFNYFKFFAISTFILAITCTVFVTMEKFNTRDWKHVRALF 222

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288
           F AF  SGL+P+IT    +G  E + R+QL  L+LE + Y+ GA+LYG R PE   PG F
Sbjct: 223 FIAFAGSGLIPLITGINIFGFPEVWQRVQLPSLTLELICYVIGALLYGYRIPEVFAPGKF 282

Query: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHT 322
           D  G+SHQ FH+ VV+ +L HLRAL+  Y  +H+
Sbjct: 283 DNIGNSHQWFHIFVVLGSLLHLRALVGSYYFMHS 316

>ZYRO0B06556g Chr2 (526478..527434) [957 bp, 318 aa] {ON} similar to
           uniprot|Q6Q557 Saccharomyces cerevisiae YDR492W IZH1
           Membrane protein involved in zinc metabolism member of
           the four-protein IZH family transcription is regulated
           directly by Zap1p expression induced by zinc deficiency
           and fatty acids deletion increases sensitivity to
           elevated zinc
          Length = 318

 Score =  245 bits (626), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 123/282 (43%), Positives = 174/282 (61%), Gaps = 4/282 (1%)

Query: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICF- 106
           E  +L  + +LP+WQ+DN+ IL+GY+RET S  K  RSLF  +NE+VNIY+HL+  + + 
Sbjct: 28  EEKTLYDFHELPEWQQDNDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYF 87

Query: 107 -LFIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKL 165
            L + + +  +V  + T+T+ DY +I+ +LLGA  CL  S  +H  K HS   S   +K+
Sbjct: 88  LLMLGITDLVMVPHFPTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKV 147

Query: 166 DYIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYR 225
           DY+GI+ LI+CSMIS +YYGF+D    F LF                   F  +++R  R
Sbjct: 148 DYMGIIVLITCSMISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLR 207

Query: 226 AAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEP 285
           A  F AFGLSG+ PV      +G      R+QLK+L LE + YI+GA++YG R PE + P
Sbjct: 208 AGFFIAFGLSGVFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFP 267

Query: 286 GSFDIWGHSHQLFHVLVVIAALCHLRALLSCY--KNVHTNAL 325
           G FD WGHSHQ+FHVLVVIA+  HL+A++  Y  K+ H N +
Sbjct: 268 GRFDFWGHSHQIFHVLVVIASFLHLKAVMGSYIFKHSHLNGV 309

>KLLA0C12441g Chr3 complement(1057427..1058374) [948 bp, 315 aa]
           {ON} similar to uniprot|Q6Q557 Saccharomyces cerevisiae
           YDR492W IZH1 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family
           transcription is regulated directly by Zap1p expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score =  242 bits (618), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 119/277 (42%), Positives = 178/277 (64%), Gaps = 2/277 (0%)

Query: 49  VSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL- 107
           +  L  + +LP+WQ+DN+ I++GY+RET S ++  +SLF  HNES+NIYSHL+P I +L 
Sbjct: 29  IKRLYRYSELPEWQQDNDKIITGYIRETKSVKECVKSLFLFHNESINIYSHLVPTITYLV 88

Query: 108 -FIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLD 166
             + L + ++V  +  +T    +MI  FLLG+V+CL  S  +HC+K HS       +K+D
Sbjct: 89  LLVGLADMFLVPQFPNSTMMQSVMIHFFLLGSVLCLGCSSFFHCLKQHSESHCHIWSKVD 148

Query: 167 YIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRA 226
           Y+GI+ +I+CS+IS +YYGF+D    F  F                   F S+ +R +RA
Sbjct: 149 YMGIIIMITCSIISLLYYGFHDHIFHFKCFTVFTVILGTICTVFALHDKFNSKTFRPFRA 208

Query: 227 AIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPG 286
             +  FGLSG++P++T  + +G  EA  R+QLK++ LE + YI+GAV+YG RFPE L PG
Sbjct: 209 MFYVTFGLSGIVPIVTGFWKFGAYEAIRRVQLKYVLLEAMFYIAGAVIYGFRFPEVLAPG 268

Query: 287 SFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
            FD  GHSHQ+FH++VV+ ++CH RA+L  Y  +HT 
Sbjct: 269 KFDFVGHSHQIFHIMVVLGSICHFRAILGSYVFMHTG 305

>AFR337W Chr6 (1051645..1052598) [954 bp, 317 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR492W (IZH1) and
           YOL101C (IZH4)
          Length = 317

 Score =  241 bits (614), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 123/284 (43%), Positives = 175/284 (61%), Gaps = 2/284 (0%)

Query: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL 107
            +  L ++D+LP WQKDNE ILSGYVRETNS ++  R++ Y +NES+NIY+HLIPG+ +L
Sbjct: 30  RIRKLYTFDELPAWQKDNELILSGYVRETNSVKECLRAMTYFNNESINIYTHLIPGVAYL 89

Query: 108 FIAL-FNKYVVADY-STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKL 165
            + L F   V+A         ++ M+  +LLGA  CL  S  +HC+K HS   S   +K+
Sbjct: 90  VLFLIFADLVLAQLLPGLDAGEHRMLRFYLLGAFTCLACSSCFHCLKQHSEPHSRLWSKV 149

Query: 166 DYIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYR 225
           DY+GI+A I+CS IS +YYG++   + F  F                   F +  +R  R
Sbjct: 150 DYLGILAQITCSTISLLYYGYHSYPSHFVFFSTLTVALCSACAVLVLNDSFNTVAFRPLR 209

Query: 226 AAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEP 285
           A +F AFGLSG++PV+   + +G  E  +RIQLK++  E V YI+GA++YG R PE+  P
Sbjct: 210 AFLFMAFGLSGVIPVLAGSYQFGFAEWAARIQLKYVLYEAVFYITGALVYGFRIPERFAP 269

Query: 286 GSFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTNALFVSL 329
           G FD+ GHSHQ+FH+LVV+  LCH RA+   Y  + T   + SL
Sbjct: 270 GKFDMVGHSHQIFHLLVVLGTLCHFRAVTGSYIFICTGKHYSSL 313

>TDEL0D05340 Chr4 (969608..970558) [951 bp, 316 aa] {ON} Anc_3.90
           YOL101C
          Length = 316

 Score =  239 bits (610), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 115/271 (42%), Positives = 168/271 (61%), Gaps = 2/271 (0%)

Query: 55  WDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF-- 112
           +++LP+WQ+DN+ IL+GYVRET S  +   SL Y +NESVNIY+HL+  + +  + LF  
Sbjct: 35  FNELPEWQQDNDKILTGYVRETKSVLRCLDSLSYWNNESVNIYTHLLSAVAYFVLLLFFT 94

Query: 113 NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVA 172
           +  ++  + +TT  DY++I+ +LLGA VCL  S  +HC K HS   S   +K+DY+GI+ 
Sbjct: 95  DILLIPSFPSTTMTDYIIINFYLLGAFVCLMCSSCFHCFKQHSNSQSDAWSKVDYMGIIG 154

Query: 173 LISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAF 232
           LISCS+IS +YYG++D    F LF                   F + + R  RA+ F  F
Sbjct: 155 LISCSVISLLYYGYFDHVFYFKLFSVITVVLAMACSVCVLSDRFNTSDMRPLRASFFITF 214

Query: 233 GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWG 292
             S ++P+ T  F +G  E + R+QL+++  E   Y+SGA+LYG R PE + PG FD  G
Sbjct: 215 AFSSVIPIATGMFKFGWTEVFHRVQLRFVGWEAFFYLSGALLYGYRIPETIAPGKFDFIG 274

Query: 293 HSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
            SHQLFHVLVV+ + CHLRA++  Y  +H +
Sbjct: 275 SSHQLFHVLVVLGSFCHLRAVMGSYMFMHAH 305

>KAFR0A08130 Chr1 (1638153..1639112) [960 bp, 319 aa] {ON} Anc_3.90
           YOL101C
          Length = 319

 Score =  238 bits (607), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 171/275 (62%), Gaps = 6/275 (2%)

Query: 55  WDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF-- 112
           + +LP WQ+DN+ IL GYVRETNS+ K   SLFYL+NES+NIYSHLIP + +L IA+   
Sbjct: 42  FHELPTWQQDNDKILGGYVRETNSFTKCIESLFYLNNESINIYSHLIPSLIYLTIAVMLL 101

Query: 113 ---NKYV-VADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYI 168
              ++++ +  Y TTT  D++ I+IFL+GA +CL  SG +H +K HS     F +++DY+
Sbjct: 102 IEIDQFLNIPIYPTTTKYDFIFINIFLVGAFLCLLGSGCFHLLKQHSELQCNFWSRIDYM 161

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI+ LISCSM+  +YYGF+D   +F  F                   F   ++R  RA +
Sbjct: 162 GIIVLISCSMMPVLYYGFFDHIVLFYCFITLTLAFASVCSIIVMSETFNLSKYRLLRACV 221

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSF 288
           F AFG SGL+P+I     +G    + RI LK++  E V Y+ GA LYG R PE + PG F
Sbjct: 222 FAAFGFSGLIPMIVGFSKFGLSGVFQRISLKFIFWESVFYLVGATLYGFRIPESILPGKF 281

Query: 289 DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           D++G SHQLFH  VVI ++ H +A++  Y  +H+ 
Sbjct: 282 DLFGSSHQLFHCFVVIGSVLHFKAVIESYILMHSR 316

>Ecym_3588 Chr3 (1117646..1118563) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR337W
          Length = 305

 Score =  230 bits (587), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 116/274 (42%), Positives = 168/274 (61%), Gaps = 2/274 (0%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIAL 111
           L S+D+LP+WQKDNE I  GYVRETNS+ +  +S+ Y +NESVNIY+HL+P + +  + L
Sbjct: 22  LYSFDELPEWQKDNELIRMGYVRETNSFLECLKSMTYFNNESVNIYTHLVPSVTYFILLL 81

Query: 112 FNKYVVAD--YSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIG 169
               +V    +  TT ++Y+MID +L G  VCL  S  +HC+K HS   +   +K+DYIG
Sbjct: 82  LFVDLVVTPMFPGTTMREYIMIDFYLFGVFVCLMCSTCFHCLKQHSESHNRIWSKVDYIG 141

Query: 170 IVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
           I+  I+ S++S +YYGFYD  +                        F + ++R  RA  F
Sbjct: 142 IIVQITSSIVSILYYGFYDHISHIKWLSVLTLTLGVCCVTFVLNDRFNAIDYRLLRAIFF 201

Query: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFD 289
           T FG SG++PV+   + +G IE  +RIQLK++    + YI GA++YG R PE L PG FD
Sbjct: 202 TVFGFSGVVPVLIGIYQFGLIEWLARIQLKFVLAGTIFYIFGALIYGFRIPEALAPGKFD 261

Query: 290 IWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
             GHSHQ+FH+LVV+ ++CH RA++  Y  + T 
Sbjct: 262 FIGHSHQIFHLLVVLGSICHFRAVIGSYVFMRTG 295

>NDAI0A07160 Chr1 complement(1630482..1631474) [993 bp, 330 aa] {ON}
           Anc_3.90
          Length = 330

 Score =  228 bits (582), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/299 (40%), Positives = 180/299 (60%), Gaps = 5/299 (1%)

Query: 27  ETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSL 86
           ET  L+D              ++  L  +D+LP+WQKDN+ IL+GYVRETNS+   F+SL
Sbjct: 29  ETNHLEDNDTSQKPKTNRRKRKIH-LSKFDELPEWQKDNDKILTGYVRETNSFIHCFQSL 87

Query: 87  FYLHNESVNIYSHLIPGICFLFIAL----FNKYVVADYSTTTWKDYLMIDIFLLGAVVCL 142
           FYL+NE++NIY+HLIP I +L ++L     N   +  + TT+  DY++I+IF+LGA  CL
Sbjct: 88  FYLNNETINIYTHLIPSIIYLIVSLTFIFINFIAIPKFPTTSVIDYIVINIFILGAFTCL 147

Query: 143 TLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXX 202
            LS  +HC+K HS +     +KLDYIGI+ LISCS+I  +Y+G++D  + F  F      
Sbjct: 148 LLSSCFHCLKQHSFKQCTLWSKLDYIGIIILISCSIIPILYFGYFDRLSYFKFFTILTFS 207

Query: 203 XXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLS 262
                        F    +R  RA +F  F  +GL+P+IT  + +G      RI L ++ 
Sbjct: 208 FAIVCSIIVLNEKFDLPSYRPLRAGLFMLFSFTGLIPMITGFYIFGYKGVMERISLNFVL 267

Query: 263 LEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVH 321
           LE + YI G +LYG R PE  +PG+FD++G SHQ+FH+ VV+ ++CH  A++  Y  +H
Sbjct: 268 LEAIFYIIGTLLYGFRIPETFKPGNFDMFGSSHQIFHIFVVLGSICHFGAVIKSYCLMH 326

>NCAS0I02570 Chr9 complement(480266..481210) [945 bp, 314 aa] {ON}
           Anc_3.90 YDR492W
          Length = 314

 Score =  226 bits (575), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 113/274 (41%), Positives = 175/274 (63%), Gaps = 2/274 (0%)

Query: 52  LCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIA- 110
           L ++++LP+WQ+DN+ IL+GYVRET S+++  +SL Y +NE++NIY+HLIP + +L I+ 
Sbjct: 39  LFNFNELPEWQRDNDKILTGYVRETKSFKQCLQSLLYWNNETINIYTHLIPALFYLTISV 98

Query: 111 -LFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIG 169
            L N  VV  + TT+  DY +I++FL+GA VCL LS  +HC+K HS       +KLDY+G
Sbjct: 99  TLINYVVVPHFPTTSIMDYFVINVFLMGAFVCLILSSCFHCLKQHSSRQCTLWSKLDYMG 158

Query: 170 IVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
           I+ LISCS+I  +Y+G++D     + F                   F    +R +RA +F
Sbjct: 159 IIILISCSLIPMIYFGYFDHLYYVNFFIILTFSFATLCSICVLNEKFNVPHYRPFRAIVF 218

Query: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFD 289
             F  SG +P++T  + +G    + R+ LK+++ E + YI+GA LYG R PE  +PG FD
Sbjct: 219 MLFSFSGFIPILTGFYLFGFHGVFERVALKFVAWEALFYITGATLYGFRIPECFKPGDFD 278

Query: 290 IWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
             G SHQ+FH+LVV+ ++CH RA++  Y  +H++
Sbjct: 279 FLGSSHQIFHILVVLGSICHFRAVIKSYILMHSS 312

>KNAG0K02160 Chr11 (436744..437715) [972 bp, 323 aa] {ON} Anc_3.90
           YOL101C
          Length = 323

 Score =  219 bits (559), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/323 (38%), Positives = 182/323 (56%), Gaps = 9/323 (2%)

Query: 3   DSDLKQR-VKFVAPENDTASSYSTKETTFLQDGTVXXXXXXXXXXXEVSSLCSWDDLPDW 61
            S+L++R V       +TA+         L  GT            +   LC +++LP W
Sbjct: 2   SSELRKRAVSLGETAIETATVSRGSRGKLLVTGT-----SSGAPSGQRGRLCRYEELPAW 56

Query: 62  QKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF--NKYVVAD 119
           Q+DN+ I +GYVRET S R+   SL Y +NESVN+YSHL+P + ++  A    +++ V  
Sbjct: 57  QQDNDCIRTGYVRETLSVRRCLGSLLYWNNESVNMYSHLVPAVLYIAGATLALSQWGVPR 116

Query: 120 YSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIVALISCSMI 179
           + TTTW DYL+I+ FL+GA  CL  S ++HC+K HS       +++DY+GI+ LI+CS I
Sbjct: 117 FPTTTWSDYLIINTFLVGAGACLLCSSLFHCLKQHSERHCEAWSRMDYMGIILLIACSTI 176

Query: 180 SQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXX-XPHFRSREWRKYRAAIFTAFGLSGLL 238
             +Y+G++D      LF                    F S  ++  RAA F AF  +GL+
Sbjct: 177 PMIYFGYFDYMGHCLLFTAVTVALGVACSGVVLFNKQFNSSSFKLVRAAFFIAFAFNGLI 236

Query: 239 PVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIWGHSHQLF 298
           P+ T    +G      RI LK++  E V YI+GA+LYG R PE   PG  D+WG+SHQ+F
Sbjct: 237 PMATGFVKFGIPGVLDRISLKYVWFEAVFYIAGAMLYGFRVPEIWIPGKVDLWGNSHQMF 296

Query: 299 HVLVVIAALCHLRALLSCYKNVH 321
           HV+VV  +LCHL+A+L  Y  +H
Sbjct: 297 HVMVVFGSLCHLKAVLESYSLMH 319

>TBLA0B08255 Chr2 (1973757..1974647) [891 bp, 296 aa] {ON}
          Length = 296

 Score =  177 bits (448), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 150/284 (52%), Gaps = 28/284 (9%)

Query: 51  SLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIA 110
            LC+++DLPDWQKDN  I++ YVRETNS  K+  S+F  H+ES+NI++HLIP +      
Sbjct: 7   QLCNFNDLPDWQKDNPLIVNYYVRETNSLFKSLCSIFLFHSESMNIFTHLIPAL------ 60

Query: 111 LFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGI 170
           L+ K+     +T     Y ++  +L+  ++C  LS ++H  K  S++ + F  KLDY+GI
Sbjct: 61  LYAKFTYNAITTLEQVSYPIV-FYLISVIICFLLSSLFHLFKCTSVQSNEFWGKLDYVGI 119

Query: 171 VALISCSMISQMYYGFYDS--TAMFSLFXXXXXXXXXXXXXXXXXPHFRSRE-------- 220
             LI+ +++S    GF +S  T M + F                  H +  E        
Sbjct: 120 SLLINATIVSMALLGFNESRYTIMKNTFVTQTSCLTAYVIILAIKSHPKQGENEDDNDGT 179

Query: 221 -----------WRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYI 269
                       +  RA +F + GLSGL+PVIT  + YGP   Y +I +  +    + YI
Sbjct: 180 LSEDDDCCCDDHKGTRAKLFASLGLSGLIPVITGLYIYGPKVVYYKINIPMVIASVLCYI 239

Query: 270 SGAVLYGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRAL 313
            G ++Y  + PEK  PG FD+ G SHQLFH+ +V   +CH  A+
Sbjct: 240 VGTLIYVFKIPEKFYPGRFDLVGSSHQLFHIFIVFGTVCHYHAI 283

>NCAS0C04920 Chr3 complement(1003692..1004672) [981 bp, 326 aa] {ON}
           Anc_3.90
          Length = 326

 Score =  129 bits (325), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 136/272 (50%), Gaps = 7/272 (2%)

Query: 56  DDLPDWQKD--NEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF- 112
            +LP WQK   N  I++GYVRETNS  K   ++ Y +N++VNI  + +    +  + LF 
Sbjct: 45  KELPQWQKQYSNSKIINGYVRETNSLIKCLHTVTYWNNQTVNIILNTVFSTVYFTLLLFF 104

Query: 113 -NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
            + Y++     TT  DY+M++ +L GA     L+ +++ ++SHSL       KL ++  +
Sbjct: 105 TDLYLIPSSPATTMSDYIMVNFYLFGAFQYFALNSIFYLLESHSLAKCHLWFKLSHLAFI 164

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
             IS S+I+Q+YY F+D+   F                      F  R+ R  R  +   
Sbjct: 165 NYISTSIITQLYYTFFDNVFYFKFLTISTLLISSIFAIFTLSEQFL-RKNRSQRNMVSIT 223

Query: 232 FGLSGL-LPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDI 290
           F +S L LP  +  F +       R++ K + LE  LY+    L  V+ PE+     FD 
Sbjct: 224 FIVSLLILPTASLMFKFNTFRILRRVEGKAILLELSLYLFSMTLKAVQVPERFSEN-FDF 282

Query: 291 WGHSHQLFHVLVVIAALCHLRALLSCYKNVHT 322
            G+S  ++H+ +++ +L H + LL+ Y  +H+
Sbjct: 283 IGNSENIYHICIILGSLLHFKMLLNSYFFMHS 314

>NDAI0G04300 Chr7 (1035664..1036620) [957 bp, 318 aa] {ON} Anc_3.90
          Length = 318

 Score =  115 bits (288), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 135/271 (49%), Gaps = 5/271 (1%)

Query: 56  DDLPDWQKD--NEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALF- 112
            +LP+WQ++  +  +++G+++ETNS++K   S  Y HN S+NI  + I    +  +  F 
Sbjct: 37  KELPEWQREFNSGKVITGFLKETNSFKKCLWSTMYWHNSSINISLNGIAATVYFMLLFFF 96

Query: 113 -NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNKLDYIGIV 171
            + Y++  + +TT  DY++++++LL A     +  +++ MKSHS + +    KL+ IG++
Sbjct: 97  TDCYLIPSFPSTTMSDYIVLNLYLLTATQNFMVGTIFYIMKSHSKQQAFLWYKLNNIGLI 156

Query: 172 ALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTA 231
             I+ S+++ +YY ++D    F  F                   F      +    +   
Sbjct: 157 NHIASSVVTLLYYHYFDYVFYFKFFTIVTLLLITLFTCSIISDSFNKMTRIRKNFLLLAY 216

Query: 232 FGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLEPGSFDIW 291
             L  L+P + +   +G  +   RI L  + LE  +Y  G  +   + PE+    SFD  
Sbjct: 217 IILLTLMPSLFAILRFGLAKVLERISLNLIILEIFIYAFGLTIRTSQLPERFF-NSFDFL 275

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHT 322
           G+S  ++ + +++ +  H + L++ Y  +H+
Sbjct: 276 GNSENVYQLSIIVCSFIHFKILMNSYCLMHS 306

>CAGL0I07491g Chr9 complement(719539..720444) [906 bp, 301 aa] {ON}
           similar to uniprot|Q03419 Saccharomyces cerevisiae
           YDR492w
          Length = 301

 Score = 94.0 bits (232), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 134/288 (46%), Gaps = 18/288 (6%)

Query: 50  SSLCSWDDLPDWQK--DNEHILSGYVRETN-SYRKTFRSLFYLHNESVNIYSHLIPGICF 106
           S + + + LP W +   N  I +GY   TN +Y    + L   +N+S++IY +L+ G+  
Sbjct: 8   SKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCLQKLVKFNNDSISIYMNLVCGLIS 67

Query: 107 LFIALF--NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSVFGNK 164
             + LF  +  ++  + +TT  DY++I++FL+          +   +K HS       N+
Sbjct: 68  GVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATTTYFATMTLGQLLKGHSEYQGKLWNQ 127

Query: 165 LDYIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKY 224
              + +V L++CS+++ +YY F+D   +F LF                   ++    R  
Sbjct: 128 AKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFVIWTCLLMSITSIVIINDQYK----RVQ 183

Query: 225 RAAIFTAFG-LSGLLPVITSCFYYGPIEAY--SRIQLKWLSLEGVLYISGAVLYGVRFPE 281
           + +    FG LS  LP+  S   +G  ++Y   RI  + L+ E VLY   A+L   R PE
Sbjct: 184 KLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRIPFQVLTWEIVLYSLSAMLQLTRLPE 243

Query: 282 ---KLEPGSF---DIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
                   SF   D  G+S Q+  ++ + A + H   ++  Y+ VH +
Sbjct: 244 LTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIVHFNTIIFAYEVVHAS 291

>Skud_15.53 Chr15 complement(86339..87277) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/281 (25%), Positives = 124/281 (44%), Gaps = 22/281 (7%)

Query: 48  EVSSLCSWDDLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFL 107
           E+     + DL  WQ+          R  +S  ++  +L YL   S++ +  LI    F 
Sbjct: 38  EIKKGFPFHDLAKWQQQ--------YRNKSSRNESLVALIYLLG-SMSSFCLLIFFTDFY 88

Query: 108 FIALFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSV-FGNKLD 166
            I LF        +TTT  DY++ + +LL   V   +  VYH +K+ SL+  +    K  
Sbjct: 89  LIPLFP-------TTTTMTDYIVFNFYLLNVFVFCMVHFVYHFIKNISLQQHLEHWQKFS 141

Query: 167 YIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRA 226
           Y+  + L+  S I+ +YY FYD    F +F                     S + R  + 
Sbjct: 142 YLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLNSSK-RFNKT 200

Query: 227 AIFTAFGLSGL-LPVITSCFYYGPIEAY-SRIQLKWLSLEGVLYISGAVLYGVRFPEKL- 283
             F +  +    LP++T+   +  +E    RI++K ++ E V  ++ +++Y  RFPE L 
Sbjct: 201 VFFISVSVVCCSLPLLTAIITFDGLENLKERIKVKAITCELVALVAASIIYVTRFPESLF 260

Query: 284 -EPGSFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
                 + W HS  LFH+++   A  H   L+  Y  +H++
Sbjct: 261 RRNKKEESWNHSEYLFHLVISGTAFYHFFILIQSYILMHSS 301

>KAFR0J00670 Chr10 (120378..121907) [1530 bp, 509 aa] {ON} Anc_5.197
           YLR023C
          Length = 509

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 102/232 (43%), Gaps = 6/232 (2%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFI---ALFN 113
            LP   ++N +I++ Y R  +S++K+  S+F LHNE+ NI+SHL+  I FL++    L N
Sbjct: 197 QLPFPYRENRYIINNY-RFYDSHKKSLLSIFKLHNEATNIWSHLLGAIYFLYVLFHDLPN 255

Query: 114 KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGIVA 172
             +V+     T    L + +F+  ++ C+  S  YH     S L++      +DY GI  
Sbjct: 256 SIIVSSSMVPTTAK-LFLYLFVFASLKCMLSSTFYHTFNGTSMLKLRRKFMCVDYSGISI 314

Query: 173 LISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAF 232
           LI+ S++S  +   YD   +   +                 P F S E R  R   F   
Sbjct: 315 LITSSILSIQFISLYDYPNILKFYMCASFMLGVLGIFMNWSPLFDSPEARPLRIKFFILL 374

Query: 233 GLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
              G   ++   F    I A   + L   +   V Y+ G V YG   PE+  
Sbjct: 375 SSCGAFALLHLVFLEKSIFAAIDVLLPLTNKSIVWYLVGVVFYGSFIPERFR 426

>Suva_15.64 Chr15 complement(100035..100973) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 73.2 bits (178), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 121/277 (43%), Gaps = 32/277 (11%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIALFNKYV 116
           DL  WQK          +  +S  ++  +L YL   S++ +  LI    F  I LF    
Sbjct: 47  DLAKWQKQ--------YKNKSSRSESLVALIYLLG-SMSSFCLLIFFTDFYLIPLFP--- 94

Query: 117 VADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSV-FGNKLDYIGIVALIS 175
               +TTT  DY++ + +LL   V   +  +YH +K+ SL+  +    K  Y+  + L+ 
Sbjct: 95  ----TTTTMTDYIVFNFYLLNVFVFCMIHFIYHFIKNISLQQHIEIWQKFSYLANINLLI 150

Query: 176 CSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF--TAFG 233
            S I+ +YY FYD    F +F                     S  ++++   +F  +   
Sbjct: 151 SSQITILYYLFYDYVFFFKIFTLLMTFIGLAAYFVILTDKLNS--YKRFNKTVFFISVSV 208

Query: 234 LSGLLPVITSCFYYGPIEAYS-RIQLKWLSLEGVLYISGAVLYGVRFPEKL------EPG 286
           +   LP++T+   +  +E    RI+L  ++ E V  +  +++Y  RFPE L      E G
Sbjct: 209 VCCSLPLLTAIITFDGLENLKDRIKLNAITWELVTLVVASMIYVTRFPESLCRRNEKEEG 268

Query: 287 SFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
               W HS   FH+L+   A  H   L+  Y  +H++
Sbjct: 269 ----WNHSEYFFHLLISGTAFYHFFILIQSYILMHSS 301

>Smik_15.56 Chr15 complement(90083..91021) [939 bp, 312 aa] {ON}
           YOL101C (REAL)
          Length = 312

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/213 (25%), Positives = 99/213 (46%), Gaps = 16/213 (7%)

Query: 121 STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSV-FGNKLDYIGIVALISCSMI 179
           +TTT  DY++ + +LL   V   +  +YH +K+ SL+  +    K  Y+  + L+  S I
Sbjct: 95  TTTTMTDYIVFNFYLLNVFVFCMVHFIYHFIKNISLQQHLEHWQKFSYLSNINLLISSQI 154

Query: 180 SQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF--TAFGLSGL 237
           + +YY FYD    F +F                     S   +++   +F  +   +   
Sbjct: 155 TILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISS--KRFNKTVFFISVSVICCS 212

Query: 238 LPVITSCFYYGPIEAY-SRIQLKWLSLEGVLYISGAVLYGVRFPE------KLEPGSFDI 290
           LP++T+   +  +E    RI++  ++ E V  ++ +++Y  RFPE      K E G    
Sbjct: 213 LPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPELFLRGKKKEEG---- 268

Query: 291 WGHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
           W HS  LFH+++  AA  H   L+  Y  +H++
Sbjct: 269 WNHSEYLFHLIISGAAFYHFFILIQSYILMHSS 301

>YOL101C Chr15 complement(126982..127920) [939 bp, 312 aa] {ON}
           IZH4Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by fatty acids and altered zinc levels; deletion
           reduces sensitivity to excess zinc; possible role in
           sterol metabolism
          Length = 312

 Score = 68.6 bits (166), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 97/212 (45%), Gaps = 14/212 (6%)

Query: 121 STTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLEVSV-FGNKLDYIGIVALISCSMI 179
           +TTT  DY++ + +LL   V   +  +YH +K+ SL+  +    K  Y+  + L+  S I
Sbjct: 95  TTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQI 154

Query: 180 SQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFTAFGLSGL-L 238
           + +YY FYD    F +F                     S + R  +   F +  +    L
Sbjct: 155 TILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSK-RFNKTVFFISVSVVCCSL 213

Query: 239 PVITSCFYYGPIEAY-SRIQLKWLSLEGVLYISGAVLYGVRFPEKL------EPGSFDIW 291
           P++T+   +  +E    RI++  ++ E V  ++ +++Y  RFPE L      E G    W
Sbjct: 214 PLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEG----W 269

Query: 292 GHSHQLFHVLVVIAALCHLRALLSCYKNVHTN 323
            HS  LFH+L+   A  H   L+  Y  +H++
Sbjct: 270 NHSEYLFHLLISGTAFYHFFILIQSYILMHSS 301

>KLLA0F15510g Chr6 (1433494..1435362) [1869 bp, 622 aa] {ON} some
           similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 622

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 122/282 (43%), Gaps = 25/282 (8%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICF---LFIA 110
           +LP   ++N +I+ GY R  +S+ K+  S+   +  HNE++NI+SHL   +     LFI 
Sbjct: 303 ELPFPWRENRYIIHGY-RFYDSHVKSVLSVVNWYGWHNETLNIWSHLFGAVYLAYLLFIQ 361

Query: 111 LFNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSH-SLEVSVFGNKLDYIG 169
           L    V        +   L+I +FL+  V CL  S V+H +     L +      +DY G
Sbjct: 362 LPTTKVFMSQDVPLFGK-LIIQVFLIAGVKCLLSSSVWHTLNGTCCLPLRCKFACIDYTG 420

Query: 170 IVALISCSMISQMYYGFYD------STAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRK 223
           I  LI+ S++S  +   Y+      ST+M +++                 P F   E R 
Sbjct: 421 ITVLITASILSTEFVSVYNLATQSLSTSM-TVYMSLSLCLGIFGSFMNWSPRFDRPESRP 479

Query: 224 YRAAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKL 283
           +R A +      G++  +      G   +    +  W +   + Y+ G V YG   PE+ 
Sbjct: 480 FRIAFYVLLAGLGMISFLHLTISRGIDHSSQFFKPVW-NRSLIWYLIGVVFYGSFIPER- 537

Query: 284 EPGSFDIWGHSHQLFHVLVVIAALCHLRALLSCYKNVHTNAL 325
                  W    +L + +   A LC    +L+ +K+VH  A+
Sbjct: 538 -------WRTDVELDYTIPTDAELCSNLDILTKHKHVHFRAV 572

>Kpol_2002.94 s2002 (229517..231250) [1734 bp, 577 aa] {ON}
           (229517..231250) [1734 nt, 578 aa]
          Length = 577

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 100/237 (42%), Gaps = 16/237 (6%)

Query: 58  LPDWQKDNEHILSGYVRETNSYRKTFRSLFY---LHNESVNIYSHLIPGICFLFIALF-- 112
           LP   ++N +I++GY R  +   K   S+F     HNE+ NI+SHL+  I F +I LF  
Sbjct: 256 LPFPWRENRYIINGY-RFYHKNSKLLLSVFNWYGFHNETANIWSHLLGAIYFAYIVLFEF 314

Query: 113 -NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSH-SLEVSVFGNKLDYIGI 170
              ++V          Y++  +FLL  + C+  S  +H      S+++      +DY GI
Sbjct: 315 PKSFIVQSPEVPPSAKYIVY-LFLLAGIKCMLASVFWHTFNGTCSIKLRPKYCCVDYSGI 373

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +   YD  ++ +++                 P F S E R  R   F 
Sbjct: 374 TILITASILTAEFVSLYDHRSIMTVYMSLSLLFGCFGLYLNWSPKFDSPEARPLRIKFFI 433

Query: 231 AFGLSGLLPVITSCFYYGPIEA---YSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
                G L      +  G   A   YS +  K +    V Y+ G   YG   PE+  
Sbjct: 434 LLAALGGLAFFHVAYLEGMAYAAWLYSPVTSKSI----VWYLIGVFFYGSFIPERFR 486

>KLTH0B03498g Chr2 complement(281148..282788) [1641 bp, 546 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 546

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 98/237 (41%), Gaps = 13/237 (5%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPGICFLFIAL-- 111
           +LP   ++N  I+ GY R  NSY K+  S+F     HNE+VNI++HL   + F F+    
Sbjct: 219 ELPFPWRENRFIIHGY-RFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFKG 277

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKS-HSLEVSVFGNKLDYIGI 170
           F++  V            M  +FL   + C   S V+H       L+       +DY GI
Sbjct: 278 FSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDYTGI 337

Query: 171 VALISCSMISQMYY---GFYDSTAMFSL--FXXXXXXXXXXXXXXXXXPHFRSREWRKYR 225
             L++ S+++  +    G  D+T  +SL  F                 P F   E R  R
Sbjct: 338 TVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPESRPLR 397

Query: 226 AAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEK 282
            A +      G    + S  +   +++   I+  ++      YI G V YG   PE+
Sbjct: 398 IAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMK-SLAWYIIGVVFYGTFIPER 453

>NCAS0D02600 Chr4 (499689..501320) [1632 bp, 543 aa] {ON} Anc_5.197
           YLR023C
          Length = 543

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 107/237 (45%), Gaps = 14/237 (5%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPGICFLFIALFN 113
            LP   ++N +I+  Y R  +S++K+  S+F     HNE+ NI++HLI G+  +++A+++
Sbjct: 220 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNETSNIWTHLIGGLYLIYMAVYD 278

Query: 114 ----KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSH-SLEVSVFGNKLDYI 168
               +  ++D   TT K  L++ +FL  A+ CL  S  +H      +L++      +DY 
Sbjct: 279 FPRSEIFLSDKIPTTAK--LIVYLFLFAAIKCLFASVFWHSFNGTCTLKLRSKFACVDYS 336

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI  LI+ S+++  +   Y S     ++                 P F   E R  R   
Sbjct: 337 GISILITASILTTEFVTLYSSYRAMCVYMAISLSLGIFGVFMNWSPKFDRPEARPLRIKF 396

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVL-YISGAVLYGVRFPEKLE 284
           F      G+L  +   F       Y+   L  ++ + ++ Y  G V YG   PE+  
Sbjct: 397 FVLLASMGVLSFLHLTFLTD--WKYATWLLAPVTNKSIVWYCIGVVFYGSFIPERFR 451

>NDAI0I02330 Chr9 (532412..534148) [1737 bp, 578 aa] {ON} Anc_5.197
          Length = 578

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 104/236 (44%), Gaps = 12/236 (5%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPGICFLFIALFN 113
            LP   ++N +I+  Y R  +S++K+  S+F     HNES NI++HL+  I  +++++++
Sbjct: 254 QLPFPWRENRYIIYNY-RFYDSHKKSLLSIFNWYGWHNESSNIWTHLLGAIYLIYLSIYD 312

Query: 114 ----KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYI 168
               +   ++   TT K  L++ +FL  A+ CL  S  +H     S L++      +DY 
Sbjct: 313 FPNSEIFQSEKVPTTAK--LIVYLFLFAAIKCLLASVFWHTFNGTSFLKLRSKFACVDYS 370

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI  LI+ S+++  +   Y S     ++                 P F   E R  R   
Sbjct: 371 GITILITASILTTEFVTMYSSFFAMCIYMTISLSLGMFGVFMNWSPKFDRPEARPLRIKF 430

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
           F      G+L  +    Y   ++  + +     +   V Y+ G V YG   PE+  
Sbjct: 431 FILLASMGVLSFL-HLTYLTNLQYATWLLTPVTNKSIVWYLVGVVFYGSFIPERFR 485

>Kwal_33.15122 s33 (968885..970585) [1701 bp, 566 aa] {ON} YLR023C -
           Hypothetical ORF [contig 94] FULL
          Length = 566

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 98/237 (41%), Gaps = 13/237 (5%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPG--ICFLFIAL 111
           +LP   ++N  I+ GY R  NSY+K+  S+F     HNE+VNI++HL     + +L    
Sbjct: 239 ELPFPWRENRFIIHGY-RFYNSYKKSLLSIFNWYGWHNETVNIWTHLGGALYLAYLLFRG 297

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKS-HSLEVSVFGNKLDYIGI 170
           F++  V            M  +FLL  + C   S V+H       L+       +DY GI
Sbjct: 298 FSQTAVYQSELVPTAAKCMAFVFLLSGLECFLFSVVWHTFNGICHLQQRSNCACVDYTGI 357

Query: 171 VALISCSMISQMYY---GFYDSTAMFSL--FXXXXXXXXXXXXXXXXXPHFRSREWRKYR 225
             L++ S+++  +    G  ++   +SL  F                 P F   E R  R
Sbjct: 358 TILVTASILTTEFVTLSGAAEAPFTWSLLFFTTTSSILGVIGVYMNWSPKFDRPESRPLR 417

Query: 226 AAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEK 282
            A +      G    + S  ++  I +   I+   LS     Y+ G V YG   PE+
Sbjct: 418 IAFYLLLASFGFFSYLHSRIFHTSISSSELIK-PVLSKSLAWYLIGVVFYGTFIPER 473

>TPHA0E03120 Chr5 complement(654079..655788) [1710 bp, 569 aa] {ON}
           Anc_5.197 YLR023C
          Length = 569

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 98/238 (41%), Gaps = 15/238 (6%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFY---LHNESVNIYSHLIPG--ICFLFIAL 111
           +LP   ++N++I+ GY R  + + +   S+F    +HNE+ NI++H++    + +L    
Sbjct: 248 ELPFPWRENKYIIHGY-RFHDKFYQLILSVFNWYGVHNETTNIWTHMLAAFYLIYLLTVD 306

Query: 112 FNK-YVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMK-SHSLEVSVFGNKLDYIG 169
           F K ++V D          +I +FL   + C+  S  +H    + S+ +      +DY G
Sbjct: 307 FQKTFIVLDTEHVPATTKYIIYMFLGAGIKCMFASVFWHTFNGTTSIRLRPKFCCVDYTG 366

Query: 170 IVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
           I  LIS S++S  Y   YD     S +                 P F S E R  R   F
Sbjct: 367 ITLLISASIMSAEYITLYDYPKAMSFYMILSGIFAVFGLYLNWSPKFDSPEARPLRIKFF 426

Query: 230 TAFGLSGLLPVITSCFYYGPIEA---YSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
                 G L  +      G   A   +S +  K +    + YI G   YG   PE+  
Sbjct: 427 VLLAAVGGLSFVNLVCLEGLSRAIWLFSPVTNKSV----IYYIIGVFFYGSFIPERFR 480

>KNAG0B05100 Chr2 (976101..977717) [1617 bp, 538 aa] {ON} Anc_5.197
           YLR023C
          Length = 538

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 100/235 (42%), Gaps = 10/235 (4%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIAL-- 111
           +LP   ++N +I+  Y R  +S  K+  S    +  HNE+ NI+SH +     +++A+  
Sbjct: 221 ELPFPWRENRYIIHNY-RFYDSNVKSLLSAINWYGWHNETSNIWSHFLGFFYVVYLAVYE 279

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           F + VV            ++ IFL  A+ CL  S  +H     + L++      +DY GI
Sbjct: 280 FPQSVVFQSDRIPSSAKFVVYIFLFAAMKCLIASAFWHTFNGTAFLKMRRRFACVDYSGI 339

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +    D   M  L+                 P F + E R  R   F 
Sbjct: 340 SILITASILTAEFVTLNDHRPMMILYMTISLTLGIIGVFLNCSPQFDTPEARPLRIRFFM 399

Query: 231 AFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVL-YISGAVLYGVRFPEKLE 284
                G+L  I +   Y    AY+   L  ++ + ++ Y+ G V YG   PE+  
Sbjct: 400 LLAAMGVLSFINAS--YLESWAYAVDLLSPITNKSIVWYLVGVVFYGSFIPERFR 452

>AAL153C Chr1 complement(75086..76345) [1260 bp, 419 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR023C
          Length = 419

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 121/310 (39%), Gaps = 45/310 (14%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPG--ICFLFIAL 111
           +LP   ++N +I+ G+ R  +S+RK+  S+   +  HNE++NI+SHL+    + +L    
Sbjct: 109 ELPYAWRENRYIIYGH-RFYHSHRKSLLSVLNAYGWHNETINIWSHLVGAAVLAYLLCWG 167

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           + +  V   +         I  FL   V C+  S  +H       L++      +DY GI
Sbjct: 168 WPRSDVYRAAQVPRLAKWAIGAFLACGVKCMASSVAWHTFNGTCHLKLRSRFVCVDYTGI 227

Query: 171 VALISCSMISQMYYGFYD-STAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
             L++ S+++ +    Y  S  +   +                 PHF   E R  R A++
Sbjct: 228 TLLVTASVVTTVAVTLYGLSRPLMYAYMVASIGLGTAAGVMNWSPHFDRPEARPLRIAVY 287

Query: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEK------- 282
                 GL+  +          A+    L + SL  V Y  G V Y    PE+       
Sbjct: 288 VGLAALGLVSFVHVWMQVRWASAHLMAPLVYKSL--VWYGIGVVFYATLVPERWRSDVTL 345

Query: 283 -----------------LEPGS-----------FDIWGHSHQLFHVLVVIAALCHLRALL 314
                            L P +            D + HSH L+HV VV+  + H RA+L
Sbjct: 346 DCCSGPVHEAACRQFRDLPPVARKDRQFWSLWWVDYFCHSHFLWHVFVVLGVVGHYRAVL 405

Query: 315 SCYKNVHTNA 324
              + V  +A
Sbjct: 406 QMSRIVWLDA 415

>YLR023C Chr12 complement(185498..187129) [1632 bp, 543 aa] {ON}
           IZH3Membrane protein involved in zinc ion homeostasis,
           member of the four-protein IZH family, expression
           induced by zinc deficiency; deletion reduces sensitivity
           to elevated zinc and shortens lag phase, overexpression
           reduces Zap1p activity
          Length = 543

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 100/238 (42%), Gaps = 16/238 (6%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPGICFLFIAL-- 111
            LP   ++N +I+ GY R  N++ K+  S+F     HNE+ NI+SHL+  I  +++A+  
Sbjct: 220 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAIYIIYLAIYD 278

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           F +  V   S    +   ++ +FL  A+ C+  S  +H     S L++      +DY GI
Sbjct: 279 FPQSEVWRNSQVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 338

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +   Y        +                 P F   E R  R   F 
Sbjct: 339 TILITASILTTEFVTMYSCYWAMYTYMSISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 398

Query: 231 AFGLSGLLPVITSCF----YYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
                G+L  +   F    +Y     +S +  K +    V Y+ G V YG   PE+  
Sbjct: 399 LLATMGVLSFLHLIFLTDLHYAAT-LFSPVTYKSV----VWYLVGVVFYGSFIPERFR 451

>Skud_12.91 Chr12 complement(177334..178962) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 99/243 (40%), Gaps = 26/243 (10%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIAL-- 111
            LP   ++N +I+ GY R  N++ K+  S+   +  HNE+ NI+SHL+  +  +++A+  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIINWYGWHNETSNIWSHLLGAMYIIYLAIYD 277

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           F +  V        +   ++ +FL  A+ C+  S  +H     S L +      +DY GI
Sbjct: 278 FPQSEVWRNPNVPQQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLRLRSKFACVDYSGI 337

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +   Y        +                 P F   E R  R   F 
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGVIGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 231 AFGLSGLLP-----VITSCFY----YGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPE 281
                G+L       +T  +Y    +GP+  Y  +         V Y+ G V YG   PE
Sbjct: 398 LLATMGVLSFLHLIFLTDIYYASRLFGPV-TYKSV---------VWYLVGVVFYGSFIPE 447

Query: 282 KLE 284
           +  
Sbjct: 448 RFR 450

>TBLA0C06050 Chr3 (1468152..1469465) [1314 bp, 437 aa] {ON}
           Anc_5.197 YLR023C
          Length = 437

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 99/245 (40%), Gaps = 34/245 (13%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIALF- 112
            LP   ++N +I+ GY R  +S  K   S+   +  HNE++NI+SHL   +  L+IA+F 
Sbjct: 118 QLPFPWRENRYIIKGY-RFYDSNVKCLLSVVNYYGWHNETLNIWSHLGGFLTLLYIAVFV 176

Query: 113 ---NKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMK---SHSLEVSVFGNKLD 166
               +   ++   TT K  +++ +FL+  + C+  S  +H      S++L        +D
Sbjct: 177 YPNTEVYQSELIPTTAK--MLLFVFLIAGMKCMLASVFWHTFDGTCSYTLRPKFCC--VD 232

Query: 167 YIGIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRA 226
           Y GI  LI+ S+++  Y     +     ++                 P F   E R  R 
Sbjct: 233 YTGITILITASILTAEYVSLSHAPIWMFIYMSLSLALGTFGVYINWSPKFDGPEARPLRI 292

Query: 227 AIFTAFGLSGLLPVI---------TSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGV 277
             F      G L  +          +C+   PI          +S   + Y+ G   YG 
Sbjct: 293 KFFVTLSAMGCLSFVHLIFTTSLRHACWLLAPI----------ISKSTIWYVIGVFFYGS 342

Query: 278 RFPEK 282
             PEK
Sbjct: 343 FIPEK 347

>Smik_12.86 Chr12 complement(172288..173916) [1629 bp, 542 aa] {ON}
           YLR023C (REAL)
          Length = 542

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 95/234 (40%), Gaps = 8/234 (3%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPGICFLFIAL-- 111
            LP   ++N +I+ GY R  N++ K+  S+F     HNE+ NI+SHL+  +  +++A+  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHSKSLLSIFNWYGWHNETSNIWSHLLGAMYLIYLAIYD 277

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           F +  V        +   ++ +FL  A+ C+  S  +H     S L++      +DY GI
Sbjct: 278 FPQSEVWKNPKVPPQARWIVFMFLAAALKCMLSSVFWHTFNGTSFLKLRSKFACVDYSGI 337

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +   Y        +                 P F   E R  R   F 
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMGISLALGIFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 231 AFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
                G+L  +   F    +   +R+         V Y+ G   YG   PE+  
Sbjct: 398 LLATMGVLSFLHLIFLTD-LRYAARLFSPVTYKSVVWYLVGVAFYGSFIPERFR 450

>Suva_10.104 Chr10 complement(191663..193288) [1626 bp, 541 aa] {ON}
           YLR023C (REAL)
          Length = 541

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 96/238 (40%), Gaps = 16/238 (6%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIAL-- 111
            LP   ++N +I+ GY R  N++ K+  S+   +  HNE+ NI++HL+  +  +++A+  
Sbjct: 219 QLPFPWRENRYIIHGY-RFYNTHYKSLLSVINWYGWHNETSNIWTHLLGAMYIVYLAVYD 277

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           F    V        +   ++  FL  A+ C+  S  +H     S L +      +DY GI
Sbjct: 278 FPHSEVWQNPEVPQQARWIVFAFLAAALKCMLSSVFWHTFNGTSFLGLRSKFACVDYSGI 337

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +   Y        +                 P F   E R  R   F 
Sbjct: 338 TILITASILTTEFVTMYSCYWAMCTYMTISLALGVFGVFMNWSPRFDRPEARPLRIRFFI 397

Query: 231 AFGLSGLLPVITSCF----YYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKLE 284
                G+L  +   F    +Y  I  +S +  K      V Y+ G V YG   PE+  
Sbjct: 398 LLATMGVLSFLHLIFLTDLHYA-IWLFSPVTNK----SVVWYLVGVVFYGSFIPERFR 450

>Ecym_7109 Chr7 complement(210829..212535) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AAL153C
          Length = 568

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 71/316 (22%), Positives = 124/316 (39%), Gaps = 61/316 (19%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSLFYL---HNESVNIYSHLIPGICFLFIAL-- 111
           +LP   ++N +I+ G+ R  +S++K+  S+  +   HNE++NI+SH+   I  L+I L  
Sbjct: 244 ELPQPWRENPYIIYGH-RFYHSHKKSLLSILNVYGWHNETINIWSHIAGAIILLYIMLRG 302

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIGI 170
           F    V + +         I +FLL  + C+  S ++H       L +    + +DY GI
Sbjct: 303 FPNSDVFNSTQVPKVAKGAIYVFLLCGIKCMVSSVMWHTFSGTCHLPLRSRFSCVDYTGI 362

Query: 171 VALISCSMISQMYYGFYD--STAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
             LI+ S+++   +  Y     AM+ L+                   F   + R +R A 
Sbjct: 363 TILITASVMTTEAFTLYRLAPKAMY-LYMGISLCLGVFAAFTNWSRRFDGPDSRIFRVAF 421

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVL-YISGAVLYGVRFPE------ 281
           +      GL+  +    +     + SR+ +  L  + ++ Y+ G V Y    PE      
Sbjct: 422 YVILAGLGLISFVHLTVHSD--WSSSRLMITPLINKSIVWYLIGVVFYATLVPERWRSRI 479

Query: 282 -------------------------------KLEPGSFDIWG-----------HSHQLFH 299
                                          K +P   D  G           HSH L+H
Sbjct: 480 LLSHPVQNPVDTNFPSSDSNIPSENIDNIHFKSKPKESDQLGFWSLWWVDYFCHSHFLWH 539

Query: 300 VLVVIAALCHLRALLS 315
           + VV+  + H RA L+
Sbjct: 540 IFVVLGVVGHYRATLA 555

>KNAG0K00670 Chr11 complement(119419..120384) [966 bp, 321 aa] {ON} 
          Length = 321

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 92/218 (42%), Gaps = 15/218 (6%)

Query: 101 IPGICFLFIALFNK-YVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSHSLE-- 157
           +  + F+ +  F   Y+V  + +TT  DY+++++FL  A         + C   H ++  
Sbjct: 102 VTAVYFVLLVFFTDVYLVPRHVSTTMTDYVLLNVFLATA---------FQCAACHMVQCF 152

Query: 158 VSVFGNKLDYIGIVALISCSMISQMYYGFYDST---AMFSLFXXXXXXXXXXXXXXXXXP 214
            +  G+ L  I ++   +CS ++ +YY +YD+     + +LF                  
Sbjct: 153 TTTAGSVLSTITMLNHWACSAVTLLYYSYYDNVFYFKLLALFTANWTLVVAAVTVTSTAS 212

Query: 215 HFRSREWRKYRAAIFTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVL 274
           +   R+W   R  +     +   +P++     +G  +   R+  + L  E  +Y+   V 
Sbjct: 213 NSPKRQWWSRRTLLLVYVVVLVSVPLVVGLLRFGTAKVLRRLDWRLLLAELAVYLISGVF 272

Query: 275 YGVRFPEKLEPGSFDIWGHSHQLFHVLVVIAALCHLRA 312
           YG    + L    F +  H+  L H+ +++ A   +RA
Sbjct: 273 YGGTEKDTLPKLPFYVAFHTASLIHLQLLLNAFHLMRA 310

>ZYRO0B10538g Chr2 complement(830311..831906) [1596 bp, 531 aa] {ON}
           some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 531

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 101/237 (42%), Gaps = 14/237 (5%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIALFN 113
            LP   ++N++I+ GY R   S++K+F S+   +  HNE+ NI++HL+ G+  +++A ++
Sbjct: 209 QLPFPYRENKYIIHGY-RFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYH 267

Query: 114 ----KYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMK-SHSLEVSVFGNKLDYI 168
                  ++D      K   ++ +FL  A+ C+  S  +H    +H L +      +DY 
Sbjct: 268 FPHSNIWLSDRVPKPAK--CIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYT 325

Query: 169 GIVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAI 228
           GI  LI+ S+++  +   YD       +                 P F   E R  R   
Sbjct: 326 GITILITASILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKF 385

Query: 229 FTAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVL-YISGAVLYGVRFPEKLE 284
           F      G    I   F       Y+   L  L+ + V+ Y+ G   YG   PE+  
Sbjct: 386 FILLATVGCSSFIRLVFLTN--WRYAADLLTPLTNKSVVWYLIGVFFYGSFIPERFR 440

>CAGL0D03322g Chr4 complement(340949..342586) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q07959 Saccharomyces cerevisiae
           YLR023c
          Length = 545

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 102/234 (43%), Gaps = 12/234 (5%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIALFN 113
           +LP   ++N  I++GY R  NS++K+  S+   +  HNE+ NI++HL+ G  ++   +F 
Sbjct: 218 ELPFPWRENRCIINGY-RFYNSHKKSLLSIVNWYGWHNETSNIWTHLL-GGLYILYLMFY 275

Query: 114 KYVVAD--YSTTTWKDYLMID-IFLLGAVVCLTLSGVYHCMKSHS-LEVSVFGNKLDYIG 169
           ++  ++   S    K   +I  +FL+ A  CL  S  +H     S L +      +DY G
Sbjct: 276 QFPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYSG 335

Query: 170 IVALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIF 229
           I  LI+ S+++  +   Y        +                 P F   E R  R   F
Sbjct: 336 ISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRIKFF 395

Query: 230 TAFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVL-YISGAVLYGVRFPEK 282
                 G+L  +   F      ++S   L  ++ + V+ Y+ G V YG   PE+
Sbjct: 396 ILLASMGILSFLHLTFITS--LSHSTWLLSPITKKSVVWYLVGVVFYGSFIPER 447

>TDEL0E04320 Chr5 complement(804655..806007) [1353 bp, 450 aa] {ON}
           Anc_5.197 YLR023C
          Length = 450

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 110/313 (35%), Gaps = 52/313 (16%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIAL-- 111
            LP   ++N  I+ GY R  +S+ K+  S+   +  HNE+ NI++HL   +  L++A+  
Sbjct: 136 QLPFPWRENRFIIHGY-RFYDSHYKSLLSIVNWYGWHNETANIWTHLGGALYVLWLAVYD 194

Query: 112 FNKYVVADYSTTTWKDYLMIDIFLLGAVVCLTLSGVYHCMKSH-SLEVSVFGNKLDYIGI 170
           F +  V +          ++ +FL  A+ C+  S   H       L +      +DY GI
Sbjct: 195 FPRTSVWESEQVPMVAKCIVYVFLAAALKCMLASVFGHTFNGTCCLALRSKFACVDYSGI 254

Query: 171 VALISCSMISQMYYGFYDSTAMFSLFXXXXXXXXXXXXXXXXXPHFRSREWRKYRAAIFT 230
             LI+ S+++  +   Y+       +                 P F   E R  R   F 
Sbjct: 255 TMLITASILTTEFVTMYNYPWSLRFYLAVSTVLGIFGVIMNWSPKFDRPEARPLRIKFFI 314

Query: 231 AFGLSGLLPVITSCFYYGPIEAYSRIQLKWLSLEGVLYISGAVLYGVRFPEKL------- 283
                G L  +      G   A S +         V Y+ G   YG   PE+        
Sbjct: 315 LLAAMGGLSFMQLGLLGGWKYA-SWLMAPVTHKSLVWYLLGVAFYGSFVPERFRTDIVVD 373

Query: 284 --------------------------EP---GSFDIW--------GHSHQLFHVLVVIAA 306
                                     EP      D+W        G SH  +H+ VV+  
Sbjct: 374 KRIPTEQELSTSLEVVTRHKHVHFRPEPTAGARTDLWSLWWVDYVGCSHSWWHLFVVLGV 433

Query: 307 LCHLRALLSCYKN 319
           + H  A++  + N
Sbjct: 434 VGHYHAIIDMFAN 446

>SAKL0G12980g Chr7 complement(1108751..1110442) [1692 bp, 563 aa]
           {ON} some similarities with uniprot|Q07959 Saccharomyces
           cerevisiae YLR023C IZH3 Membrane protein involved in
           zinc metabolism member of the four-protein IZH family
           expression induced by zinc deficiency deletion reduces
           sensitivity to elevated zinc and shortens lag phase
           overexpression reduces Zap1p activity
          Length = 563

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 69/151 (45%), Gaps = 13/151 (8%)

Query: 57  DLPDWQKDNEHILSGYVRETNSYRKTFRSL---FYLHNESVNIYSHLIPGICFLFIALFN 113
           +LP   ++N  I+ GY R  +S+ K+  S+   +  HNE+ NI++HL   +   ++A + 
Sbjct: 236 ELPFPWRENRFIIHGY-RFYHSHTKSLLSILNWYGWHNETTNIWTHLFGSLYIAYLAFYE 294

Query: 114 KYVVADYSTTTWKDYL--MIDIFLLGAVVCLTLSGVYHCMKSH-SLEVSVFGNKLDYIGI 170
               + Y +     +   M+ +FL     CL  S  +H       L +      +DY GI
Sbjct: 295 FPQSSVYLSGDVPQFAKYMVYLFLGAGFKCLVSSVTWHTFNGTCKLHLRSKFACMDYTGI 354

Query: 171 VALISCSMISQMYYGFY------DSTAMFSL 195
             LI+ S+++  +   Y      +S   FSL
Sbjct: 355 TVLITASIMTAEFVSLYGNGDNPNSPVTFSL 385

>KLLA0F19888g Chr6 complement(1839682..1854429) [14748 bp, 4915 aa]
           {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
           YLR106C MDN1 Huge dynein-related AAA-type ATPase
           (midasin) forms extended pre-60S particle with the Rix1
           complex (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent
           remodeling of 60S subunits and subsequent export from
           nucleoplasm to cytoplasm
          Length = 4915

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 22/46 (47%)

Query: 65  NEHILSGYVRETNSYRKTFRSLFYLHNESVNIYSHLIPGICFLFIA 110
           N H L   + E  SY K FR      N  +N  S LI  +C +FIA
Sbjct: 229 NYHSLPNEINELVSYPKNFRPTGKSFNIDINELSSLIVEVCGVFIA 274

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,437,603
Number of extensions: 1245772
Number of successful extensions: 3998
Number of sequences better than 10.0: 75
Number of HSP's gapped: 3976
Number of HSP's successfully gapped: 77
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)